2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR H BINDING PROTEIN
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
2W81C 4AYID 2Y7SA 2YPVA 3HOEA 4O49A 4Z3TA 4AYDC 2KC0A 3KVDD 3PQUA 4QQ1A 3UAQA 4AYMC 4O4XA 5T5FA 4O4UA 4O3ZA 4AYEC 5EE2A 4O3WA 2KDYA 4O3YA 3VE2A 3HOLA 3V8UA 4U9CA 3PQSA 4O3XB 2W80C 4AYNA 3VE1A 1YS5A 2LFUA
chains in the Genus database with same CATH superfamily
4MCZA 5CSGA 4QCIA 2X10A 3CDCA 3L5JA 5IFJA 2DLHA 3DGCR 2GYSA 1LP9F 4ODSH 2VLJA 1PKOA 2X1XR 4RDBA 1YNTF 3EYFB 1Q94A 2WXMA 4TLSA 1CK0H 2N1TE 4C83A 1HZHL 4FFYH 5DF0A 3O9WC 5ESVA 3TVMA 4F15B 3DJZA 5FYJD 4ZOCA 4PW9A 1KPUB 4IIQB 2OYLA 2ATPA 2W0FB 1X4XA 3GLEA 4KGLA 4G9DB 4O2EA 5C3TA 3VFMA 3CZLA 4QXTA 1OY3B 3F7VA 2CHNA 3ZKNC 4BM7A 1E9QB 2NY3C 1UFUA 2JH2A 4L23A 4FT6A 2F5BH 3MGOA 1J11A 3RGVC 4EQ2A 4K5NA 3FB5A 2H2SD 1D9KD 3CFUA 4H8QA 3KNBA 4LGRB 4MZRA 3PHOB 1MHCB 5IK3B 3IPBA 1ANUA 4HF5H 4BH7A 1J8HD 4R26L 4OIIL 4Y4HB 5C08A 4QRBA 1SVBA 15C8L 3K1DA 3HAEG 4U1IA 3WN5A 4GIOA 1KT2A 2FBRA 4Z7QF 3OHMB 3RQ3A 3HS8A 1A9BB 1DUZB 5EZLB 2VDRH 3ZE2E 3D34A 3OKOA 2AV7B 2HKHH 3KCPA 3KL3A 3O8XB 3ULSB 5H35B 2YAFA 3EGXB 3IJEA 3KYNA 3WG7B 4ELKB 3V4UH 1U95B 1FAIH 3MOAL 2IGTA 4NO3B 1JZFA 2C7FA 3TTSA 4ABVA 2CO4A 4GI9A 5T5NF 4N26A 3OAZK 1PVHA 3II3A 4G6KL 2NXZB 5E4AA 4UTAH 2H4EA 2OL3L 2ZG3A 3GS4A 3C60C 5BRZA 1QASA 1ORQB 4DQOL 4YHKL 4M61B 4WU7B 4FQ2H 2CZNA 1LL1A 3QORC 3NJFA 1ZHKA 5K59E 5D8JH 4YSTA 1BIIA 2WSPA 2OZ4A 4FLSA 2VLLB 4S1DD 4Y1AA 5DL8A 5IROC 5J06A 2CLZB 4GAGL 3UTZB 3FTYA 1ROWA 4PJGA 4X5PA 1A3RL 1TQBB 5ID0B 1QJ8A 1FF5A 1Q9GA 3MUUA 4H40A 1SF3A 4LNVA 2BVOB 4W9HC 4MD5A 3EJJX 3LYRA 1JWMA 3W39A 1T21A 3HNTH 4FP8L 4Y5VA 1J9TA 3LZOA 4MJID 4NNXB 1TR7A 1QA9A 3DX9A 2JJTC 2NW3A 1NC4A 3BD4A 2CDFB 1IEBA 1P9MC 5C3LD 4WY7L 3OGCB 3T24A 1MQKL 2DQIH 4MA3A 4J3WA 4DAGH 3K6NA 1F90H 2JIXB 4XXWA 4RFNC 2BX5A 4JHBA 4RBPK 2D3NA 5FIEA 1FP5A 1W0WB 2AZUA 4LCWA 2MQ0A 3MCLL 1YMHA 4KR8A 1AXSB 3MV8B 4GBXB 1IKNC 1WBYA 4NZTH 4OQTH 1RXLA 2XNAB 5D71H 5H2BA 3C5OA 5HHNA 3ZRCC 2X1WL 4G9FB 1RZJH 3G6JF 3N85L 4GNKB 1NKRA 3RL2B 2H3NA 3ARDA 5C0BA 5H94B 4YIQB 2ICEC 5A40E 1FDLH 4ABUA 5DRXB 4YUEH 1U58A 2OMYB 2E9IA 3VDCA 1U3JA 3UMNA 1YQVH 5HD8C 3AAAA 2IC2A 4KZCA 1CTMA 1OK8A 1DBMH 3TV8A 2PW1A 3L3GA 2G60H 2DL2A 2BMKA 1MUJA 1UD4A 3O4OB 2GTQA 3GBEA 4PWHA 5E8EA 2CBMA 5F1SA 2WKLA 4OKVB 4ZMYA 3VFTA 3CXFA 2FEJA 4HUVA 3K6IA 1A4JB 3HMXA 3WY1A 1EANA 5FYJU 3QJRB 3A2SX 4F57L 3CFDB 2VGLM 2CUAA 3T4AA 2CALA 3D0VB 1P5UC 2R0ZH 3INUH 4NCC2 3K72B 1YEKH 1ZDQA 1B0WA 1U92A 3GRGA 2IFGA 5D7IB 4AEHL 4LMQI 3DV4A 3FTWA 3WEMA 1PS3A 5HGBB 2RH0A 3VFSA 3CJJA 5C3IA 1XEUA 3Q8FA 3CBJB 4O4UA 3L9RB 2EXYD 1VCBC 4WTZG 4D9LL 1M7IA 5C0JA 3UYRH 3NAAL 1QEXA 4FFZL 3WOVA 1FGNL 3DXAD 3JCUO 2NY7H 3NCWA 2QHLA 1AC6A 1XCQA 5EMYA 1NCWH 3JWNG 1Z5LB 3CTTA 3BZ4B 4YDMA 1SEBA 4Y4HC 1A0QH 3PP4L 4QRUA 4WTQA 3WNPA 1B2WL 4AKRB 4P07A 4FQPA 1XGUA 1QRND 2D0HA 5LXGL 3WI5A 2HWZH 3AREB 4LSUL 4X4KA 4K2UL 3KZIO 3V7AE 5C2BL 1YEHH 4PREA 4ZO9A 1DLFH 3NRQA 3EOBA 2JCCB 1T1ZB 3IDUA 5I23A 5J11B 5GZOC 3B8YA 4ZXBA 3LCYA 2NMSA 1XH3A 5I76B 2X4NB 4FE9A 1CI3M 4K71C 3JQOB 3NIDB 2AS5M 1E3ZA 1I4FB 2FJSA 4FYTA 4U9CA 2L4OA 3X12A 4XP6L 3HI6L 1KBKA 3ZN6A 1FZKA 1E7UA 5SX4I 4Y4KC 5EEYA 2QL1A 1G5GA 3APFA 3B3BA 4NUJA 1MJ7L 2RIKA 5KBDA 1IM3D 5A43C 3DTXB 3SGJC 2YUVA 3KEDA 5KYWA 2GTWB 2V37A 3MV8E 4UCFA 4Q8BA 2CHZA 2LAAA 3B9KC 5BW7C 3O2VH 1KWKA 4L3AA 3S8WA 1D5ZA 2F19L 3EFDL 2APWA 3V9CA 3EDKA 1CVSC 1RJZB 2ATAA 4K23L 3HOEA 1KIQB 2F5AH 4MTMA 3DI3B 3TZVC 3BP4B 3K2IA 5AFUL 1VZGA 1LJMA 1SYVA 4CVWA 4I9XA 4ZO8A 1IC4H 1X7TA 2AI0H 1MKFA 3ZYIA 1JHKH 3X14A 2VC2L 1Z9PA 3L3OA 1NICA 3M17A 5C0RH 3QAQA 1A3QA 1MAKA 4DCQA 3MRJB 2XV2A 3FRUA 3ARFC 5AZ2H 3MV9B 3PDOB 5KSAA 3KVPA 5AAMA 4PRHD 1WZKA 4NQEB 4U3SB 5JW3H 4XI5D 1TJHH 2YSSA 1LO0H 2QPEB 3WIHA 2OZ4H 5D7IE 4QXGL 3QCUH 4IGBB 1U30A 2IH1B 3L54A 5E1HB 2IXQB 1HNFA 4I1PA 1Y6NR 3AG3B 5I30H 1LEKB 1QZNA 1MELA 2Z8SA 3C5SA 1IJ9A 4YHMH 2OMVB 1UB5B 1JPSL 2FJFA 1AG6A 1CTNA 1OE2A 4HC1H 4PW3A 5TH2B 1PSKL 2DKSA 3JV4B 5E03A 5B1JC 5GS2H 3HI5L 2JKXA 4LCCC 3V6OA 1EO8H 2Y2XA 2K3HA 3OXRA 4ORGB 5EU7E 4R2GB 1PMYA 3Q2LA 4NXSA 4QTIH 3ABMB 3LEXA 3M6DA 3CLFH 3WBDA 3IBOA 1KULA 1Q9KB 4DUXA 5FO9B 3B8SA 1E4HA 5EZJA 5D7EA 3VO0A 1JXJA 1L5GB 1GTFA 5IIEB 5I1JL 1WIPA 2EKJA 4JFDB 3VWJC 2LVCA 5D7LA 4FQCH 2MNHA 1DCLA 4S1RH 1A5FL 2Y5QA 2JCCE 2C9RA 4ADJA 3F05A 5DWUH 3VW3L 3EJPA 1I1FB 4ZFOA 3NIDE 2HFGH 4BE5A 3T6QC 2NYYC 3TYGH 1PPIA 4M4RA 4XXCC 1MCDA 2WYZA 3VB8A 5AW0B 5CEZE 2J5LB 2SEBA 2MCPH 1INQA 4U2YA 3X1GA 5DO2D 2PCPB 1WA1X 5F7EH 1YDPB 1BQLL 1JVKA 3TJEH 1QATA 2WMPA 3WNJA 2HFFB 1FL5A 1WV7T 4V1DB 3SGEI 4JL1A 5DLMH 2E74C 2P49B 2NY5H 4DP6X 4F33A 2FZ3B 1KEGL 4AGOA 4QRQB 3U4AA 3H55A 3IWVA 4OF7A 4URKA 1OF0A 5EU6B 3ZQWA 2G5RA 2IGFH 1GS8A 3I50H 4JY4B 2CDEA 4OCRH 3PWUB 3U6XS 4BXSV 4EN3D 1RPUA 1RK0A 3A23A 5H2FO 3T0XA 5AW9B 4LEOB 2L7QA 4MCYA 5DZJA 3PQYA 4MQSB 2NUTB 3GMRB 4UM9A 3V9FA 4AG4L 4RQQB 1VFUA 1TQUA 2YD7A 3O45A 3P40A 4G8IB 5I1GH 4BQBA 5I19H 5K39B 5DZAA 3L8QA 1HINH 5FR3A 4HT1L 4GSQA 