2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FACTOR H BINDING PROTEIN
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
2KC0A 4O3ZA 3HOEA 2KDYA 4AYEC 3KVDD 4O3WA 2W81C 4QQ1A 3VE1A 3PQSA 4AYMC 4AYNA 4O4UA 4O49A 4AYDC 1YS5A 2W80C 5T5FA 4O3YA 3V8UA 4O4XA 4O3XB 2Y7SA 4U9CA 4AYID 5EE2A 3HOLA 3UAQA 2YPVA 4Z3TA 2LFUA 3PQUA 3VE2A
chains in the Genus database with same CATH superfamily
2VE6A 5AW4B 1JXDA 4HJGA 4FMSA 2X28A 1XH3B 2HJKB 3IPBA 3N91A 2JI3A 1RHHB 3Q6GL 4Y1AA 5AAWA 3E7JA 5D5MF 1B4TA 2Z4QA 1KNOA 2C7UA 3ZU8A 5FPIA 1KTLB 3ZTJG 2Y9RT 3EGXA 4WV1C 4N6RA 4O2FA 2NXZC 2H3NA 2FX8H 4QHKI 4YHLH 1YEJH 4W9LC 3NP4A 5BMFH 3ILQC 4Z7VA 4FZ8L 2CU9A 3HHRB 4HAKA 1NC4D 4Q89A 5TQ2H 4ZPTA 2RCSL 2BDNH 5CINL 3U30B 3ESOA 1NBZB 4NUGH 1KXQE 3NJJA 1Z5LA 4XXDA 3WSQL 3SYAA 1EAOA 3HC3L 3MRGB 2YKLL 3TNNB 4F9PC 1TCRB 5J6GA 4PJHA 4AE1A 5BZWB 4BRVA 3IS1X 2ZOKB 4RJWA 1KACB 1OAZH 4XP4L 5JW5B 2DJUA 2VT0A 3U83A 1F11A 1R3LB 3A21A 4PRHA 1S7RB 3FC8A 1PDKA 2Q7YB 3MNWB 4L1HA 4I77L 2XQBL 1DEEA 2MPAL 4KXZI 4QGTA 5ADOL 1T2JA 4YSAA 1NMBH 3ZE0E 3DWTA 1XF2B 4YXHL 5E94B 4ZOBA 2QTVA 5D2LF 4Q9BA 4HWEL 1JXFA 3EOAB 3K80A 4PWHA 2HKFH 5CP7A 4BKSC 2PN5A 3RLSA 1JZHA 2BS8A 2HTKC 1X5LA 3SGKA 2X4UB 4NHUB 3SOTA 4EI5C 3U0PA 2WLKA 1WHOA 2HG5B 3CN4A 4HSCX 1UUSA 3HB3B 5DRZA 3QDJB 3CH8A 3BRDA 1MH5A 4P2QB 2PO6A 5D1ZB 5D7LA 4F8OA 4LPVA 5I16A 3BRGC 2PPFA 1BWMA 5F44A 3D18B 3DTDA 1AANA 2O6FA 3G6JF 5CLZA 3NTCL 3U2JA 1MW3A 4KKNA 3O8XB 4TQHA 1OV8A 3KS0J 3VFUA 4WUUE 4L8CA 4D0CB 4IOIB 5A43C 2ZKYA 3L7FA 1QSFE 4FG4A 2G5BB 3D5OF 4HD5A 1W0VB 3TVMB 1IFHH 1I8IA 2XN2A 4KFZC 4NM4H 5EOCJ 4GKLA 2O5YL 4ICWA 3TLRA 2DKSA 1UCBH 3HAEH 2VC2L 1CICC 3HMXA 3QT2A 5IMKA 3CZFB 1WICA 1SVCP 2K3HA 4OLWH 3VE0A 4LEOB 3RURA 1A7NL 4HS8H 3VWJB 5J13C 2YRPA 3OAUL 1BWWA 5IEKA 1BVNT 4FZEL 4MAZA 2QQKL 4PS3A 5D2NB 5CJOL 4PG9B 3SKJL 3GMLB 1HILB 4L4VB 5L88L 3E9TA 1L7IH 4HJSA 1EMTH 1W8NA 4CDGC 2TSBA 1WFJA 4E5XA 2EDWA 1A7QH 1C16A 4X7SH 3VG9C 3C12A 4X6CF 4U33A 2EILB 3UBXA 4XBGB 3VXUB 4HH9A 3LNFA 1VACB 2VR9A 1BQUA 4P2YA 3SYCA 3VG0L 4XAWL 4WW2A 5JOPE 1D5XA 3MRRB 3QI9C 4B9FA 3EYUH 3S3DB 5DJ8B 4EI0A 1OZTG 3LNDA 3HNTL 4Y16D 2FWUA 5LGHH 1AXSA 4HUWA 5DJCB 5CJXA 2IBBA 1EEZB 3IDYC 2P80D 5CWSA 2CDFA 2DWDA 1QJ9A 3MLWH 3NZHH 2MOVA 3VACA 4X6BB 2BY2A 3BUYB 3QCUL 1RIVH 4L29B 2J1WA 2BMKA 4IQHA 1Q9WA 3HHSB 4J23A 1S7TB 1B2WL 1G7PA 1YQVL 2YUXA 3GHPA 3IBEA 4WFFE 1HXYA 3L3GB 3RVVC 2ZCHL 1SJHA 4FQHA 2A6IA 3OKKA 3UC2A 2F54D 4RFEB 3ZK0A 2EUVA 3D9AL 2LHFA 1FL3B 3Q01A 4WEUD 2ENQA 4YFDB 1VLXA 4NQCB 3T0EB 3KS0H 4PREA 2Y0SA 4KMTH 3S3SA 4P5TB 1SYSB 2R69H 3MUUA 4ZUUA 2XTJE 4M1CD 3GPSA 1RZ7L 4U6VL 3QFJA 2LV4A 2H41A 4IMLB 4N90D 1CXEA 3PGFL 3EGDA 2C3GA 2XCMC 5K1NA 1FNAA 1IE4A 1ZS8A 1I85C 2NQ3A 3PL6D 3BIBX 2W88A 3G5XB 3CFIC 3TN0B 3BGMA 