4EVNB 5FW8A 1RUPL 1D7FA 1Z5HA 1T5WA 2B9BA 4G1MA 5F7LB 1IZNA 4AVHA 1FYTD 3A67L 4Q9CA 1NM9A 1PG7W 5MI0C 5F1KC 2KPWA 3MV9E 3SN6N 1OGTB 2XN9D 3BEWA 1CE1H 1I8IA 4RWYL 5J56B 4NQEE 3X1EA 5JTWA 2AANA 1BQHB 3RWJB 3ZT7A 2Y6SC 2AMGA 3PGFL 4MMXA 1N0XL 5SV3A 4XVUC 3RTQD 5A2IH 3AT8A 5JW4Q 2BK8A 4XZUB 2IAMA 1JGLH 3V0JA 4HZAA 2BCKB 2DH3A 1TJMA 2BINA 5EF2A 4RLCA 4JN2B 2WHVA 4Q89A 1JDAA 1IARB 2DB8A 4DHLA 5KVDH 4LQFL 2AV1A 1CLOH 4OCNC 3WTVA 4XAWH 4IOFD 3V0EA 5FO2A 3Q5OA 3KPOB 3GSVA 1YN6B 2DBLL 4UT6A 1JK9B 2WLLB 3P54A 3SE8L 4GG8A 1F41A 3SD5A 2F61A 5G39A 1AY1L 5HGHA 1MFBH 4F37F 3WTYA 4JFDE 3HN8A 3WFDH 3KLAA 1NFDA 1R33A 3L1OL 3O3AB 3X1FA 2ALWA 4O9HL 3L16A 1FLRH 5ALBL 3FTSA 1MCEA 3NTCL 3V0VA 2PP8A 2Y7MA 4FQXA 2NPLX 5KN5A 1C9SA 4LIQL 3NN8B 4P4RB 5BQDA 1EWHA 1AANA 3B5HA 5E95B 2Q8BH 3MYJB 4LEBA 4UQ9A 3MAWA 2ZXGA 1P1ZA 5D1ZI 1NWOA 4FXTA 5AW3B 2UUDH 1OSZB 4N1CA 3UL4A 2YMTA 1YEFH 3BSZL 2VLKE 2R4PA 1X5LA 1MF2H 1X5KA 3IGKA 3BWAB 3T09A 4XXDA 4I8DA 1RUAH 1RUQH 3VDBA 5L88L 3ZDYF 4JGMA 1K3IA 3MLSL 3VE1A 4V1DE 3ZKMC 2COQA 3UEQA 1BM7A 4OV5B 3RY6C 1G7HA 4XCFH 4LQ1A 2K6WA 3EHBC 4PJ9B 2BIOA 4WJ5B 5BCAA 4TSBL 5EU6E 3MO1A 2PPDA 1XD0A 3SGDI 2M07A 3VY8X 2NR6D 3K7UA 4KK9D 2WYHA 5I9QB 3WXWH 2D03L 1HEZA 1UADC 1AR2A 1MNNA 1FNGB 2NNCA 5BRPA 5LN8A 4DPAX 4TTGA 1BYNA 3AS1A 4ZDHA 3U7YH 2WM0A 1KXVA 4AEEA 5IVZB 2Y0HA 2PLTA 3MJ7B 1DZ0A 1T20A 1UWFA 4RFOL 5INDA 1E5CA 3O3EA 4XPHH 2AGJL 2QGBA 3PS6A 1OM9A 4KDWA 4OZGA 3SDAA 1YPZF 2WKOA 5KTEL 1LO2H 5M7QA 3HRPA 5DJ2A 3CHSA 4DKAA 5IW3A 3VNZA 3PRZA 4PFEA 5FV2A 3ZHFA 3NABH 3HR5A 3C09C 5JZ7D 4KUCF 4M7JL 4QHUB 3FHAA 2FCBA 5JA9A 2UWEB 3BS0A 4J3OD 1KIUA 5I8CB 1RHHB 2MQ3A 4HJUA 4PUBL 3MLRH 1XX9C 5ELIA 3HZYA 3HIZA 3VGEA 5GGTA 2JKWA 1RIVH 1SHSA 2PN5A 3IK2A 2FD6L 3T4YA 3L4ZA 3CFJB 4ODHH 3ZMRA 2OXGA 3DRTB 4P8QA 5B8CA 3R4RA 4X80L 2XZAL 4N6RA 5DJDA 3DA0A 3KPPA 3SPGA 3L7EA 4AQZA 4DSYA 3SYOA 4XNMB 3WJMB 3V7MA 4PJBF 5EBMB 1H15B 4HIHA 1RUKH 3H3PL 5FHAL 1S7UA 4YEFA 1P7KA 4D3CH 1FFOB 1DVQA 2GJZA 1KGUA 4MVBC 3PIQA 1H6S1 2RQ8A 2XWEA 2EDLA 4FD0A 4XB7A 3UC2A 4LOUD 1FFPB 1U8JB 1BD2A 2H1XA 4PRNB 3KJ4B 1B88A 1CZ8H 5FA3A 2DLFH 3RX7A 1J10A 3SZ6A 2EH7H 4HZLA 2V5TA 3KPLB 2MMXA 3Q0HA 3ZKSD 3RNQB 5D1ZD 2QSVA 2Y1ZA 3NZ8A 5CZXC 5BZZA 3FSOA 1N26A 3SY7A 2NY4B 1ACYL 4FULA 5FGRA 3CN0A 1I1YA 3JTTA 2EUZA 2WSDA 4DKFH 4ZTOH 4A7TA 3GPEA 4M6NH 2O5XH 1UJ3C 3N42F 4YFLI 3K6SB 4WW2C 3DX6B 3NDYE 3QJQB 5I73B 5IEHB 5AZEL 2J4UP 1RJYA 1IBBA 1NZRA 1P84K 4JQVC 4G42A 4H8WL 5HDRA 1FPTL 1TETL 2MQGA 3LH8A 4MRBA 2OAAA 3DA3A 3BUDA 3Q2VA 3HCVB 2XV3A 2R2CA 3QXDB 5DJXB 3PPEA 3S96B 4L1LA 4U1LB 3IU3A 5EEWA 2R2BA 3Q5TA 4OFDA 3I75A 5A3ID 5JIHA 2Z9TA 4XN8A 1DQLH 4POYA 3PGRA 1YLBB 1I1AC 3CXDL 3B2PA 2QMJA 1TITA 1FO0L 1MIEL 4LLWB 1JGIA 5DRNB 4CSPA 3F84A 4PP1D 1QLFB 4CTDA 2F08A 3T5WA 4A38A 4WIQA 5G4OA 4X0KA 2XQ0A 3DBXA 5E4EB 3MUJA 4C4VA 2HT4C 2QKIC 5DQ9B 3S34L 3HNSL 4H88H 5LNEA 1NCTA 1CDUA 3BLKA 2IMMA 1JNLL 3K0YA 3LHPL 2VR9A 4YVNA 5I6MA 4G5ZH 2YD8A 1FRGL 3AWGA 4K3JL 1OALA 2NYZA 4NB7A 1SEQL 4NQCA 4NUGL 4RNRA 4UIKL 2K78A 3K8KA 3SO3C 3WLWD 1PCSA 2O93L 1PX8A 3R7RA 2OJ1A 2JELH 2AK4A 4UT6H 4D94A 5BNXD 2UWEE 1AP2B 1G7PB 1RURL 1VA9A 2ITCB 4G1EA 3QH3B 2WLHA 1USQA 4NT6A 5I0VA 3OX8B 3BO8B 4N8VA 5DD1L 3IEAA 5DVOA 1KGXA 1I31A 1PQZA 3BZDA 4OF3A 1H8OA 2HP4A 2QDWA 2UVFA 1S7WB 1KJVB 4XP1H 1BOYA 2WVTA 2YEQA 1T7ZA 1A6WH 3IGUA 2QPFA 2CHDA 4L8SA 4Y5XB 5ICUA 3ZE0F 4DEWA 1GJWA 5T1JA 2NY6C 1RMFL 5KJ7E 5J7CC 4OLZL 1S7RB 4R4FL 3BHBB 2WZ0A 1BZDA 3CFEB 5K9JH 1BXUA 3DWTA 3KGTA 3L7FA 3L4CA 4CSZA 3NQIA 4XNQB 3RHWF 2R29A 2O61B 4XCYA 4XBGA 3DECA 4FXGA 2K4WA 1BQKA 3UX9B 3VUAA 1MCBA 1WP6A 1DJHA 4GRLA 3FSAA 4WUKH 2FL5B 5GTHO 2RJMA 3GRBA 1FBIL 1ZSDB 4LLYB 3TBSB 5ITFA 3CSBA 5C0CD 2KYIA 3F8UB 3KR3H 5L7XL 3K46A 2ZCKH 4OCSH 3QZNA 4M5YH 4BFJA 4AITA 4U33A 1UZ8B 5IR1A 3K6DA 4FMVA 2IG2L 1MW3A 4GKZB 1N67A 4NAJA 3BJ91 4RA3A 4PY8I 4PRID 4PB0L 4PJXB 5GGVY 4A2FA 1E8ZA 1DO6A 1XSOA 4KMTL 1DBBH 5G4MA 1RZIB 5DI8A 5I16B 4FQIH 4CAGA 2AJUL 3MBEB 1RD6A 4OFQA 4N0YL 4ZUVA 2CNYA 4BH8B 1BT9A 4NPKA 1T16A 1TVBA 2ZOKA 4GXUN 4W9ZA 1RZJC 2H8PA 3DURA 3W9EB 2XACC 1QHPA 3QI9A 1SDDB 3V4VL 1BIIB 4L8DB 3IDIA 4XNBA 4YXKL 3UJJL 2YS4A 3KJ4C 5F3BB 3ZBMA 2BLFA 1KEMH 4XNLA 2WWNA 1AHMA 1KCLA 2OMWA 4GS7B 2E27H 2O6DA 3EDFA 5LO7A 1YYML 4JLRA 3G5ZA 3Q1SL 4B9CA 3SKJH 4I3SL 5ESQA 2FRGP 1G84A 4KNTA 1CLZL 1QTPA 3BWSA 2X89D 2E59A 4RAUA 1Q0YL 1VERA 4E41D 3MNMA 1ET5A 3CMOH 4NHCL 4LHQB 3RX8A 1T7VA 2J8UA 4FNLL 3FCTA 3PDDA 1NBCA 1KTBA 3S4SB 2ZUYA 4MA3B 1M2OA 5D1XA 5AVWB 2OMUB 4BGLA 4E9QA 3VE2A 3SKOB 4K8RC 4OGYH 2WGNB 4PJCF 1R3HB 2UXTA 5CS7A 1GGYA 2KZWA 3BX7C 3ZE1F 3WFBL 2V8MA 4Z5RB 4RMBA 3QRAA 4L4TD 4HALA 1F45A 4FXKB 4M1CD 3W81A 4IRZA 4BFIA 3QFDB 3HC0A 1KXTA 1BIHA 2IBBA 1H19A 2I7SA 3WNIA 1D5MA 5L4MA 2VMCA 1CXIA 2VXQL 1OTUD 3F6JA 4R7LA 4R0LA 3NCYP 1MSPA 1KTDA 1OAKH 1NH6A 7FABH 4CL7A 2X70A 5I66B 2XZZA 4PUXA 1XF4B 1C8QA 3O9WD 4HULB 2B0SL 4N0UB 3UDWC 4CKVX 3TO4B 2PPAA 5E5MA 4NP4L 1CICA 1SOXA 5DS8A 3V6ZA 2JK5B 4HGWB 1KYOJ 3C8DA 4E42A 2GEQA 1QFWH 2VMJA 3BDBA 4O5LL 3O6LH 1BOGA 1BQUA 1JGDB 3Q48A 5FYKH 2BY2A 3RGVD 4YL9A 4JFYA 1EFXD 2AQPA 2WCPA 4AWJC 2BHUA 5IMOB 1RZ8A 1K8DA 4P23A 1R24A 1N6QL 5K9KB 3AZUA 4C8XA 4H8PA 4H20H 4AKMA 2YO3A 4NC2B 1G6VK 4JZJB 3LZNA 3AT0A 5ACMA 5ACZB 3EYUL 4AJVA 3NFNB 5EZOL 4CW1B 1ZHYA 3CDYA 2V9UA 4NHUA 4IK6A 5JPMA 4XPFL 3DETD 3GMMA 2VXVH 3TVMC 4HAKA 1CF8L 3VDAA 3NMEA 5AUMB 1EEQA 1SQ2N 3VFSB 1MLCA 1SJXA 3H42H 4JRXB 1F4WH 2GAZB 4PJXE 4PLJD 4MNHB 4MBRA 4Z1PA 2EDDA 4HLJA 3VGAB 5LAXA 2BSEA 1JP5A 5C70A 1XDTT 1I8MB 4LO9A 2HKAA 1DJWA 1EZVY 4AJ0A 4ANKA 4H4NA 5BRZE 5JPNA 1S7VA 2QTVA 1L0XA 3DUHA 2IWKA 2HKFL 1F5WA 2VH5L 4FTVA 5JHBA 3HOLA 5GJTL 4UINL 1TFPA 2P5EA 1FFNA 2VQUA 4GLRH 2MWCA 1XSJA 4NN6B 3AITA 4Y1AE 3WN5C 4JO4L 1YC7A 2ADGB 2R15A 1CLVA 4G6MH 4JAMB 1VDGA 4NWTL 4NC1E 5F3HA 2FO4B 3DJRA 5EA0H 2H0PA 3FRPA 4TOYL 3IETA 4U1SA 3RKPA 5F9DC 1BHGA 1M71B 3IS0X 3N41B 1HJBC 1OK0A 4UT7H 1JHLH 4KQ3L 2X4SA 2VAAB 5HJ3B 3QIUA 1JZEA 4R5VA 2AXHA 3IU4H 4Z3IA 4I4WB 4YDJA 3UAAA 2FJHA 1VSCA 4XCEB 5F88A 2X1QA 3B9AA 5E9DB 4ZSOA 3LRSB 4XMKH 2XOTA 1QQDB 3L3KB 3PGUA 1A1MB 3C6LB 1IT9L 4H1LA 1IGFH 1JTOA 4LCUA 3B83A 1JRHH 1AXTL 4M7ZB 4K7PY 3DX8B 3LRHA 5KYWB 5I8OL 3QDGA 1JSYA 3Q43A 1FIGL 4OD3L 1JPFB 4WO4B 2F2HA 5I18L 3QQ3A 4I77H 2D7TL 4TL4A 4I2XA 4FA6A 3QZLA 5HYSB 1G87A 2R4OA 4R8WH 4HWEH 2HYMA 4FTDA 4JO1H 3FHQA 3RDTA 4OGXH 5K9OB 1Q9FA 5JLZB 3AQZA 1DE4B 1O6VA 4KRNA 3EYVB 3RI5K 1MNUL 3RURA 3PL6A 1T66C 3B43A 4F7MA 4ZMWA 3WJJA 2FWLB 1ZIAA 4Y5VC 3SKMB 2FATL 1DLHB 2ZLDA 2EJ1A 4JFEB 4DP7X 4N0UE 4EI0A 1HTYA 3FU9A 2BVYA 1BGXL 4HK3J 3P11H 3WS3B 1E54A 3IMRA 3VRJB 4KOCA 3KWUA 1I9RL 1D7BA 3QNZA 4P2AA 3JWDH 1MEXH 4XXWC 1THCA 2XPZA 5D6CA 5AZUA 1GYUA 4PGZA 2I9LA 3NPSC 1HL9A 2FHBA 4XMWA 2GJJA 2LV4A 1KB9K 2Q9OA 4X7SH 3TIEB 4ELMA 3EYQD 5MEQB 2B1HL 4AM0A 1CB4A 3CC5B 3GB7B 5ERWA 1Q9OB 2BOBB 4RSYA 2AQ2A 3AY4A 2XVGA 1IO4C 1QUNA 3MNDA 3ARDC 1UUSA 3EADA 3O0RH 4APQB 3MXWH 3MMEA 2UXGA 3A3YB 2E0PA 4JRXE 1OP9A 3FQTB 4YDZA 4JVWA 1XMWA 2R23B 1M05B 4MDIA 1CXHA 4EI5B 1IAOA 3PWJB 1AIFB 1EDHA 4DP8X 2XFGB 5GGRB 3NFSL 1KBWA 5HHVL 5JHLH 5LGJA 1WFUA 4Y9BA 3HPLB 4PGCA 4PWFA 2PRNA 3TIDA 1VPOL 3VWKA 4NN7C 2Y5EA 4K3DH 4Z95H 5E70A 1J5OL 4KKCD 3T08A 4JE4B 3T4AC 3Q6GL 4Y4HD 3ULUC 3C08L 1MCRA 5J12B 3L1FA 4HKJA 5AAWA 4XNYH 4Q6YA 5AVXB 3SQBA 4LLUA 2KDGA 5IG7B 1QYGL 3AJ7A 4XBEH 4JFTA 5FAAA 4YSCA 3I6SA 4EXKA 4PAZA 3TF7C 4P2QA 5B3SB 5EPMA 3L5XH 3CU7A 2P1YA 3LKSA 1ZVSA 1E43A 4LEXL 5AYQA 1OV8A 4HFWA 1O5PA 4HWZA 4WI9A 2TSAA 2WXFA 3Q01A 1EBAA 4IRZH 3GP6A 1G7MB 3STZA 5MEPB 2DQTL 1N3NA 1Z9SB 5D93B 1RJLA 1NTDA 4IOIB 1SYSB 3ZQ9A 3EOTL 2OSXA 2VLME 5B39B 2C3VA 3LXBA 1IMHC 3BPOC 5AOJA 4PJEB 2NXZD 4OBRA 4R5TA 5E9DE 5F6IB 4NPYA 2OULB 3ARSA 5BJTA 1NANH 3WKNA 4F3FA 3RX5A 4BDVB 1LYQA 3EMNX 2XPGB 4JPVL 4HK0A 1HYRC 3GRWL 4ETYA 5CEZL 3FQUA 3TJHC 3RFZA 1EZVX 1L9MA 1HYSC 2R69A 4TNGA 2BVPA 1YMMA 3CHXA 4OCWL 1DVFA 3TWYA 1KBVA 5CHNB 1MJ8L 3RAJL 3QFJB 1BECA 4DUVA 1F00I 4ZXBC 4MA8H 1U8QB 4O58H 2E7HA 4N6QA 4F8PA 4HOXA 4G7RB 1AG0A 1J1XL 1X7QB 4FSOA 3HN3A 3RIFF 1NCOA 2ADJA 1UT9A 4JFEE 1AGBA 1AZRA 3NRFA 3RJOA 4BK4A 5HVGB 2XFXB 5FKAB 4RRPA 4KZDL 1TZGL 5A16B 2DKMA 3MA7A 4ZQKA 4F37K 5KWYC 2H6PA 4G11A 4WV1A 3KPRB 1UOWA 5F89A 5EF3A 5D72L 2X4PA 2XZCH 1BBDH 2JIXD 1ZT1A 1A6UH 2ID5A 1YECH 4UIMB 3DV6A 5L2KB 3IGFA 3HG1B 4ZMLA 4KKZA 1PEZA 4GAYA 2EDRA 3MV8D 4GBXD 1KPVB 1SXNA 1PIGA 3ZTJG 1M1XB 3OJVC 1F6AA 3FONA 4K7PX 2ZXQA 1WK0A 3IS1X 4M00A 5DJ6A 1OARH 2IV9A 5SWZB 1GZPA 2AJZA 3CZJA 1DUYA 3GLZA 4X9IA 1BZ8A 1OAUL 4U3CA 3RPBA 5DJAA 1BQRA 2HJLA 2J3SA 3G6DL 4Q9QH 1QBMH 3CIAA 4EDWL 3IDGB 4QI3A 3QO0A 4CMHC 2EKSB 4OR1A 3ZRFC 3L3OC 4RSVA 1UM4L 2EO9A 1ITBB 3IDJB 3KBEA 4Y9GA 3V6OE 1GYVA 2GABA 1MFNA 3WXVL 2DLTA 4MNGB 2YPVL 5KSAC 2JJSA 5AAMC 5IMLB 2AAVA 2F7RA 5E51A 3MRCA 4Z3EA 5HTSA 5GRVL 5HGHB 2NYKA 4NJ9L 3CC1A 4HISA 3V5HB 3QG6A 2HJFA 1WO2A 2VO8A 2HTKD 4EZLA 1O6TA 1FE8H 5DD3L 1E40A 3PQSA 1XIWA 2OXHA 3V0VB 3ARGB 5C0AB 3GPSA 4XPAH 4YDNA 1NMBH 1HQRB 1ZTXH 2ZXCA 4NRYB 2FR4B 1HNYA 1XBRA 1AHWB 2WN2A 2NSXA 1GY2A 1GFQA 4N2BA 4JG9A 5D5MA 3B2MA 4CRPA 2W0PA 1HHIB 3DGGA 4YFLF 3CQPA 2XC8A 5C0GA 3OWRA 4PJEE 5TGBB 3V6OC 5CCKH 4R7XA 2YD5A 4ODTH 5I1CH 3TH3T 4AFKA 2W9EH 5CSBA 3AA1A 3ILQD 3J7HA 4PGDB 1XH2A 5CP3A 2ICWA 1KPRB 2XZQH 2R8SL 1G7HB 4LDEB 2F53B 3QEUA 4K55A 1S7SB 1HKLH 4Z7OF 1XCWA 4YHNA 1L0QA 1MAJA 2CGYA 2F8XC 1J5HA 1QPXA 5D7JA 3ARED 3CWGA 3QNYB 1BXAA 3UERA 4GW5A 3QFJE 3CLWA 3FAXA 4ZOEA 2YAHA 5E5RB 4HJ1A 5DJ0B 3OKNA 2Q0ZX 1JYVA 1NQBA 3E6FA 1U8HA 1BYOA 3PQYE 2LLGA 4YO0A 3UTOA 2NZ9C 2DQHH 3VZUX 1HU8A 3UBXB 5BV7H 2A9CA 4YDVA 1KN2L 5DS1A 5I26A 1PBYA 5I1AB 2XN1A 1P5VA 3KXFB 5CEZD 1A4AA 4O3XB 1NBYB 1XMEB 3CX5J 3KPRE 3PF2A 5D7HA 1TSRA 2C7UA 1MXDA 1BA9A 3CUPA 5DMKB 4R4BA 1OT1A 3HB3C 3PG2A 3NJHA 3MRDA 4HS8L 3GKWL 1OAZH 4HJTA 4B97A 5IEKB 3HG1E 5FA4B 5L2KE 3S9DB 2PWHA 2P52A 2EE6A 1MCPH 4HKBB 1LO4L 4XMTA 1IEAB 1LK2A 4PJHB 4POUB 4PB9H 5DHXB 5DJCB 4LPTA 2Y6SD 3POQA 4X6FA 3US9A 4CJ0A 1UWEH 5IZ7A 3SDCB 1S5IH 5CIPB 2DTMH 3EOYG 5D4JA 3GJFA 5DFTA 1UD5A 3ECWA 5SWZE 1A6TB 2A5UA 2W0LA 