5FUCE 1HOCA 1F13A 4BD4A 2WTPA 3T0DA 3BVWA 5HHVH 2GK2A 1GHFL 2WSKA 3T3PF 4PJDE 5MERA 3WLBB 2ZWSA 5T1KB 1FNHA 4W4OC 1LEIA 4OGXL 1CFNB 1JDCA 1QA9A 1WS8A 2K6WA 2P49B 43CAB 2EDQA 3KYAA 4G8EB 3FQXA 5IHWA 3GBMH 4UT7H 4BCYA 1G94A 3FHAA 3P4MB 2FEEI 5MEND 4Y8AA 2HYMA 5CFHA 1AP2B 3LS4H 2YQ3A 5CD3A 2W91A 3GDBA 2G75B 1SEQL 4L23A 3C5SB 1BD2D 1NM4A 4FKHA 3L17A 3UYRL 2VDMH 1P7QD 4N2CA 3P4LA 4JZJC 3I02A 4UNVA 1A7RL 2BP3A 3M1CA 4B0MB 3BPLC 3MQIA 2BX5A 1AFVL 3CSTA 4LLVB 3ARWA 4NNXB 2ATPB 4I0PA 3DRTB 3DX1A 1QEWA 1LE5B 5I5IA 3DX6A 3PPEA 1IX2A 5CZVH 2E59A 4IGBD 4KK8D 3JQOB 4AX3A 1PLAA 5I75B 3TF4A 4XVOA 4UUJB 1N59B 2XSKA 2H1XA 4X5WA 4HCGA 3VYNA 1U8NA 5KVGL 3GF8A 3UG4A 3DO7B 2H9GA 3ZTJH 4L4TE 1Q9LA 5HHXH 3OB8A 3HUJB 2VQ1B 4JQVC 1UJ3A 3DX9A 3ZQXA 4HPHA 5C0NC 3QSKB 5IMOB 4PRNB 1GYWA 2GITB 4JKNA 4M93B 2X70A 3EKCA 4GW5B 3SJVD 5F7EH 3MI6A 1TZGH 5EOCL 3LIZL 2FIKB 1BEYL 4YQXH 5E9DD 4HLJA 3RWIA 3V0WL 3FOLA 3EADA 5TFSH 4U31A 1MY5A 4AEHH 3U1QA 3MROA 2DWTA 5C3TA 4MWFA 3OLIA 3IT8D 2CO1A 3V0HA 2H6UA 3PDOA 2UZXB 3T3PE 4X99B 1QBAA 4NZUL 5I1GL 3PAVA 1I7RA 4OCMC 5GTIO 5FKPA 3V79C 4YDLB 1EFXB 4LVEA 3J8F7 4ZFZA 4KTYA 2B3RA 3L1OL 3O2DL 5L2JA 1BCIA 5INCA 5LKNA 5F3BB 3CD4A 1JK8A 4JFDE 4QGYA 1NDGA 4U1JB 1I3RA 5DR5L 1AI1H 5I19H 1PD6A 3CH1B 5E8NB 5KSBB 3UADA 3M17A 4JN2A 2X89D 3OR7B 1SZNA 2CRMA 5CLWA 2H2SC 4QHLA 3OZ9L 2C9UA 3LX9A 2ESVA 4RWYH 1TSHA 5ETUA 3RPKA 1KB9J 5IB4A 1DJXA 1O6TA 2ICWJ 2IXQA 3MUZ1 5DHVB 3VNYA 1J12A 1NZRA 5CIPA 2R59A 3GO1H 1OGTA 5DT1L 1BZDA 2HFEB 4P8QA 3NCYP 2K70A 2VXQL 1BH3A 2ODJA 1WEJL 4W4NA 5EO0A 1TJHL 1WZ1H 4NBYB 2CXGA 4LFHD 4UNUA 5JIDA 4LCYA 2IWGA 3VQ2C 3ROLA 3GKWL 4ABWA 1CGWA 1A4JB 1ZHKA 4A7TA 3ET9F 3NIFE 3P2DA 5EIIA 2CBOA 4Y4FD 5IOPA 3KCWA 4B9YA 1Y18A 3BKJH 1PF3A 3F05A 5GS1A 3P9WB 4Y1AE 5K39B 4YS4A 3LPWA 3WNKA 1VZHA 1Q1JL 4FL4C 1ZHBA 3WG7B 5CJ5A 2GW5A 1MCRA 5HHNA 1CGVA 4F8LA 3C6LB 3HG4A 2XTQA 2F5BL 2V2WA 4MA7L 2OMUA 3GFUA 2XVKA 4OVVA 4YDIH 3IFNL 4QRUB 1BG9A 2L4OA 4O51B 5DHYB 5I0YA 4EIUA 3CMOL 1D5MB 4Z7VE 4AG4L 1AS8A 4GIOA 2B39A 4QI3A 1GZQA 2J1NA 4B95C 3WTUA 1Q9GA 3V8OA 5HJDA 4WK2B 1VERA 1EJOH 4UQIM 5A2FA 4DSYA 1JD9A 4JFOA 3FUIA 4KU1A 4PJHE 5E6IC 2YS4A 2HPOA 3B9KD 4D5UA 4B9ZA 3D25A 3MBXH 2XZCL 4AJWA 4QYAA 2GKIA 2YUWA 4ODSH 3V2AR 2BNQA 3U4EA 4PRHE 3S35H 2CRZA 4CSSA 4PEEA 4IRJB 1KJMB 1Z5HA 3L9RA 4WI2A 4HUKB 1AJ7L 1U0QA 3VQMA 2YIHA 3MODH 3OF6A 5EU5A 2BOLA 2I9LA 2RA1A 3QZWB 3THMH 4PRPD 3NABH 2XHNA 1CPUA 2KBGA 3IDMA 1LK3H 1U8QB 2JCCB 2VDLB 2YEQA 4AL8L 2VJ8A 1Q0XL 5DEFA 4KTEH 2E3VA 3UL4A 1QR4A 2BSED 4PLJD 1YA5A 2DQUL 4H25A 4NSKB 3RPBA 3V0JA 2OTUB 4TQIA 2UV3A 4N5ED 5FFGA 3DBXA 4HETA 1HCFX 4Y9EA 1HXMB 3LS5H 3MCLH 2G60L 2RR3A 5D7LE 1JUFB 4QRRA 2J6EA 5KZCD 3IE4A 5HHPA 5I1EH 3RZWA 1Q90A 5DLLA 1F1DA 3ZHLA 1EXUA 3WI4A 1JZGA 4EZLA 