3GKZA 1TKWA 1W8NA 3N55A 4ONHB 2A73B 4TQ8A 1I3GL 2JNZA 5IBUB 3V0AC 3U36A 2WJ7A 4P2RB 5E2WH 1JCVA 3LNDA 2AEQL 1E8WA 3SDXB 1A7QL 3FL7A 3VFRB 3R06B 4P46A 3B7RL 4BZ2L 1HILB 2CO3A 2Y06L 3HE6A 4F7TB 3O41A 1CTOA 3CSYA 3GUTB 3D9AH 4MNGE 2MNJB 4Y5YB 3T1FA 1LK3L 4QRRA 3H9HA 5EFIA 1L0PA 3ZO0A 4WTXA 1E90A 1QTSA 3MV9D 5DMIH 5D55A 4PJIB 1QLEH 4MMXC 1RZKH 4L9LA 4NQED 3T0WA 2IAMC 4YSSA 4ODSL 1JNJA 1CL7H 4FQ1H 4FG0A 3C8KB 1NCJA 1W0YT 1U4EA 5C0AE 2R69H 3IDXH 4ZUSA 2WJQA 4IGBD 1T22B 4LVOC 3FHEA 4I5BB 1CK0L 2WOBA 2YWYA 4FFYL 4NJAH 1YG9A 2CCLA 4K3HA 1G7JA 1WT5A 4JK0D 3JSSA 4Y2LA 4NYLA 1VEOA 2EH8H 4GAJL 2ZOLA 3APDA 1L9RA 2H0EA 4U7SA 2WGXA 3BZFA 3RA7H 2JJVA 3ZZQA 4ABQA 2WTRA 3LVEA 4LVHC 2R89A 2F5BL 1HHJB 3PWNB 2X4RA 4TF4A 5LAPA 3DNKA 4XWOC 1KLFB 4R2GD 2PETA 2F53E 2YHGA 1J5CA 4HF5L 2QT6A 5DRZA 3WYRA 3K0WA 3Q3GA 3F7YA 2I24N 3DHJA 2BDNH 1IC1A 1LGVA 1XF2A 4F58H 3WSQL 1JVLA 5K5YA 4JFDD 1AYRA 4IRSA 4APXB 4FQXC 4ILDA 2VDRL 4RGNB 2HKHL 4FZLA 3OR7A 1MCJA 2LGNA 3SGKA 4YHLL 4H5SB 3RHWK 4JCHA 1NEPA 3FT3A 3JT0A 3OAYH 1UA7A 2IPKA 5EO0A 3FFCA 3V4UL 1FAIL 3DIFA 1DJXA 2BSBA 5SWQA 4UUJA 1C5DA 2VKXA 2VLKD 1LTXA 3BAJA 5I8KH 2KI6A 1J7VR 3BUTA 4UTAL 1U3ZA 2MPAH 1OTSC 2WUCH 4XVTH 5F0LB 4V1DD 1H6UA 3EBAA 4H0IA 1ORSB 1QBLH 3WLBB 5D8JL 1UZ6F 3B37A 1U9KA 1R47A 1R5VB 4BJLA 4NFBA 4N74A 3O2WH 4PJHE 4HHWA 5EU6D 4U1GB 3FOMA 2ZICA 3DIDA 2R4SH 3GSUB 4Y4FA 1D5IL 1PD0A 3ARQA 3CVCA 5EEUA 3FN9A 5DK0B 1JZ2A 1OCRB 2F54B 4Z7IA 5C0DA 1KXVC 3D48R 4P2RE 2H26B 4FQQB 4JVUA 3HNTL 4TSAH 1BLNA 1YUKB 1ZMYA 3OKLA 3QG7H 1QBBA 5J1AA 3SDXE 1WAAA 3O3BB 4PI2A 1VF5C 3P3YA 4KAQL 1EMTH 5HPMB 3SDAC 3VYOA 1OE1A 1UA6H 2DQIL 3L7FB 2Q10A 3MUGA 5DC4B 4DAGL 5CD5D 3GFUA 1F90L 2XV6B 1BFVL 3LPGA 4MVBD 5T8IA 2K6YA 2D2OA 2Z1PA 3K6FA 2Y22A 4AQ1B 4N2MA 4PJIE 3VFUA 3DBSA 1ZHNA 4XP5L 1HH6A 4Z7UB 2VM9A 3ES6A 3X3GL 1MRCH 1T6WA 1JGUH 1T0NA 4Y8AA 2ZYRA 5D71L 5EO1A 3G9VA 5HDQH 5DR5H 5JQ6H 1MRFH 4GI8A 2HFEA 1A4KA 1KYUA 1JNNH 3JUYA 4HX1B 5IR1B 1LWJA 2FWOB 4KNQA 3LVTA 3O6FA 1FDLL 4Y2DA 5B8CC 4YUEL 4AUIA 3ELQA 3D18A 3D39B 1RZGA 3PGCB 4KXCA 4RAVB 4HWNA 3HE7B 5FYKE 2CBQA 3Q05A 3VQLA 3HRZB 3RBGA 4KY1H 3C9NA 3FB8B 4JFFB 2EEXA 1CIUA 2G60L 3ULVC 5IREA 4JM2B 2B3RA 1QR1B 4ZFGH 1NMCC 4FL4C 2Y2YA 2I9TA 2YC1B 1TDQA 1THAA 5FVNA 4AYFB 1FZJB 2VWEC 1CT8B 4NAQA 4JR9H 3H9SD 3N3EA 4UQ2A 4ZMTA 1WG3A 2GTZB 2P8PB 5D2NA 2WINA 5CM1A 5IVXA 2HX7A 3IFPB 2OMWB 5G26A 1Y07A 3OR6A 2EVGA 3VA6A 2R0ZL 3TBVA 1FV1B 1D5XA 3INUL 3MBXH 4Y9CA 2FIKA 4RGNE 3GSNA 2A9MH 4WSGA 5TDOA 2W81C 4ZS6D 3H6AA 2R0WH 4YHPB 3O0EA 1YYCA 2VM3A 3U4BH 1M7UA 1S46A 4YSOA 4YDKH 3SE6A 3DMMB 4JO8A 5J6GB 2HT4D 3MLUH 3AB0C 2EIJB 3VCLA 1PIFA 3KYKL 4J6IA 3VD1A 1NCWL 1XF3A 2Y0KA 4Y9FA 1JI1A 5GRJH 3TNNB 4X4ZA 1I8KA 3L95B 5AAPA 3U30C 1B0GB 1KYAA 4E5XA 1A0QL 5J0BA 2VZOA 4PJ9D 5AFUK 1E2ZA 2Y72A 5FOBB 5EH1A 1IJNA 1BFOB 1WHPA 1XVSA 1JDCA 2HWZL 3N40F 4RGNC 5HHOB 5C7XH 1YEHL 5EN2A 1DLFL 1KGJA 3VH8G 1A1NA 3MOQA 2FE0A 4LAQH 1X4YA 3GLDA 5T33H 1P4UA 5AVSB 2F54E 2P5PA 1QMUA 5B3JF 1QRKA 3FU7A 3BE1L 1WWBX 1XF5A 1IU1A 3S35H 3CCHA 4FAAB 3UZVA 2HLAB 1NCAH 5A2CA 3T0SA 2IOMA 4EBQH 3Q44A 4F7PA 1U8NB 4LK4A 1JUFA 2PXYB 4Z76A 3EG9B 3JZYA 3L1GA 7TAAA 1G6RA 1YZZA 5DRWA 4O4XA 3MOBL 2IMNA 3L1EA 5GGRY 2VISA 5GIRA 4Z7UE 2H47C 3S98A 5J6HA 2XXMB 1RZQA 2Z92B 1BMGA 3ABZA 3O2VL 4X7TA 3M45A 2P5WA 3MRBB 2PWGA 2FT7A 2GSMB 1PNDA 4AE1A 1AD9A 2EIBA 1OPGL 3SHSA 4EI6A 4CBZA 2F5AL 4L8SC 2FT6A 2KKQA 2KQNA 4UV4L 1GPOL 1DYZA 4X4MA 4UZUA 3EGSA 3CZSA 3GWJA 3CVHA 1IC4L 5E08H 2F7IA 3PUCA 4JFFE 4J4PA 4YH6A 4OF6A 4E9VA 1JHKL 3ZZ1A 4Z8FL 1OF2A 3L5IA 5FYLH 4FXGC 3HG3A 4N2KA 4GRLC 5JXEA 4XN5A 1HI6A 2YA2A 1M4KA 2J43A 4XMVA 4UQBA 4BWTA 4N5UA 5C1MB 1QG3A 4PQXA 1E27A 4PV8B 5CP7A 3VFGH 4DZBA 5JW3L 1TJHL 4J3OG 1LO0L 3FQNA 1JWUA 2VQ1B 3E3QC 4YDLB 4D9QE 1NMAH 2OZ4L 2V2TB 4X4XA 1XAUA 3QDJA 1T0MB 4N5EC 2NQ3A 2OFQA 1DP0A 2HB0A 3VXSA 4B9IA 4CN6A 2NY4D 1T2QH 4A68A 4LF3A 1G0DA 3IFOA 3QNFA 5LBGA 2GSGB 3RVUC 2YZ1A 4N3TA 5E6IA 5F1OB 3QIUB 2ICES 2WLZA 4NQUA 1URIA 2WBXA 3HFMH 4KJWC 2WB7A 3F65A 4KKLD 4NI3A 5CSZA 1AMYA 2OJEB 5FO7B 3DPBB 4HC1L 2MCMA 3WI4A 2CLVA 5HHPB 3ZDWA 4F20A 3QDMB 1DQVA 2HRPH 5AYUH 3QI9C 3AWFA 1EO8L 1WFMA 1KCVH 3QUZA 2R83A 2W91A 5IF0A 1C1EH 1CFQA 2EE0A 4OFYA 3ARUA 4OZIA 2YKKA 4YZFE 1RCYA 2H1LM 2ZYIA 3C12A 3QQ3B 5ICXA 3QPQD 4U6HA 1A8JH 3BKCH 3GJEA 3O2DA 4FQCL 5HHOE 1E5ZA 1T1XB 2G9KA 1MJJB 3QYNA 3VXQA 2F0CA 4X98A 4IOSA 4MD0A 3OAUL 4U6XB 5DWUL 1UD8A 3TO2B 3T0BA 3HEIB 4LHUB 4AT6B 2HFGL 3WUWB 3ASOB 1RU9H 1WBZA 1K8IB 4QRFA 4HHGA 5FC9A 5E6ZA 3LS5H 2VR7A 1IL1A 1DSFH 1UH2A 2A9BA 2DICA 5D1XC 5HJBA 3W82A 2ZD0A 1IE5A 2MCPL 1NEUA 4NCDA 2ZAIA 3S3DB 3IJ9A 5F7EL 2WW8A 5B1BB 3QHFH 5BPPA 3TJEL 1AZVA 3GO1L 4L29A 4UB8O 4UTBH 4WEMB 4WHCA 3JVFC 5DLML 4Q14A 2NY5L 3UAJD 2WLIB 2MOQA 1CFSB 1GRWA 2CK2A 1S4IA 1UD6A 3E9UA 3HPJA 3NRPA 3TCLA 2IGFL 4R0LC 1CD1B 5JIKA 3HZMA 5E7FA 3S8GB 4Z3TA 3I50L 2AJ3A 4OCRL 2W38A 3F62A 1VKXA 3LMJL 3SY0A 3SOBH 2C34A 2J20A 3PV6B 4RWHA 4HIIB 1CGVA 2DM7A 4G83A 3P4LA 4QOKB 5IW6B 1P6WA 5ISZA 1CICC 3TPKA 1KY6A 3NGBB 3GSNH 1Z66A 4O4YH 4G8FA 4HPHA 1RK7A 4UAOC 3BT2L 5I19L 1FAKT 1U8LA 3UBFA 2YPLA 1HINL 1KJ2A 3WHXA 1ZA6A 3PDGA 3EDDA 4FTVE 4P23C 2Z1KA 2P5EE 2ZTBA 4QRSB 1UEMA 3Q1EA 3PWVB 1KENH 5E1AA 4MS8D 1G9ML 1PU0A 2NW2A 3BAEH 3FU3A 1J0HA 3MRGA 2PORA 1CE1L 3QQNA 4TQIA 3BZEB 2HG5A 4YE0A 1NCDH 5JPMC 4JY6B 3WFCH 4P2QB 4NQXA 1HH9A 3BPNB 1B0RA 3V0HA 4WFGE 1T3FB 3LPPA 4YFDB 1FL3B 2FGZA 3SYAA 5HHXH 1GGBL 3I9PA 1IQWL 2CIKA 4JJOA 1N2RB 1XGRA 1SZNA 2GI7A 2BPBA 1MJUH 4KJYA 5B38A 4MMZB 4MX7B 1R5WB 1CLOL 4HV8B 4ONFH 3RBSA 4ZPTB 3OKKA 5JPNC 4XAWL 1CDHA 3MREB 3MBED 3BIAX 1T89A 3QDME 1MAML 5BRZD 3ECQA 3C2SA 1EX0A 1BX2A 2VLRB 2HTLC 3BUQA 4LLVB 1IAKA 3I2CH 5JDSA 2PO6B 4RVBA 3QDGE 2DYSB 4GP4B 4Y1AD 5MP6H 2XBZA 1I7RB 3FQ4A 3G9AB 4J12A 1ZTXE 3FOLB 1JNHA 2G3ZA 3WFDL 2WQVA 2ENYA 2NX5B 2XKNB 2ZJSH 4NLAA 5J89A 4OFVA 1FLRL 9PCYA 1C12B 3D0AA 4OZFA 2IPUG 1AGDA 4LSIA 1QOKA 2MOGA 5GS2D 4JQIA 4AENA 4PRDB 3QIUC 4PJ5A 3FT2B 1JV5B 1MW0A 1M6OA 5HI3C 5G5DA 1CWVA 2YXFA 4JKLA 4KDTA 1YEFL 4KTGA 1MF2L 4TRPH 2FQFA 1IC0A 4UM8B 4WHTB 3N50A 3VE0A 3FN3A 4LSSH 2ZUSA 1RUAL 1RUQL 1YNTB 3CDZB 3CVHH 1WBXA 4QHKJ 2GIMA 3WUZA 4YSQA 2BNRB 2YGVA 2A0LD 3V0GA 3FTVA 4XCFL 5GPRA 1MHEB 2Y24A 1U91A 3QUMB 3FFDA 4KK5C 4YN3A 1E6OH 1P1VA 1TVDA 4IBWA 5D2LA 3RDTC 2AQSA 2V9TA 5FPIA 3Q8CA 2XTJB 3FONB 1GFPA 1ADQH 1XGYH 1EJ6A 2IPUK 2KH2B 2X4TB 1LHZA 3PL6C 4FOMA 4BQCA 3WJJC 3WXWL 2AJZB 1DQML 5FUCE 2J88H 2NY0B 4NKQB 4QOKE 3N9GH 3T2LA 3QZBA 3BH8A 4Y2OB 4JJ5A 3RG1C 4CVZB 3TS8A 1RSFA 2FT8A 3HAEA 3LRMA 2X3AA 3U7YL 3SYBA 3QJTB 2BP0A 4XMLL 3TO4D 5A2JH 1CU4H 1OGAB 2Y1YA 1T4KA 2FX7H 1GSMA 1IFRA 2XG4B 3H9ZA 1V8HA 1G4RA 3Q8AA 5LUMA 4XPHL 4Z7QB 1KBBA 1L9QA 5CZKA 1BH3A 4GF4A 5TISO 3D87B 1LO2L 3JTYA 4XN9A 2ZYHA 2ESVA 1M2VA 2Y7LA 4N1EA 4RDQG 2NDGA 4N0FB 1SBSL 3WEXB 2EQDA 3FUKA 4NP9A 1YQ2A 3AY4C 2ZCHH 4GUPA 4PWJA 4GOSA 2LW3A 2P26A 1HXYA 4WGVB 5BV7C 3EXJA 2ERVA 4TV3A 4P2QE 2V2XB 5L2JA 1NGXA 3GF8A 4KH9A 2A9AA 4OF8A 4EIBA 3MLRL 4M02A 4NIYE 1OZUA 4JRXD 4F8NA 1RIVL 3O2DH 1LE9A 4KU1A 1URZA 3TLRA 4ODHL 2Z35B 4HETA 4ISVB 4F7KA 1IGYA 8FABA 1DBJH 1YY9C 1AR1B 1LVEA 1C08B 3MLYH 3AQDA 5C0ND 5KS9A 3VWKC 4J8RB 1RUKL 4F2EA 2UYLA 2J1WA 3BRFA 4D3CL 2DQEL 2VLRE 5D96C 3WU1A 3MJ9A 2FX8H 3LKQA 3HZVB 3QEUB 4HFUH 5AAWC 4ZW5A 3BMWA 4FMFA 4B95C 3CZFB 5JA8B 4LBEB 3TBTA 1CZ8L 2DLFL 3HTLX 2C1OA 1FFRA 4HS3A 4JHZA 4NKDB 2Z4QA 1YYLH 2EH7L 4QT5A 3NJMA 4LZKA 1LDPH 4YSRA 1YA5A 5KG9A 2FYYA 2ZWKA 4WKZA 5JO5B 3WFEH 5IFHH 1E2VA 5F1IB 1G1KA 3H2QA 4MQXC 3T2NH 5A6IA 4DKFL 5GRXG 1ND0B 4ZTOL 2DMHA 4M6NL 3BCDA 2ARJQ 2OX5A 3EJCA 1CE6A 2VLMD 2ZX9A 5EC2A 4HUMB 1FJ1A 4L37A 5HGDA 2XWZA 4BSWB 5E9DD 2A9DA 2XJKA 1TZHB 2CIIA 4WQOA 3ZTEA 4ZW6A 1SFHA 5EU4A 1HXXA 4WI0A 1G90A 3C6LD 5TDPA 2AKRA 5TFSL 3RFZC 1WCBB 1TUPA 4RMSA 1B4JH 2PP9A 4P57A 4YAQA 1S78D 1DVFC 3MLWH 2ZP8A 4W9JC 1CYGA 2WLNA 1RP9A 4N4YB 4WO4D 2BOCA 1NGZB 3O3DB 3X11A 1NBZB 3QUYA 2DWDB 2XTJE 5EOTB 1ZT4B 1DQLL 5FFGA 3GI8L 4NLHA 1SLUA 4XT1C 3I3EA 3QEHA 1S7XA 2C1PB 2ZT9C 5ICZB 4J28A 4CVUA 4RESB 5D9SB 2XHNA 1CDCA 4R97C 1KCRH 2EC9T 4EUPG 3TXAA 4YK4B 2UZYB 1DBAL 1PYWA 5D7KE 2LTQC 2ZNXA 4JFED 5E8OB 1G9NL 2DIEA 3QIWA 4MAZA 4WJKB 4Z7NF 1OGAE 4WV1C 5ETUA 4L9DA 5J13C 4X0NA 4X6BB 5DMGD 2WO2B 1MIMH 4BFGA 4H88L 4XGZA 4NZUH 3BRGC 3Q5YA 3SYQA 4XE0A 5DDHA 5DHYA 4G5ZL 4L4VB 4FG4A 4AQEB 4CU6A 2Y3NA 3EUUA 5DD0H 5HPOA 2A6DA 2A3TA 4WTZA 4AVKA 1LE5B 3QRFM 4AGLA 1N9PA 1LEGA 5I15H 2JELL 1HIMH 4JB9H 4LSRH 2JI1A 5E2UH 4HA1A 1WVZA 4ZUWA 5TK4A 1FN4A 4APQD 3IPFA 4GCPA 4A7QA 4JRYB 5IW1A 1BF5A 4IDJH 4QRPA 4YHZH 3ZL1A 4XP1L 4EI5D 1BM3H 5E7BA 4J1UB 1A6WL 1PG7X 1OGPA 1L6PA 1LD9A 3IF1A 4U0QB 1UQSA 4U1KA 4OZFH 4N2NA 4X6DF 4D0BA 4FMKA 5PAZA 2VL5B 4NQTA 4JQIH 4P59H 4JG1L 3OLDA 5K9JL 2EDEA 3PAVA 2OJZH 4GW4A 5HVFB 1NPNA 2JJSC 3TJPA 1J5IA 1H5BB 3DROA 3MNWB 3DUSA 1QWUA 3M7FB 4JY5H 4N2EA 3TBCA 4WUKL 4H7VA 5B66O 2BNQB 5E00A 4NO2A 3D07A 5DUJA 3M1CA 4UOZA 5J57B 3GI9H 4E0RB 2J6EA 1XIWC 3MRLB 5GISL 2IH8A 1W9XA 2Q86A 1TNMA 3BEVB 3KR3L 4ES9A 3BUYA 4RGMC 4ATWA 2P45B 1T03H 4XCCH 1ZIBA 4M5YL 3OR7B 4XOBA 2JTDA 3PWPA 4OD2A 4PWIA 3V0WH 2BSCA 4HUWA 4DO6A 1M53A 2CH8A 3DIFB 4KRPC 5J3HD 4HIEA 2PUQT 3WFHA 3PGSA 1OP5K 1DBBL 4FZMA 4IRJA 2R4RH 1IFHH 3TN0B 5CKGA 5SWSB 3GMLA 1G7QA 4Z7VF 3HAEH 2R56H 5DFVD 3TL5A 1N70A 3C6SA 4GG6A 2IGLA 5DT1H 4DOHB 2Y9RT 5I6PA 4U1MB 4P3DB 3DRQA 1RJCA 2I85A 3U2SB 1IC5H 1J9SA 1K4DA 2FHCA 1CJYA 2O6PA 4I0PB 4OZHF 5D7JC 4D0DB 1KEML 2JB6B 4ZX3A 2N7AA 4MMYA 2A6JB 3LZFH 3LK3B 4JFSA 2E27L 4PSPA 4FJ6A 2Z31A 3QFJD 5J4MA 1F6FB 4W9GC 3SKJL 2WXNA 4JGUA 5BZDB 5CBEB 2GPZA 2WXOA 1Y0LB 3PQYD 2ZCZA 3ZTCC 4M7KL 4PTTB 2HN7B 1A6ZB 1YY8A 3FF8A 4S10A 1IGTB 1WZAA 3CMOL 3K80A 3RKDC 1B6UA 1G7IB 1KC5H 2D3JA 2LFEA 2DYPB 2VW4A 3KPRD 4RBPH 3UXFA 1ACZA 3NH7H 3IRPX 4X9HA 1G1OA 1RK1A 3LD8B 3L4XA 3UBGA 3UBXI 1MCIA 1IM9B 3EOAA 4L4VE 2XICA 4UTCA 3PGDB 5L2KD 3BZ5A 3HG1D 4X5WB 1GMIA 4KROC 3QUKB 2ZP9A 4OM1H 5KVMC 3WL9A 3FO0H 2DQCH 1P4LB 4ZX4A 1ZLSH 3CN4A 4IEFA 4MQ7B 3MJ9H 3PNWB 1PG7L 1S2EA 4N28A 3OB0K 3FYEB 3V7AG 3LN9A 3FU8A 4GKLA 1P69B 