3OG6B 5HHOE 4IKLA 2VDOH 3DRQB 1D7FA 1K6QH 2VXUH 5DRNA 1A6WL 1EGJH 1UH3A 3KYNB 4K5MA 2QKIB 3QAZC 3ALWA 3C2AH 2X4SB 3FMGH 5IBLD 3Q44A 3BZ5A 3CAFA 3OAYK 4FA8A 1WCBB 1I3GH 2OYMA 3VXNB 3W0WA 2UXTA 5KVDL 1E30A 2E7MA 5E8PB 4TVUA 2AXTO 4QHNA 1UFUA 1JZ4A 3N2JA 4XP5L 4PGDB 1H0DB 1UHVA 1S9WB 5IVZB 5A16A 3RFZB 1AYRA 2O5ZH 1UM5L 2DMCA 1QO3A 2NX5A 2GVYA 1OE2A 4MJ5B 4MQSB 4XWGH 5FXCH 4AQ1B 1D6EB 2I26N 3D2TA 4YDJB 1JBJA 1DVFB 4MD5B 1TETL 2DF3A 2YHGA 5H8DA 5L6YH 1OCRB 1NCHA 3G5VA 2BNUB 2CHWA 5EWIH 4AJYV 4P46A 2F1BA 4FQEA 2BM3A 3QEHB 4Z0XA 2ZOOA 4UNTA 2OQJA 5I1IL 1AS6A 4UB6O 1MF2L 1Z0MA 3C09C 4JG0L 2CUAA 1VFAB 2YA2A 5B8CC 4TSAL 3RUGA 3PAUA 4NKOA 5FUZL 1HHHB 4RLCA 1FAIH 1GGBL 2DD8H 4GKZB 5DD1L 5JZ7D 1A1MA 2IDTA 2F58H 4S1RL 3I50H 1CT8B 2GJZA 4LSPL 5HPMA 1HVXA 4G7VL 4KXDA 4NN7C 4PGCA 4R96B 4OCNC 5B1KA 4B3EA 5LNEA 1E4KA 1PQZA 5LLIC 5KUKA 2AJVH 5EUOA 2YRLA 2H45A 5KYYB 3BP5A 4PMFA 1FN4B 3CPLA 1E4XL 2VDRB 2ZX5A 4MYWB 3KXFB 2B4CC 2D2CC 3RZCC 1FFPA 4J3WA 4OD1L 3G7TA 3NCCB 2DL2A 4MZIA 4NRYB 3CG8A 3V4PB 4GAGH 2BS71 1KXHA 2JK5A 3MLTB 3UTTE 2CBQA 3VI4A 4ANXA 3MLVL 3BT2H 2UY7B 2B77A 1I7TB 3LEXA 4KDWA 5BRZA 3WFCL 4A2FA 3VMNA 2F7PA 4HJ0C 4P3CH 1PZ2A 1NQBA 4WJ5B 5JW3H 4FZMA 1C5CL 4NAMA 1D7CA 1MZZA 1N8OE 3QFJE 1MCOL 3NJXA 5I5JA 4NWUL 1X5FA 5TGBA 3ULUL 4GINA 4OQTH 5KS9B 3QULA 5C2BL 3F58L 5AB9A 5JA8B 3A2SX 4XNQA 2AW2A 3FYEB 5HP5A 4AMXA 1MCSA 5EOTB 4JRXA 5ITFB 3B3BA 4UQ3B 1IZNB 4OZGB 5I8CA 3DUUA 5EA0H 4WUKH 4RRPA 4XXCC 2X40A 4LSQH 4LF3A 3HMWH 1CGSH 2WOYA 1F3DJ 5EF0A 2X4NA 5T5FH 3BQVA 3DXAD 3IDIB 1J0ZA 2VLRA 1CFTA 1M7IB 4HZAA 4PJ9C 3OLDA 4MXQC 3Q2CA 2WZ5A 3MLYH 3PLYA 1XGTA 1NGPL 2D73A 2VR4A 2XXGA 4P04A 1U9KA 2CUIA 1QW8A 3WLWC 1URIA 2ITCB 4M4RB 4N2DA 3VXRA 3D07A 3TFBA 4RGNE 3DIDA 4H44C 3BAIA 4W9DC 1ZLWH 3VU1A 4ZMQA 4APQA 3L3JA 5ADPL 5EZOH 2ZWZA 2ZXWB 1G9MC 3EO1B 4O9HL 1Y1DA 4NO0D 5E1HB 1V7ML 1AMXA 2V7NA 1CGYA 3EHBC 1CDUA 1MG2C 3KGUA 4OI9A 2Y25A 3D39D 3MSPA 5D7JD 1VSCA 3D0LB 4NP9A 1KYUA 1PEWA 2D4FA 2AQ2A 1Z5YD 2JB5L 3MRCB 4Y2DB 1T5WA 1AXIB 1UOLA 5AW9B 5AW7B 4UOW0 1EBAA 2OL3H 2YA0A 4QRTB 3PF1A 4KZ0A 2HA1A 4JPVL 3NCFB 2VLJA 5TF1H 3K4ZA 2FVNA 1IGTA 5GRYA 3BN9D 1XH2A 3F5WB 3PGDB 3T6XA 2OJZL 2ROYA 5D6DA 4AGLA 4ZG1A 3ZZQA 1VJSA 3QFDB 5GXBB 5JR1L 3RDTC 1HOEA 4HG4K 3N42F 3AMLA 5I30H 4FADA 1KTDB 3HE6B 4RQQA 2UXGA 3EJSA 2PMZA 1MHCB 4YE4H 2WLJA 3UTPD 1AHKA 4XWOD 3QPQC 4UV4L 4NQDD 1UA3A 1LO0L 2FO4A 3DTXB 4JFSA 4H26B 1QBMH 4NO3B 4WHDA 5ERWB 4CC0A 3SDXF 1S7QA 4M5ZH 4PB9L 9PCYA 4HGKC 3WE1A 1AZBA 2CALA 3QUYB 3U6RA 3VU2A 4H5SB 1JPSH 1TG8A 3BIKB 3GMNA 4IU3A 2FX7H 1E2WA 5FO7B 4GLRI 2BY1A 2E6PA 3NFSL 4KROC 1GAFL 1BZ7B 3ETBF 4N2LA 4F37F 1IGJB 4XMPL 4QRPA 4H20L 1VIWA 4Z77B 2Y6TE 1F4YH 4GQQA 4QYOB 1ZE3H 3UTSB 2ZYIA 2C3VB 4G80B 3VXSA 4ZW5A 4PV8A 3IVKA 4JDZB 