3GSOB 3IPEA 5L8LB 3H7LA 1A2YA 5SWZD 1CMOA 3O6FB 5ADXL 4JRYE 4X8JA 7FABL 3QNXA 1H3GA 4HU2A 1GC1C 1RZGB 4KO6A 3VMOA 4DTGL 4K3BA 1SGKA 2EIZA 3TZGA 2EDTA 2ZX6A 4AKQA 1SJEB 2FH8A 2Z3FA 4E9SA 1EERB 1QWHA 4P46C 2YA1A 3HE6C 1JWSA 1QW9A 1QX1A 3C9NB 1WD9A 2IH3B 4HSQA 3OB8A 3AA0B 2VITA 1QFWL 1D5RA 3O6LL 5I1LA 1L4IA 1HNGA 1BXXA 3ZDXF 3L4TA 1U3YA 1ZGLM 4P2OB 5FYKL 5E9AA 2Y4SA 1Q9WA 5AW6B 4ENEC 3FKUS 1U8OA 1EHKB 4L9LC 5FO8A 1I3VA 1NIAA 2BNQE 3MR9B 1LEIB 4FI8A 5IVXB 4H20L 1FH2A 2A6KB 3EJZC 2EACA 3NBNA 3WTSA 2D7OA 4KVNH 4F2FA 3GSNB 4CSTA 3ARGD 1M7XA 3SJVA 4X2UA 5C0AD 3SKNB 4BA8A 1W6WA 1W0VB 2ZKYA 1JYXA 4JFBA 1JZ5A 1GY1A 1VGEH 1RY7B 1WT5C 2EDWA 3FFCE 3H42L 5FYLE 3G7TA 2CRZA 3MRIA 2J44A 4MLIA 1HXMB 1S9XB 2EXSA 3SYSA 2GIYA 5DSCB 3DPDA 1BXWA 2N7BA 1RVFH 1CN4A 1KB5B 5I1KH 2EE2A 4K9EC 1E3FA 5SWSE 4AGQA 1UD2A 4U1HB 3TU6A 1QFWI 3IJHA 3H6JA 3P02A 3KLHC 1JJUA 4DOHE 1N5AB 1N59B 4FEMA 2GCYB 1W8OA 3IGAA 2VQ4A 2F53D 1MH5B 5DA0B 1J0IA 4TL5A 3DVGA 4YLCA 2B2XH 3J2PA 1Z1WA 1QEWB 2F58H 1FZMA 4FMSA 1FHNA 2ZSWB 4L8CA 4IRSC 4G6ML 2GFBA 3AA6B 3SGKC 4DPBX 3EKCA 3ZYZA 2W9DL 3KMDA 5C07A 1CXEA 4F7EA 2IQAA 3IDNA 4IQHA 4N2OA 2P80A 3C5ZB 2ICWJ 4OVVA 1ROCA 3B7SA 1NINA 1JHLL 2JFCA 4GKNA 2FIRT 4NWUL 3LK2A 5T1KA 1DFXA 3UZVB 5LDSA 1X5MA 4I3RH 3UZEA 4MXWH 1EXUB 4ZMVA 3IU4L 4KX7A 3AS0A 3H85A 3FB7B 3OZ9H 2IDCA 5T1LB 3MRMA 4XMKL 1AQHA 1GGIH 4XMPH 3TH4T 5HDBF 3VRIA 1F02I 2N7SA 2C9XA 3LRLA 3B2UD 1IGFL 1JRHL 5AW7B 1O75A 1A6AB 2F74A 1CLYH 4Y4FC 3M07A 4I77L 1UH4A 2YGQA 4YGVB 4R8WL 1JPGA 1AZNA 1PX4A 2BERA 4HWEL 5EU3B 3RIAK 3SDCD 3VM7A 3CZEA 3GZQA 2VERN 3ARBA 1ONQB 2V6HA 2J6EH 4HPOH 3KLKA 3LN4A 2W07A 4Z7WA 4P2RD 2AXFB 4H8UA 2TAAA 4NRZA 3DO7B 4LDOB 3MLVH 3P11L 4JDEA 3OKEA 2J1KA 2XWRA 2VN5A 3S97C 3JWDL 1MEXL 1ZANH 3GIVB 5FW7A 2KERA 4UF7C 2NCEA 1ZLVK 2DQDL 1H3TA 1JRHI 3PY9A 5BVJB 4X7SL 2CJUH 3FDWA 4FZ8L 3M1BB 2CO7A 5CP7B 3VXOB 5IVXE 3LEYH 2K8MA 1KELH 3F7PC 2ZAGA 5PCYA 3GM8A 4MXQC 5LWYH 2AJXL 3O0RL 4MJ6A 4Y2DC 3MXWL 2E7MA 4J39A 1NDGB 3VFOB 1EO5A 2WXRA 3RWDA 3ZDYB 1CBVH 3K2MC 2PYFA 4AIZB 3W56A 4HJGB 1HQ4B 1AD0A 5JOFB 5FYKD 1OXYA 4ZTPH 2OLDA 3KWVA 5C0IB 2FBOJ 3TPUA 1T1WA 3ATFA 4V11A 5IKCB 2CLVB 1U8IA 1S8DA 3P4OA 4XP9H 1JMXA 5JHLL 4X5XA 1SN5A 2E8YA 5MENB 1NWPA 4MKTA 4F92B 3RUGA 4IHOA 3MLZL 4K3DL 1SLXA 5ENWB 1JF1A 5D2NC 4HS6A 3MA9L 2VW6A 4AZ8A 4R6UA 4GINA 4NRXB 4K7FB 4JO2H 2BVTA 2NUPB 4XNYL 4PTUB 4TUJB 5FXCH 3E7JA 3FMGH 4XRCA 1UB6A 4RGND 2A4EA 1TQCB 5AOIA 3GGWA 1NC2A 2KMWA 1FWXA 4PVNA 3W0WA 1YPZB 4UMGA 2BFVH 4HIPA 4P5SA 4QWWD 3WGVB 3DOSA 3H56A 4IRZL 2WVSA 4H44C 4LL1A 2QELA 1NDTA 3VSTA 5FHBL 4U2ZA 3UAEA 3W9DA 1E3XA 2JKLA 3E6HB 4M5TA 3T8XB 1HWGB 2JKJA 4JFQA 1A6PA 1MLBB 3N41F 4WK0B 3GXMA 4OLYL 5AW2B 5GGQL 1GAFH 1XFPA 4L29B 4NSKB 2OMTA 2GK2A 3TA3B 3SYCA 3BN9D 3TESA 2R4NA 2O30A 1ZEAH 2CDGA 1F4HA 3EO0A 1ZT7B 1B3JA 2W0KA 3DO4A 4GKSA 2BS9A 3SE9L 1L7IH 4U3XA 3HS0B 4GH7B 2G3MA 5F96H 1LP9A 3AMLA 5HVWA 2N2LA 3RWHA 4MA8L 1ZHBB 3BXNA 4O58L 4U1NB 2QGEA 3JV6B 3REWB 1VIWA 2F54D 1I3RB 3FUJA 4PIBA 2XCMC 2NSMA 3NDZE 3QHTC 1KNOB 2XWTB 4DNLA 1ACXA 1R34A 5GRVK 5DUPH 3JTBA 2IDQA 3MV11 3QB7C 4WW1A 5F9WC 2ITDB 3C5JB 3THMH 5D6DA 3WAJA 2ZXEB 5I28A 3NJTA 4LP8A 2ZFGA 2WXJA 1NANI 2XZCL 5DFAA 5F7BA 3KCWA 4IBZA 2OTWA 1A6UL 1YECL 5IB5B 3T77A 2NTSP 4Y0GA 1FLTX 4KVCH 4UI2A 4M93B 4WWKB 2NW2B 1WEJL 1XZ0B 4LKCA 2VIRB 4LL9A 3D3VA 1TZIA 4KRLB 3DTDA 2N01B 3N42B 3NCCB 3IMTA 1DZBA 3U4EA 5AKTA 1KTLA 4X99B 1CCZA 4P3WA 3S2CA 5IMMB 4KJPC 2OV0A 3L3HB 5LGYA 2Z91A 3VJ6A 2Q6WB 4C54A 4PG2A 1OARL 3ZDYE 3WU2O 1I7TA 1U8MA 2CIKB 4NGHH 3D6GA 5B38B 2CGZA 4Q9QL 1QBML 2NZ1A 3L17A 2WLJA 4J4PC 4LCYA 5FM5M 1PLAA 4LT7A 2FSEB 4JFFD 3TP4A 4X8CA 3ZTDC 2A6IB 4OAWB 4JM2D 4N2DA 5MENE 1F2XK 5JXEC 3II2A 3VXMB 4B5EA 4X6CA 4HCGA 3B2DC 5KOVC 3MRRB 3GXTA 3BGMB 5F7DA 2VXTH 2L7UA 4LOVA 1BQHG 2XIBA 4AJWA 1SQMA 2CO2A 3KPSB 3TEYA 4QRTB 3KW8A 4RFEB 3AS2A 1ZSHA 1CDBA 5E8PA 4D9QD 3LQMA 3VG9C 2JKTM 3SY6A 3US1A 4OZFB 3LZPA 2OL3B 4XPAL 5FUZL 3QVAA 5GZNA 1NMBL 1YPZE 2HG0A 2XWBA 4AV4A 1R0AL 1ZTXL 2P46B 5E6IC 1TPXB 4PJ8B 2DI8A 2HLEB 4NO5B 5IBLD 3QPXH 2B1OA 4G59C 1M6OB 2HMIC 4BE6A 3NP3A 3DMMD 3LNFA 1MM5A 2EYTA 4QTFA 4NO0B 2Y7QB 43C9B 4BZ1A 3H2WA 4IMLB 1E5BA 1NDMA 5CCKL 4OJFH 3QUZC 3S7GA 4ODTL 5C0FA 5I1CL 3IDYB 4DERA 1NFAA 2W9EL 4MJ5B 1K6QH 5I17B 2XZQL 4ZUUB 1FZOA 2JB5H 2NT0A 4EIUA 3HC3H 1TZ8A 1HKLL 3RZCA 5IP4A 1GGCL 25C8H 1IKNA 1ILSA 1VADA 3ZE0B 2QGDA 5DVPA 2B4CH 4ESKA 4AKOA 5HHOD 3GBLA 5DYOB 2WXLA 3TGXA 2OBGA 5KSBA 2PCFA 3U6RB 3S3CB 4G6JL 1U8PB 3G6JA 4KI1A 4P9MH 3ME0A 2BSRB 5DHVA 3ZZLA 3VXUA 4F9PA 1DQQA 5ISZE 4L8BA 1N4XH 1QABA 2DQHL 4QHNA 3APCA 3LHAA 4XBMA 4HBQA 4Z0XB 1XCTA 1HL8A 3FPXA 4RISH 2XQYA 2I25N 1U8CB 3RVTD 4AVJA 4Q4EA 5DQJA 5JW5A 4EPSA 2H2PC 1K85A 2PXYD 4AOFA 4RL9A 3ATAA 1CG9A 5I5MA 2YRBA 1F97A 2DI7A 3PORA 2UY7B 4KTYA 1OAZL 2AVGA 4P04A 3DWOX 1X5IA 5CWSA 2KZ1B 1F4AA 3QXAB 1MCPL 3AADB 1TLMA 4PB9L 5DS2A 5JNYA 5IB3A 3MGTA 4G75A 2WZ6A 3G08B 2FX9L 2XG5A 1IQDB 1UWEL 1WWCA 4RCAA 1S5IL 1VZHA 3SIKA 4LDLB 2EYRB 4A63A 2DOCA 2D3VA 2P7TB 2BSSA 3D05A 5E2WL 2RCSH 2HVKA 2IADA 3S3PA 5KS9B 3TCTA 3WELA 4Y7OC 1KDJA 3ET9F 4NKOA 4O2FA 2IJ0C 3VXME 5I0DA 4PV9B 3D9AL 4FTVD 1F4YH 4MAYA 2GI0A 2P5ED 4N90E 1N0LA 3MRHB 1O6SA 1YSOA 2BP8B 4B53A 5DMIL 2WLKA 2QVKA 1RZKL 5LBVA 3GQFA 6CGTA 3HG5A 1BVOA 2P3YA 4N2HA 5DUMH 3KPSE 3LAFA 4P5KA 3HC2A 3HLAB 4XR8C 1CL7L 4FQ1L 4H25A 1H3XA 3O4LA 4LBAA 4WFGD 3LXUX 4BYHA 5L8KB 2R69L 3IDXL 4Z0BL 5I2IB 3BFOA 3QUXA 3UPAA 3UPRA 1ZJAA 1WUNT 2BS8A 4PJCB 1ZLUH 5CO1A 4I1RA 4P4KB 1NFDF 3M7OA 3PHQB 4NJAL 5IT2H 2BM3A 3QIUD 2YOCA 1OANA 4LSVL 4OGZA 2Z0BA 2WBJB 1T89C 4W9LC 5IB2A 1F3JB 3NQKA 3OD3A 4TQEL 4XOEA 5H4YA 4YSUA 4DKTA 1EVUA 3RVWD 3QDMD 1YEIH 4L3EA 1JHTB 5EU4B 2P47B 5D70H 3T3PF 2AKRB 4GUCA 4HKZB 5DTFA 4JPIA 1F8TH 1S3KH 2GG1A 3QDGD 3X1BA 4QJ5B 2XY1A 3ARRA 1YCSA 2PCYA 3IJYB 4GQ9H 4M7LL 5GGUB 1HDMA 1Y7VA 4KFMA 5DK2A 2P24B 2BDNL 3MPCA 3QJOA 2ZUTA 3ZE0E 4F58L 3G5XA 3DSNA 4KV5E 1N6VA 5KANI 1CL7I 2VABA 3GMPA 1FL6A 2EXWD 3GMNB 4LVNC 1SJHA 1VFMA 3VFVA 3QUML 3ZSSA 4XO5A 4E2OA 4D7PA 3OSKA 4LHUD 4N8PA 4KKBC 4ZMOA 1REIA 4KY2A 2FNBA 1DDHB 1K3ZA 4FG6C 2XPYA 1Z5YD 4KDTC 2ZPKH 4G7SB 3IXAA 4FYQA 2YBRB 2ZSVB 5IY5B 3HI1A 2JQZA 5I8KL 2V3FA 2JKIS 4ZAKB 2MPAL 2WUCL 3LDBC 4XVTL 5J8OA 3ATBA 1CURA 4PJ6A 5IESH 5T1DH 2MHAB 2KS0A 3L5WB 3GBML 3D25A 1GZQA 2X4UA 1HOCA 1MCNA 1Q1PA 4OZGF 4JPWH 2EE9A 4FA8A 3O2WL 2WKOF 2HT2D 2R4SL 1EZUA 1S9YB 4WK4B 4MD4B 3F7KA 1R17A 1GH7A 5EUKB 4GSRA 1MCWM 1QFOA 3EJUA 3GZPA 4QOKD 2R9HC 4E36A 4OI9A 4XB3A 3AUVA 5HVHC 4QAWA 1XGPA 3AT9A 4TSAL 1PZ5B 3UAQA 2OSLB 4Y1SA 3QAZB 1VEPA 3QG7L 4LKXA 4D0BB 3BD3A 4NQSB 5I6LA 3MRNB 3ABKB 5IB1B 5LAXB 3QULB 4IMKA 5KS9E 1J05B 1EMTL 1JGEB 2X9YA 3GMOA 4NUQA 2PWEA 5KW9H 1UA6L 4EJ1C 5EOQH 2EIDA 3POCA 1B2YA 3SCMA 4XNKA 4BZ1H 2HUHA 1XSKA 1YAZA 3EO9H 3GSXB 4AK2A 1BV8A 2QQNL 4HJJL 2H32A 1ICTA 4YC2C 3QZWB 4S2SB 3MUY1 5DO8A 1AGFB 1EXGA 4DEPC 1MRCL 1CFVH 1VACA 4IKNA 1AKJA 2UV3A 1JXKA 1JGUL 3NG5A 4P2QD 4TUUA 4PCKA 1PRNA 5DR5L 5JQ6L 3GLAA 5LBSA 1JNNL 1BZ7A 1QNZL 2IAAC 2Q87A 3CH8A 1DSWA 4PJCE 1IBGL 1AO7B 4KKPA 4MSWB 3OF6A 1XB6A 1T04B 3MSPA 5I1DB 5IHZB 2DY2A 2WQUA 2ZUXA 4HCRA 3CPLA 4JW3A 2ZUQB 5F1NB 3IMVA 1EVTC 4KY1L 5LNDA 4WNQB 2CO6B 4LGSB 1E4XH 3EJTA 1W91A 4ZFGL 2VLRD 4ZPVB 4YHIB 5BQ7B 1J8RA 2PO6D 5JOPE 1B4LA 3AU0A 1V55B 3UTQA 3LKPA 4K5MA 1MVUA 4JR9L 2WP3O 5F9JA 4DK3A 3MROA 4P5TA 1NL0H 3ZLQC 3EH1A 3T0EA 3BESR 3NCFB 4UOW1 3MBXL 3QRLA 4KTEH 2A9ML 3I6KA 2PTTA 32C2B 5ECGA 5INCA 2NXYB 2YGPA 1L9SA 2C8NA 4QD2E 4R7DA 2BJMH 3ILPA 2NY1B 2V8LA 4E1SA 1Q1JL 3SZKC 4BELD 3RU8H 5ADPH 4DFHA 3U4BL 4LOEA 1BLIA 1FCGA 3CH1A 4PPTA 5DL7A 1KLGA 3BDYH 1ED3A 2LE9A 4JMNA 3MFFB 1MFAH 4R7VA 3TWCH 3ZRSA 4YDKL 4DJMA 5CD3B 3VD2A 1SXBA 1INDH 1GS7A 3TBYB 4KRAA 2XBTA 4M6OH 4GT7A 3MLUL 1UD3A 2VDPH 5J9PA 3KPQA 4N75A 1AS6A 2EDMA 3NSFA 2YKLH 5EBWA 1ASPA 3U9PH 3BQUA 5GQBA 5GRJL 1JZGA 2AITA 3T6XA 4BKLB 2ZQKA 5AKRA 2ETWA 3GD1C 3BW9B 4QLWA 3QUYC 4UDUA 5FWQA 1MY7A 4YPJA 1KXQE 3DX2A 3NJNA 5DJYA 3VD4A 2O5NA 3D0LA 2XTJD 5DEFA 3NSCA 4HKXB 2WIIB 5C7XL 3G5YB 5DVLA 4DKEH 4HEME 1U3HA 4C57C 4U7MA 2NY0D 5FM4A 4LAQL 3ECUA 1F3DJ 2AXJA 3QIWC 4P5RA 5D7KD 2VZSA 4XO3A 3U1SH 4L1DA 1JWSB 1OGAD 4J6RH 1D5BB 2CA4A 4Q6IA 3S4SG 4KNSA 5D1QB 4WEEA 3WKMH 1HHHB 5ESAA 4JZNB 5I30L 1W72A 2N59A 3RVUD 2DQFA 2VRAA 4FFTA 3IMSA 5M95B 1PKQB 3IVKB 4FQJH 2BVUA 5CKAA 3CN2A 2QQQA 4P0DA 1UGNA 2B5IC 2P8MB 2WQWA 1U8OB 2WV3A 3UIYA 2WANA 1BG1A 5F97E 1KLUA 4KXZI 1X6LA 4HH9B 3X13A 3IFLH 4K5LA 3JWNC 4WFFE 3E9TA 3SBRA 5CBAA 3NK3A 4JG0H 1D9KA 5I71C 1V27A 4YFEA 3PHAA 3RWFB 3PWPE 1DHKA 3V9EA 1J8HA 1AO7E 4HMEA 3UP6A 3P0YH 3DZMA 2KLSA 1EZLA 4RZCA 3GSQB 1HHGB 4JREB 4KRPD 3FH7A 1AR1D 4TTDC 4XVSH 4CADA 4PJDA 3IE4A 1E9PB 5E08L 1YUHB 4UT9A 4ZFZA 4XAKE 1O7DE 4G43B 1KFGA 2CUHA 2CKBA 4HD9A 5C8JA 2JQAA 2BC4B 2G3NA 2BSTB 3MRQB 2AQ1A 5FYLL 2ITEA 3BRZA 3BISA 3SKUD 4YNYB 1NAMB 1OB1B 2ZCLH 3OWEA 9CGTA 4O3WA 5KYUB 2BIPA 3VXNA 3SZVA 1IB5A 5CGBA 5I6OA 5KBNC 4QGTA 4EOWL 2W60B 3S5LB 4DZ8A 2GSIA 2HSIA 1VFBB 3P3TA 4WGWB 3WIAA 1NMAL 1M57B 3WEBA 1EJFA 1L3NA 1T2QL 1QR4A 1F1GA 1JFHA 3OLIA 5BO1H 3OZLA 4IRJC 4OLXH 4M1GH 1XH1A 2XN0A 5KJRL 1MRDL 3HFML 2N0MA 3UPGA 2VZVA 3SBWA 1NGYB 1MFEH 5DQDH 4BFFA 3BVNB 1NLDL 2JMMA 3SDDB 4JM4H 5E4IA 2HRPL 1P7QB 1ZS8B 5AYUL 1A1OB 4HJ0C 5C09B 4FZEH 2WB1A 5IQ9B 1KCVL 1OTTD 4NENA 2J8UF 1TMQA 2IQ9H 1U2YA 1H3UA 1C1EL 1XO8A 2NDFA 3EZJB 4MJIA 4NBZB 1M7DA 4PW4A 5EC1A 4JDVA 2Y0SA 4OUUA 3PCYA 3VZTX 3ALWA 1UOKA 2Y69B 4HIJB 4QHLA 3D85B 2D7PA 2OMXA 5H37H 1CXKA 2VDLH 2Z31C 5AQ0A 2J12B 3BKCL 3OXSA 4AX3A 1UM6H 5I75B 2A4CA 4GEIA 1R3KA 4JFOA 2E4FA 4CJ1A 2H32H 2NXYC 2G5UA 2FWUA 4N58A 3OG6B 4DN4H 2QEJA 4PVMA 3LKNA 5I0XA 4DVRH 2G2NA 5BZWB 4UBDD 5ICYB 1SJMA 1QP1A 3ZHDA 4HVBA 2V5YA 1O9VA 4OT1H 5AKSA 1K5WA 4PR5A 3LS5L 1NCNA 2M26A 5AW1B 3ZJAA 1Z9OA 2W65B 3KAAA 5D1QE 1QLRA 1UT2A 4HIXH 1CD9B 4UDTB 4ALAL 5AD0A 5BS0B 3AXLB 4PJBA 1G0YR 1PKQE 4HCRH 1MFUA 5HHQA 4IL6O 3QHFL 2EECA 4JRLA 4L4VD 2OQJB 3GS7A 4UTBL 4BINA 2X7LA 1GOHA 3P9LB 4ZYKB 1PW3A 3EFOB 2YEZB 4UYPA 2MSPA 3MJ8A 1Z9MA 3EJZD 5HYSG 1T7XA 2G75A 2YJQA 