5F1IB 3VFPB 1BM3H 1O9WA 2ESVE 4AEFA 3HRZA 3RILA 3SDAB 3I2CH 1FV1B 2KZWA 2J8UB 3AAEB 2QVTA 1O5PA 1QUPA 1Z2KA 3NH7L 1V27A 4IIQC 1B0RA 3ARUA 4PN6A 4BCXA 3RL2A 3SPVB 1MCQA 4N22A 5SWSE 2DQJH 4V33A 5CXPA 4M62H 4G1MB 1WZMA 4R7NB 5F2FA 1KGUA 2NSMA 4U1NA 4DVRL 3AAAA 1AZNA 4FS0A 1P5VB 3LAFA 4GSDH 2NY1D 4MB3A 4WTZG 5MI0C 1WZLA 2QADB 4NWTL 3K2KA 1UB6B 4JQIH 2YN3A 5EG6C 1X7SA 3F7VB 4RETB 1NEZB 1NCIA 1HNYA 1IGYA 1IGML 4DJMA 3KGSA 3U2SB 1M6OB 2FTAA 4P2RA 5ICYB 4JPKH 1I1FB 4IIZA 3VGAC 4JFYA 4PRBB 4XH2A 3PV6A 2X0VA 1BBJA 4DN4H 3SZDA 2MIZA 1M6UA 3N85H 5L4IA 1MFAL 4KO7A 3DECA 4XCCL 1LYQA 4G6KH 1M2VB 3ZE2F 3LPPA 3TIEB 2ZUWA 2ATKB 5D9SA 1MRCH 1NCWH 4MJID 4JPWH 1D3CA 4C55A 1J18A 1K5WA 3ZRSA 2FD6H 3IDGA 2YAEA 4FI7A 3U0TA 1TJGL 4OJCA 3H7BB 3EDEA 5F8RC 2MCPL 3ZKXC 4KC3B 1JN6B 3NQKA 4AL8C 3GXFA 3BFOA 3FB6B 4N8VA 4U7KA 4YHZH 2P46B 4LHUB 3HRPA 1IU1A 1FI8C 2H6PB 1DO6A 1VADB 2GAZB 3IS0X 1UOKA 2BNQE 3C5JA 5IM7A 4Y88A 4UOZA 1EZVX 3RVTD 4WDIA 3S5LB 2GQHA 4UOW1 1A65A 3CFTA 2JJSA 2IADA 1UVQA 4XAKE 2JKNA 1HZHH 1UWEL 1HL8A 2PXYA 3BSZL 4X8JB 5F7FA 4MAYC 2YMXH 3WIIL 4OIIH 1FGVH 2CCLA 2PCXA 1SQ2N 2XFXA 4KVNL 1MM5A 4WW1B 4ACPA 1E9QA 2H1PL 5CZKA 4AQEA 2VRAA 1X5HA 5DJDB 4GRLC 5IUSA 1VF5C 4UDTA 4O58L 1KCSL 1W80A 2C9RA 1EZUA 2YC1A 4AZLA 1X5KA 4Y4KA 4GUPB 4QRRE 3T4AC 4OJFH 1XZ0B 2DQCL 3G5WA 4PWKA 1BXVA 2O6DA 1KCRH 5KBDA 1ZT1A 3LZPA 1NLDL 3RBSA 2Z8RA 2Y7MA 3FH5A 1ZMYA 4CU8A 4HKJA 2QL1A 3RX9A 3FO1A 1MJ7H 4I2XA 1U21A 3UBHA 1F97A 1H19A 3SE9L 3WI9A 3HTLX 2D7TH 5TISO 1E5BA 1SXAA 4WTXA 4BA0A 1I1YA 5BCAA 1GPOL 1IMHC 2JTDA 3LQAL 3L4XA 3QUXC 4LPWA 4KY2A 2A73A 5T5NF 4DOHB 4UYQA 2OR9L 1CF1A 1LGVA 2OZ4L 3MRHA 2VRQA 3SBQA 2AQTA 3SCMB 2IH3B 2EDFA 3W0WE 3LD8B 4O4YL 3MRJA 5JMOC 1T7ZA 3JUZA 1UWXH 4Z7UB 3QB7C 4IYKA 4LP5A 3TBWA 3UPAA 3QRCA 2H2PD 1FL5A 1OGSA 2BERA 1YEDB 3LRLA 1DQJA 1TJMA 2FK9A 3KM2A 1UH4A 2AEIT 2NX5E 2ZWLT 2XKNB 2IBZY 3KJ6L 4HBQA 5EU7E 1EPFA 5IK3A 3S36L 3CZJA 2XN1A 3CHXA 3FHQA 1KC5L 3D6GA 3GI9L 4P2OA 1G6VK 3ZRCC 3ZZSA 2IWEA 4JN1H 4YLQT 7PRNA 5DUML 3WL9B 1DQLL 3IAGC 5ES4B 2JVUA 1T4WA 1BLIA 1MHPL 4FHBD 1G87A 4J8RB 2W0KA 2WNKA 3QDMA 3UTQA 3BKYL 1U3HC 3RUGE 2Z91B 2AK4A 4BHUA 4Y7MA 8FABA 3FU0A 1DQQB 1HQRA 3AACA 3IDUA 3TCTA 2G3MA 2ZOWA 2IAMC 2X9YA 4HIJB 5DCCA 2YR3A 5F1NA 5E9AA 5GRWA 3S0PA 4BH7A 3ZTEA 4APXA 3OKDA 2OR7A 3QZMA 3O2VH 3C8KA 5I15H 4Z7WB 2VWEC 1I3VA 3U4BL 5BW7A 4DQOH 1KEGL 1ETB1 3G6AA 4GXFA 1ZXQA 5F7AA 5EUOE 3K6NA 3LH8A 1OE1A 3QUKA 2HFGL 4FFZH 4EDXA 2AGJL 4NO5A 3HPLB 1BMWA 3UH8A 4LSEA 1VGEH 5AVTB 4RBPH 5D72L 1J05A 4PG2A 3NRPA 3CC1A 4CMHC 4HGMA 2CPCA 4HSAC 1CTOA 5ESQB 2VAAB 3APMA 5A7EA 5I1KL 1NCCL 2B2XH 3T3ME 3VI4E 4PGZA 2YWZA 5FWRA 4C4VA 1V7NL 3QJRB 3HAEA 5DFVC 1CC3A 4P2CG 5AOLA 4BZ1L 5BRZE 3C6SB 4HSQA 1KCVH 4NI3A 3P4NA 4YGVB 5TK2A 1FO0L 1MPAH 3BEVB 3FQNA 3GSQB 3H56A 3WSQH 1HH6B 1JNNH 1ACYH 1KLGA 2R0LL 2HN7A 2N56A 3ASNB 3CVDA 5A3IC 3MXWH 1KPVA 3T65B 4ATWA 1TIUA 5FVNA 1HE7A 2NLJA 4PJFB 5DRXA 5CU9A 3K71A 3WO3B 4KKQA 3VDBA 2XWCA 2HTLC 4JRXE 3PIQA 4OCLC 5FM4A 3O6KH 3US1A 4DHLA 4ZSOB 4EKXA 1G7LB 5DEGB 4JKPH 4W93A 2WZ6A 1AGFA 1S4IA 2YBRB 5FFOA 4KK9D 4AT6B 3PWNB 4TSBH 4TUJA 2VUOA 1OAQL 3HC4L 3D8MA 5BO1L 3RJOA 4E41B 4QNPF 2BSSA 2CA3A 2VLRE 3CV5A 4KPHH 2IFFL 3MGOB 3CN3A 1BXWA 2XNAB 4K8RD 4I9XA 4PBWD 3HZMB 3OMAB 3VXRE 2Q9OA 1TKWA 1B2YA 2AEQL 2DMGA 4M7ZB 4PJ8C 4X4XB 2ZE0A 2A6KA 4CAGA 5I1JH 3D4YA 4Q9QH 3IK2A 3TV3H 3GSWA 4J3OC 3IWVA 3WFHB 1OB1A 5IFAH 1FSKC 3BCFA 1X44A 4S1QL 4MDIA 3SKNB 4RIRA 5DI8B 2F9BT 5E1AA 5SX4H 1JPTH 1RULL 5IW3A 5FYKL 4K73A 4HOZA 4WHCA 8PRNA 4H8WL 5DFWH 3AWEA 3QORA 4P23B 2BIQA 2IEPA 3WGVB 2YMTA 1IB5A 2VLJE 2R69A 2D7OA 4ZAKC 1V54B 2X4TA 3OXRA 3BFWA 3BPNB 3GSNH 4UILH 1BREA 5D1ZI 1D9KD 3DURB 1N10A 3AQZA 1OO2A 3EH1A 5HI3C 3S5YA 4Y9FA 3LIZA 1YEIH 3L4UA 4RGMC 4POYA 3QZOA 2WBJD 4PJBB 1JV2B 3AXLB 4HXBH 5DL6A 3AQYA 3P0VL 5GIRA 5I9QB 5DC9B 1U8LB 3S3CB 5ID1A 5JHDA 4R5VA 2MH4A 3SD5A 3LB6D 3TO4D 4XNKA 3O3DA 3S3PA 4EZJA 3MLUL 2EDKA 3GHEH 5KG9B 1TEGA 4WEEA 2VDPH 4OCSH 1ZHLB 2OSLB 2J20A 4L48A 1NJ9A 1NDMA 4YBQD 3QG6B 1WRFA 4F58L 1JCKA 2YWYA 4G6FB 5BZDB 5EEWA 2R23A 5FKAB 5DURD 2H6OA 5K33A 1JNLH 1QWNA 1DLFL 3MV7A 3ZYZA 2BNRB 4TQPA 2IC2A 5IY5B 1QWHA 1EAJA 2V3DA 1C08A 5HYJD 2NTFA 4WO4A 1WVZA 4M43L 1EEYA 2OTWA 4QRPE 1G1OA 2Z64C 4FCAA 2X88A 1OLLA 1WFOA 2YQBA 4XMXA 1O5DT 1VZIA 5D5MB 5FECA 3P4OA 3VH8G 1X4ZA 1T1YA 1WBYA 1MIEL 2ZKWA 3MJ9L 4L3EA 5HYEA 3PHSA 3H1ZA 1G1CA 3N44F 4AEEA 4P4KD 3CXDH 4Z9KB 1UYWL 2J25A 3C9NB 4PCTA 4FFYL 3NCJH 2VXQA 3LVTA 4L4JA 3ARDB 3LTVA 5E5MB 4BFJA 4DP7X 1HEZB 2WXGA 3M1BA 2UYLB 5F7DB 3FDWA 3MLRH 4D8PB 3TPUA 3L4YA 2G4EA 4WCYL 1PZ3A 3KLDA 4Q6IC 3S4SA 4DKEH 2AXFA 2GJ6D 3QUZB 4RMTA 2ZWYA 3V7MA 3MV8B 4QRSA 1S9VA 2R29L 5DS8B 4B9IA 3GMOA 3O4LA 3CSFA 3IXAB 1IC1A 4L0PB 1LO5B 3MRQB 4P5RA 4WNSA 1OOAA 4P59L 2B16A 4XVJL 4P07A 2BP8A 5ACLA 2B08A 2D03L 1K4CB 2BWDA 1AYOA 4MXWL 1CS6A 2A9CA 4JM2A 2IQ9L 4MNQD 3HG1D 4LSHA 4YSTA 3DV6A 5ENWB 2OMFA 3FFDB 4P2RE 3IDNB 3FCUB 4X98B 3WN6A 5D2LB 4GAAA 2MCMA 5D7EA 4HFUL 1A4CA 5H94A 1A4KA 1JDDA 2E46A 1A8JH 2OMZA 3UP1A 3UAFA 5HDOA 4AM0A 5A2BA 2FE0A 2ZUYA 2KDGA 4FQ1H 2GYSA 4ZXBA 3E2HC 2VISB 4AJ0A 5HBBA 1BQLL 1D5IL 3VFNA 2Y2XA 3BS0A 3GRGA 4DEPC 2NUPA 4ORGA 2UZPA 1UWGL 5PRNA 3IJEA 3QQ3B 4OZIA 4LLUB 3VFMB 3D3VA 4D9LH 3QH3B 3ZRFC 5GRZA 3G6JB 3FTVA 3RHWF 4P48A 3TZVB 3CC5A 3WTYA 3R1GL 4TNEA 4XPGL 1IEHA 3HJ0A 3PQYA 4PGEA 2HJLA 1X3DA 1S7VB 4DAGL 2WXJA 3NJNA 5KBPA 1E8WA 2GTWA 2VR5A 3OKMB 4JZNA 1AR1D 3QHFH 3UX9B 3OPZH 1E27A 4GT0A 5EBMA 2D7QA 5JOFA 1QI5A 4R4BB 3LIUA 5D1QB 5TE6L 1ET8A 2VMFA 3DETC 5H37G 4AIEA 3LQZA 4HEMA 