4LPXA 3ZVVA 1RFDH 1HSAB 3GHBH 3SJVE 3QO1A 4PJ7A 1NOLA 3K71A 1X5YA 4KGJA 4HAFA 1D6EA 3BGFC 3BN3B 3SOBL 4W6YB 3D69A 1NUDA 4FLOA 3RWDB 1N8ZA 3QWQB 4AW7A 1RPKA 2YSTA 2YZ8A 4ANWA 3D2UB 2ZWNA 3RFRA 4DO5A 3GSRA 3GSNL 3LQAC 4Z7OB 4O4YL 1E2WA 4XC1H 4G8GB 4QYOA 5FKPB 3EGDB 2V7NA 5F6HJ 2WQSA 4JDZA 5JDJA 1QI3A 3DX7B 3CAFA 5I0YA 4N1HB 1KB5L 4G8EB 4L2YA 2OMZA 3NP4A 4RIRA 1KENL 4A2LA 2DH2A 1U8KB 2BNQD 2AABH 4K5PA 5CZVH 3EAKA 1VGKB 4P49A 3DXAA 3OQ3B 3T3MF 3PQUA 1NCDL 2VE6A 4GIAA 3WFCL 4S1SL 2YGNA 4JRFA 2QR0B 1ZHXA 3RY5A 2XE1A 3BPCA 2BZ7A 3L2NA 3QT2A 1R3IH 4ZFFB 3UJTH 2QADB 2ZWZA 3ZR6A 1X9LA 3A6CH 5HHXL 3FFCD 5FYLD 1ZWIB 2AZAA 1QRNA 1MJUL 3T65A 3V0IA 3MNVB 3BKYH 3TN0D 1F86A 3LNGA 5SWSD 2VN6A 1TFHA 2BS71 3VFPA 4HDIA 1UH3A 5C09E 4JN1H 3AUWB 1L0YA 4W9KC 3VI4A 4ZUTA 1ES0A 1HEJC 4ADIA 1X6NA 1X3DA 2YAOA 3MI6A 2MNWA 4LRNL 1RZ7L 5MP6L 1ADWA 4MNQB 5AVRB 5I74C 3K5SA 2YUZA 3U83A 4W9DC 5FYJH 1JXGA 4NIKB 4ODWA 1WC7B 2ZJSL 2APVA 3ARTA 2FO1A 1GZHA 4TM9A 5JMOC 5CMAB 3PF1A 3E8UH 1IM3A 4UB0H 5HI4C 3KPTA 1IGCL 4YXLH 4GXVL 4K15A 3ESNA 2FWSA 4NKMB 4ZQTA 1E9OB 5T3ZH 3UZEC 1EAPA 3DJ9A 5DEGA 4PRPB 3HC4H 5B39G 4BEIA 1FNEA 5KAQF 2ENJA 2NY3B 2DYPD 5BS0E 3ECBB 5FM5O 4HQQH 3RGVB 1FYHB 4MDJA 1OP3H 1EFXB 1LNUB 4HUXA 1IM9D 1E7VA 1I1CA 3CVHL 5AOMA 1GGUA 3AXIA 5JUEH 1NCGA 2A7BA 4U1JA 2IPTL 4W70A 3P0VH 3AA7A 5CJBA 3ASNB 3QWOB 5EOCJ 3W37A 2BRQA 1ADQL 3DYMA 1XGYL 4HOMA 3ARBC 4MXQD 4FXLA 1Z3GH 2R2HB 1MHHB 4I18A 4YR6B 5EIIB 1XGTB 3O6FD 3VGDA 4Y2DD 3AAEA 4EDXA 4ETQB 2J88L 4KKAD 1JE6A 2X0WA 3N9GL 3AU1B 4IU2A 4JFVA 4UQAA 4A2DA 3UBHA 4TULH 4PRHA 2FGWL 43CAA 2K9FB 4IBYA 3K2UL 3MN8A 4F7CA 4Z7OE 2QFPA 2AJSH 4D0CA 2YGOA 2W92A 3KHOA 3NIGF 3H3BC 4QJ3B 4WU5A 4XHJC 1WS7A 3F01A 3GEWB 3P4MB 2XWJA 4G8GE 4TVUA 4WHDA 3FK3A 1LWHA 3C60B 4PY7B 2B4CC 3FO1B 3QORB 3RUGE 3VXPA 4QGYA 3B2VH 3BFQG 4HWBH 4XH2B 5GS1A 3N04A 3JWOH 1HC1A 4I87A 1UVQB 1BFSA 2ALAA 3ORJA 2XMXA 4XE5B 4XVOA 2ZCHL 3SE3A 1EEZB 5EBLB 1G43A 4F9LA 3BWUC 4Y88A 4JKMA 3LZLA 3RWEA 4HG4K 5ES4B 3TNMB 3IAPA 4HHAA 3GXFA 35C8H 4NCC1 4X50A 4OLVL 4PWKA 3WY4A 4AV0A 2GBUA 4KWUA 1IVTA 3HZKA 2OTUA 4QXVA 4KI5C 1VFAA 3KPNB 4ZW3A 4YBQC 3JTSA 3MLYL 3U0TA 1NGWA 4PVLA 4RFNB 4FFZA 2GJPA 4QF1A 2YD2A 2EUWA 5F9OH 1FH5H 2J1ZA 1OEZW 3PABB 2XE3A 5MEOB 1FG2B 2FX8L 3R4DA 3RVXC 3RZCB 4HFUL 4MNQE 4WLCA 3VSQA 1VADB 1ZD6A 4D7BA 4HPYL 2XWCA 4A6YH 4H26B 3BPLC 3A0BO 4ODXB 5MERA 1YYLL 4A04A 1QSFB 3NSXA 4V2BA 5IVOA 2ICEB 3ALPA 2Q7YB 1KTCA 2QADC 3RL1B 3AW5A 1WDAA 5IFHL 3VXUB 1A7PH 1J18A 3SDYL 4WEBL 3V5KB 3FNKA 5GSVB 3T0DA 1EUUA 2GBVA 3UTSB 5E8DL 4XNXH 3LKRA 4N8CL 3QQDB 2WWMC 4PRPE 3QCVL 2ATKA 3EYOA 4EN3A 1NFIB 1OAXH 2I07B 3O0LA 3MRPA 3QRGL 1XGQB 4Z18A 3UYPA 2ARJA 3WIFB 3L9YA 2FB4L 5T1LD 4WFEE 4C59B 4YMPA 3IN0A 2P48B 4AEFA 1HESA 1B4JL 3P1VA 4ZJ9A 3QRBA 1P5UB 3N0AA 5JORA 2WVPA 2JWYA 1JL8A 2RFXA 1E8YA 4Z3GA 4WUUB 4C56B 4F2MA 5A6LA 2NCMA 2AEWA 3BVUA 1EEYA 1FYTA 4CVXB 1A14H 2WLMA 2YRZA 2AQQA 4HJEA 1KCRL 1HHKB 4N59A 2GJ6B 2XN9A 5DD5L 3GXDA 3DVNB 2R1WB 4O02H 1E4KA 1TJGL 2IWVA 3UBXG 3FQ1A 5TDNA 2YXMA 3D12B 3RTQA 2NQDA 1KUMA 4U7KA 5D6DC 5FF6B 3CFKA 3VVWA 4P2CG 5IB4A 1MIML 4PGBB 3BWZA 4NS0A 3RDJA 4NZUL 3I9AA 5KSUB 1K2DB 1I7UB 1OT2A 3TT3H 5JXED 4M62L 1NCUA 3BAYA 1N0LB 3P4NB 3VTMA 4QJ4B 3KBPA 4OZ4A 5DD0L 2KXPB 4S0TD 3WNLA 2EYSB 4LLQB 1DQTA 1KV3A 2G5BB 1J8KA 3G6AA 5I15L 1HIML 2B59B 1TU2B 1IGJB 4JB9L 4LSRL 1K4CB 3TBWA 1WRFA 3CXHK 4AGNA 5E2UL 3DARA 5KEZA 4P5MA 1IC7H 1RI8A 4P9HH 4PG2C 3DLQR 4QXWA 4MFHA 4K71B 2CLRA 4O51A 3VX0A 5IHBA 3OJDB 5IBUG 4IJ3C 5I5JA 4IDJL 4AL8C 2Q3XA 4W68A 4YHZL 2A77H 3P73B 1BM3L 1UZ6E 3LIUA 3LX9A 2DLEA 3MU3A 3U0PA 3MRFA 4NQQA 1GMEA 1QZ1A 4Y4KB 3VH8A 2EUVA 2WSKA 4JQIL 4P59L 4XBPB 1BVKB 4AIEA 4LCVA 4W9FC 5MEND 1BZOA 3IN2A 1R3LA 2OJZL 3HUJA 4KJQC 5D5MF 3BP5A 1OB0A 4MZ3A 5B7FA 3QPKA 4JPIB 4JY5L 3FO9A 1K5NB 1FVCB 1MQKH 3B9KB 2FGQX 3VXTA 2CRYA 3GI9L 2UY6A 5KSBE 1MCOH 1QSFE 4IW4C 3ZDZB 5GZNC 1T03L 4XCCL 2Q76B 4XOAA 5F7NC 4ZNEE 2OW6A 4WDIA 3P77A 3TZVB 2IALB 3VXUE 3RZWA 2IOIA 1QAWA 1RERA 3TEZA 3UTSE 3V52H 3B6SB 5F7HA 4G6AD 3VI3A 2AW2A 4KC3B 3SBQA 1PHOA 3RWGA 5IV2A 3B56A 2IFFL 4KUCD 5TF1L 5KVEH 3N85H 4TLKA 2NR6A 3VZWX 2I32A 4K94H 3SPVA 2BVQB 2J4WH 1U21A 2R4RL 4JCWA 5CCHE 4BKSC 3KWTA 1U93A 2D7QA 2R56L 2J25A 4JKPH 4XCNB 1Y1UA 5IJVB 3KWWA 5C6TH 3TA3D 3ARZA 5DT1L 5ADXK 3ARFB 3RZCC 4M7LT 3S88H 1JPTH 4H13C 3MHZA 1P6FA 4XTRC 4ACTA 4M9OA 4B3VA 4CNIA 3PJSA 3IXTB 2LHFA 4WUUE 5DJZA 4DVBB 4C56E 5C86A 4LLDA 3BLPX 4G80A 4MB1A 5KYXB 3UZQB 1PY4A 3MXVH 5GSRA 5C0EA 4F9PC 3PAYA 4A2GA 2AMUA 4PM1A 4POZD 1RULH 2GJ6E 1BJ1H 5A1AA 5EHFA 2DPKA 2M83A 5ISZD 3IKCB 1G4MA 3N1PC 5IBTL 3SEPA 3CSPA 3IKKA 5CUSH 1KIPA 1SMOA 4WI7A 3ATEA 2YPKB 3R1GH 5FECA 4QQ1A 1ZLEA 1XR8A 5FFOA 2UZPA 2X4OB 5CN1A 5TPWL 2AXWA 1EZSA 3VSVA 1KC5L 1FIEA 5AB0A 1EAOA 3QCTL 3QJHB 4LCCB 2VUOA 2XV0A 1INEH 1UCTA 3NH7L 4A2MA 1NSNH 1KJMB 5TE4H 3MCKB 2VDLB 1P84J 4GYBA 5E56A 4G7QB 1CDIA 1MPFA 1QJ9A 3MZGB 2WVVB 4WWKD 5GHWL 5EUOA 1S6NA 1P0SE 3F5WB 4K07A 2R8AA 2I27N 3NAAH 3MNZB 4QO1B 3O11A 1D6VH 4K8RH