1YPZF 3A47A 3KPPB 1DJWA 4IU2A 1JYWA 2Y24A 3SDCB 5ESVA 5ACZA 1ORSA 5JNYB 3V0FA 4K7PX 1E9PB 1R3JB 3LQAC 3LYRA 4X6FB 2AEWA 2J12B 5TTRA 1WH0A 3GJEB 1AHWA 4YHKH 5IROA 4OFKA 4HYTB 1CFQA 4WU7B 5BUAA 5HGGS 4GMSL 4HS3B 4G43A 5HYSA 3F7KA 1WFUA 1R5IA 3SQOL 3EYOB 2MEJB 4I2XE 5TPWL 3Q48A 2DWEB 1VFBB 3DPBA 1NUDA 2VM9A 4GW4A 4X6CB 4B3VA 5F9OH 1BGXH 4QOKD 3SDDC 4CN6A 4G6JL 1U58B 1A6ZB 3KYKH 2OK0L 3A6BL 5FX3A 2GBVA 4GAJL 5FCUH 1L9RA 1U93A 3B7TA 1CBJA 4JG9A 2K45A 4PRAB 2FT8A 3NFPA 2FWOB 1XIWA 4XN5A 4NB7A 1UACH 1OPGH 4G8AC 4KKRA 5PAZA 5KN5A 1RIHH 3GMMA 5EZIH 4FZLA 1KN2L 2D3JA 4H2AA 4XGZB 4EVNA 4DGYL 4UQAA 2LFUA 2V0AA 2WXIA 4FKEA 1DDHB 3PWPD 1WT5C 2RB8A 4IBTA 5KYUB 2ZCLL 2AV1B 5CMAB 5K59F 2K3TA 4L4TB 1F2QA 1W9XA 1Z6JT 2ITDB 2R15A 4MMZB 3V5KA 4DIXA 3J27A 5C07A 3QIWB 2I7SA 2Y5TA 4C56D 3VRLF 1V3JA 4NQSA 1ZIBA 1Z66A 2G2RB 4TUKL 1H3XA 3TC9A 4ODVH 3HPJA 1DUZB 2ICWA 2WXPA 4W6WB 4JJOA 3QDME 3KPLB 5GZNC 1LE9A 1QQDB 2AK4E 5BVJA 5E5LA 4E1TA 3GIZL 3OXSA 1KGXA 2WXLA 5C0BB 1OQOA 1NBYB 5CHNB 2P8LA 2VTFA 2ORBL 1FE8H 1WSST 3TBCA 3IJHB 4Y5VB 5DK0B 5BXFB 5HTSA 5JUEH 2AQSA 3D85A 2FBRA 3ECQA 2JFCA 3RTQD 3T3PB 3L4WA 4AYMC 4XN8A 1HESA 1NWOA 1B4JH 1GR7A 1T21A 2CXKA 1BFVH 2NT1A 1XBRA 1RUKL 4X8CA 1P7HL 1N0LA 1FYTA 1WJ3A 1EGJA 4LKXB 3UCQA 4KI5E 3QNZA 4P5MA 3G04B 3AT9A 3MUJA 4ICXA 1OSYA 2J43A 4N8PA 4GOSA 1HYSD 4JFXB 2AEPH 4WFHD 4U0RB 5KSUB 1OGAB 4U3SB 2ED8A 4ANVA 1K8DB 4FMVA 2VMDA 4GQ9L 5L8KB 3H42L 4Y19A 5F3HB 1CFVL 3TT1L 2AANA 4QO1B 1ICTA 1CI3M 4R0LC 1ODAA 4HOXA 4N9GA 2PW1B 1FDLL 1UH2A 5FV1L 3U9PH 1TQCB 4BDVA 4DO5A 4JY4B 4X0KB 1BP3B 2ZCKH 4KRAA 4IGBC 4KJPD 1JZ5A 2WQVA 2CR3A 2QHLA 4P4RB 3PP4H 3TXAA 2B5IC 3BLBA 2HLFC 3NEEA 4KRNA 4HPOH 4F2EA 4ZMVA 1G7QB 2FWSA 2VZ1A 3I9GL 1UZGA 4JDVA 4JY6B 1I7UA 1F6LL 1T0MA 3NG5A 1DN0A 4DESA 1IGIL 1IBBA 4NERA 5DUBA 3U46B 3D0VA 5CBEB 3EBHA 5KSAD 1M7DB 3S8WA 5BJTB 3WFEL 1XF5A 3LPGA 4ZDHA 3BWAB 4G8IA 4MA1C 3FN0H 2XWTA 5K59E 2C7UB 5IVXA 1GC1L 3IMTA 1SJEB 4F37K 4MZ3A 2D31B 1WFTA 2EYTA 3QZLA 4O2FB 4RBPK 5LWYH 1VB9A 2CGRH 2AQ1A 1I4FB 2CKBH 3ULAB 1ZHTA 3H3KA 3MBEC 2X9WA 3VGGA 4JE4B 1YNKL 3LPOA 1X5AA 2JIXB 5L88H 2EXYC 2Q86A 3F64A 1J11A 1G6RH 4GS7C 2ZXDA 3LNEA 3CLEL 2NW3A 3O6FB 4LVOC 4JQXC 3VFSB 4XXDB 3L3HA 4NYLB 4ZYKA 3JVFC 1KFAH 4LIQL 2J56A 2XWBA 4XXWC 3FONB 1T83C 1AG0A 4Z95L 4AYFB 3QG7H 2P26A 1A0QL 4E9WA 1YYCA 3K7UA 4PBVC 2QJDA 3B1UA 1J1OL 3BQUB 3T0WA 1UM4H 1GYVA 1P9MC 1IQDB 3BVDB 4GUQA 3C5ZD 1E3ZA 3UJIL 1XAUA 4L37A 3TYFA 3BUQA 4LMQE 3OHXC 3OKOA 5JQ6L 3KAAA 1GXEA 5JHDE 4FTDA 5GRXG 2AZUA 4JG5A 4PQXA 2VLKA 3U0PB 3L6FA 4LCVA 2A6JA 4K2UL 3VSTA 1ROCA 2DIBA 2X6AA 5EZPA 5HI4C 1QRND 1MH5B 2JB6B 2CD0A 1A4AA 4AXWB 2IH1B 5HHMD 3BAEL 2DKUA 5K9KB 1A6AB 4TLSA 5FF6A 4WEMB 2B4CH 4Y4FC 1FA4A 2BCMA 1ZEAL 4YK4C 3MV7E 1T3FB 2VSKB 3ARFB 3D4GA 1J1PH 3JWOL 3Q8AA 4NKMB 1NOLA 5DJAB 4B27A 4G7RB 2GUYA 4FSOA 3ES6B 5HHOB 3GXNA 1RK1A 3HE7B 4XN2A 5JPMA 1N12A 4QHPA 4ZO8A 3WJMA 3AM8C 4X9FA 2ZYRA 5CCKL 5IOKA 4LXFA 4L3EE 2R1XA 4OKVA 1CK0L 1QJ8A 3EZJB 5H37H 1BPVA 2AKRB 1BFSA 4KVCH 5DL8A 1F4WH 2W60A 2VDQL 1YY8B 5J11C 2MRYA 5KSVB 4P57B 1DANT 4OCXH 3WIHH 1P7KB 1HHIA 2EDNA 1NAKH 1BQHA 1NC4A 2A9NH 3FU7A 4JFED 4JCLA 5I17B 2WBXA 1EHKB 1SEQH 1WBZB 4I88A 2WJ7A 3TNMA 2V2XB 4NQTA 2WN3A 3EG9A 3HC0A 3MGAA 3BN3B 3WMSA 1ONQB 3BPOC 4MFHA 5EO9B 2HVJA 1PKQA 2GSIA 4XO5A 2D2OA 2OL3B 5CD5D 3NA9H 3GBNH 5I74B 4DTGL 1FNGB 1P84K 3O4LE 5DJXB 3KBPA 2F5AL 3U1SL 1U95B 4HAGA 1L5GA 4NQEE 4QHKJ 3R8BB 1NGZA 1ZPLA 3CHSA 4ZMWA 3TBVA 2V5SA 3FS9A 4BSWB 1F0LA 1FZMA 2NNAA 2O4VA 2E75C 4RZCA 3ZKMD 4YFLF 2JQZA 3T2QA 3D69B 3NT0A 1RSFA 3LHPH 1KBWA 2BFVH 2ZUUA 5C0IB 5EF3A 35C8L 3QQ9D 2WUCL 3SOBL 2FO8A 3TURA 1G9MH 4EZKA 1WA1X 1KV7A 3GMRA 3A0HO 1QVOA 3EOTH 5BS0D 4WSGA 4WSJA 3X1BA 3RPIB 4FFTA 3FFCB 3JYBA 4R97B 1RZGA 2BMKB 4JKKA 2J1ZA 4I4WA 5AVZB 2ZKHL 4Y7OC 4HU8A 2WMPA 3UP6A 1G7PB 2YPKA 3IGKA 1KN4L 4O2EA 4CMMB 3OJDA 1T04A 3OKKB 4PTTB 3DX4A 3UTTB 4PJGF 4OZIE 3D3VE 2ZUXA 5HY9A 5IMLA 3OC5A 3QRLA 5IWLC 4TYUA 3PWLA 5GZOD 4ISVA 3ME0B 3NYKA 1IC0A 4IRZL 5L9DL 3GDCA 3X1NA 3PQYE 3KPRD 4ELMA 1GIGL 2FIRT 4EI6A 5AOIA 1R9FA 4LNRA 2PYEB 2R2CA 3I9PA 1TZOA 3T8XB 4YHYC 1EUUA 3GTNA 1QWUA 1L0PA 1N67A 1HOCB 5SWZD 4YL9A 4JJ5B 4G11A 4NAQA 5H2BB 2VDNH 3JWNG 4JDTL 2O30A 3Q5YA 4JKMA 4N2KA 4CILA 1Q94B 1QBLH 2UWEA 2XV0A 3OKYA 4HEME 2AP2A 4GKSA 4Y4HB 5FM5O 1J7VR 2FATL 1LEIB 1A02N 5ALBH 2W9EL 4FXGB 2R2BA 4JQIA 4HMCA 5IFJA 3NK4A 4YLBA 1LO3H 2FQEA 3SYQA 2CR6A 2QV2A 2WUBH 3QJQB 1A6UH 1PLBA 1N7MH 2VL5B 1VEMA 1DO5A 1WPCA 3CZKA 4OUUA 5AW1B 2NY0C 3CVHB 4J3VA 2A7BA 2WAQA 2B0SL 4N87A 4A39A 2G0LA 3B37A 1OAYL 3ATBA 2IPUG 1JXKA 4PV9A 1QYGH 4FLSA 2FQDA 3QHZL 1UURA 1X9LA 4ZUTA 2Q7AA 3PGCA 4NT6A 1T80A 4PB0H 2NNCA 4KHXL 4R7DA 5HJBA 1CU4H 1TR7A 2J4UP 1YJDH 2EIZB 1GYUA 1N3NB 4XHJD 3TH4T 1K85A 3GB7B 2CK2A 2J88H 1WITA 3ABGA 5EFIA 5ESAB 2H8PB 5F70A 3DX6B 3EF7A 4QTIH 3GJFH 1ZK9A 2M83A 3PABB 1AZUA 3FQTA 2BIPA 4Y16A 5JYMA 3FUMA 5ABDE 1QPKA 1MHHA 3T77A 4XI5C 1GW0A 2P80A 2XYBA 4EN3C 4GQZA 1NCBL 1BSIA 2QQNL 5EEYA 3MOAH 4KXZH 2C3XA 1I7ZA 1OW0A 5T1LD 3KWUA 1RVFL 1HWHB 4CBZA 3DIFB 1AAJA 5C07E 1J8KA 1QFPA 2F54A 2OMWA 5E6YA 3KCPB 3MXVL 2KZ7B 4N2MA 1YEEH 3V52H 3E6FA 4OF8A 2FEDD 3Q1SL 4LPUA 1CDHA 1YG9A 2W0LA 4L1TA 4QF1B 5FW7A 3ZTNL 1PG7L 3IF1B 3GUFA 1NBVL 3PHQB 5F9JB 2MOQA 4DZ8A 4FFVD 1UJTA 2K6YA 3MRBA 2ZUSA 3GNML 1EANA 1R75A 5J9PA 1SN2A 5DL7A 1K5NB 3CDCA 3ELAT 3KR3H 3TJEH 5F6IB 3P69A 4J3OF 4QXVA 4TM9A 1DQMH 1P69B 4AYSA 1FVEA 3N1PC 5LB1A 1WIUA 4KKBD 1BJMA 1WQVT 5EC1B 2IV9A 3RQ3A 7PAZA 15C8H 3TH3T 4J3BA 4PRIA 1I7RB 2XPGB 4XC1L 3MLPA 2CJTA 3FQUB 1GJUA 2P7TA 3NCWA 1H3PH 5DEJA 4B9KC 5E2WH 4MKMA 1FYTE 4IDJH 3Q3GB 4IEFB 3C08H 1KB5L 5EO1A 4BZ1A 2EEBA 3EO0B 2DMHA 4L1DA 3K8LA 1H3UA 1RK0A 5DJYA 5EH1A 1FO0A 1HWGB 3IJSA 4U1LA 1T1XB 5MENA 1NCDL 3VY9X 3ULUE 2NY3B 4N75A 1LEGA 1BD2A 5LN8A 3FB5A 4CW1A 1ZAGA 1NSNL 4F27A 2EABA 2EIDA 4XNYL 1DBJL 1HXUA 2EDHA 1L9QA 3BISA 3CGTA 4K8RL 4OZHA 1PNDA 3MRKB 1QLEH 4L1BA 3TA3C 5LG6A 3RB5A 5GS0L 4LLQA 5SWSB 2DL9A 4U6XA 1LDSA 3ARGD 3OMIB 1DBKL 4FXKC 1KUMA 3EJPA 2H26B 4LCYB 2W07A 1QNZL 4XVTL 2AK1H 1MEXL 3BDYL 3FB8A 3ZSTA 4D0BB 2B59A 4E0RB 3AVEA 5H2FO 3FSWA 8CGTA 1Y18B 3QA3A 1X5JA 1XH0A 2AJ3A 4AC4A 4AEIH 3BDXA 3O9WB 4DUXA 3POCA 2KDYA 2WLLB 1EA9C 3LKQA 4LCWB 3CDGB 3KPNA 1DL7H 5IVXE 1I1AC 5HHNB 3V4VH 2YSSB 2BVYA 4OF7A 4CVXB 3QNXB 1JYXA 1HSBA 1M42A 1BVZA 4WI0B 2OMUB 2GSGB 3OKNA 3UJJH 4D9QE 3TVMC 3BE1H 4MYPA 1JZEA 1M1XB 2A6DB 4FFZA 1MCPH 3W1ZA 4ELDA 3MV01 1T0NA 4WV1B 5AENA 3TO2B 4HWBH 1A7PL 2NXZB 5C0DA 3INUH 2JXMA 5CUSL 1RCYA 2YMOA 4MQXC 4XOAA 3Q13A 2BJMH 3PF2A 2JNZA 4ONGH 4HALA 1N68A 1CF8H 1QPPA 4U49A 4ABQA 2HRGA 6TAAA 4YSRA 4N0UE 4X5QA 5IBTH 3SDXB 3VWJC 5IHUH 4AZUA 4TN9A 4N3UA 2W0FB 4OM0L 3MOBL 3STLB 1W72L 1VDGA 1KJ2H 1NFKA 3P1VA 3BD4A 1OTUD 1SM3L 1T89C 4DWHA 1MW0A 4ADGA 3TCLA 1FJ1B 3H6JA 5IKCA 1OOWA 4AIZB 2G30A 1KENL 2OKMA 4N2NA 1OAXH 1RJZB 4MXVE 3KGTA 4RSYA 2WXFA 4LDOB 1MIML 5E6RB 4BCZA 1F6FB 2RMNA 2KL6A 1KG0A 4PW9A 2X89A 4AH2B 1TPXC 3JWOC 4JPIA 4R8WL 5FDWA 2V9QA 2VLKE 5E00B 4NZRH 1PAMA 5DVMA 2CBPA 1A21A 4FQXD 3O6MH 1PZ5A 4KKCD 1RJLB 1NEUA 1NFDF 2P24A 1TZIA 1ES0B 4TSCH 3V9FA 4OF3A 4MB5A 3TT3L 1O75A 2V8MA 4EI5B 4KRPD 4YDVA 4MA8H 3CFCL 4GY4A 1QLRA 2CDEA 4OCRH 3TWCL 1P53A 2CDGA 5HHPB 4OLXL 1G7HB 5FYJU 1WBXA 3VX1A 1EDYA 5JDSA 1OARL 1SFDA 2A74A 1JPFA 1SHMA 3N1QC 3V4UH 2V7HA 5MEQA 5HGBB 4KDVA 1JCVA 3T0EC 3WTTA 5EBLB 5ICZA 5SWQA 4HT1L 1DJSA 1L7TH 4NIKB 2NY6D 4HQQL 4P5TC 4ZQKB 3P9MB 1U8CA 2WVTA 2XDHA 4AITA 1G0XA 3L9YA 3X3FH 3RHWK 3HZKA 2NNRA 5LQBL 4M48L 1KTKE 1MLCA 5GGTH 5KYWB 1D5ZB 3JWNH 5HGHA 3UGEA 5DQJA 4A2EA 3GHBH 1OIOA 3W0WB 3B83A 1L0YA 4G9FB 5E6SB 4AMWA 4WTZA 2HH0L 1CD1A 5I8EA 3IXTA 5B3NA 5BQDA 3L5IA 3W11D 4HJJH 5BQ7A 3ZE2B 4G82A 1IBYA 2NR6A 2P5EB 4NNPH 2DQIL 1CICB 3MUY1 4LARL 2DH3A 2BRQA 4H8HA 4I3SL 4IMKA 3N9GH 3ZDWA 4Z3IA 3WDHA 3ULVD 3BZFA 4H40A 3QC6X 3T20A 1QTPA 2FHCA 3TF7C 3FN3A 1SRDA 3Q1EA 1PKQE 5J13B 2C1OA 4I8DA 3R0NA 4FQPA 2NY2D 2ZWKA 2CGZA 3B9KA 4QDGA 1MVFA 3BPCB 3O11A 2IAND 2W5PA 1H6S1 2V9RA 2XT1B 3GQFA 5F7NC 4OFPA 3WHXB 2E6QA 2OAAA 1S3KH 2E9WA 3B2VL 3QNYA 3GSNB 4NPKA 3F62A 2Z34A 3KPOA 3FCGA 4CRPA 4UQ9A 5DMKA 1ND0B 3RY4A 1U92A 1H3WM 4OIAA 4K3JL 3VFVB 4ZK8A 4MNGB 4PRPA 3VG9B 3VXTA 2Y2YA 1AY1L 4LASL 5KJRL 3NIGE 5FK9A 3GP6A 1RFDL 4I9WD 3LKRA 3L9EA 4KJQC 3ZUNC 5GSRB 1DHKA 2BSEA 3CFJA 4TQEL 2DQMA 4MJ2A 3LV3A 3QI9B 2L7UA 2EIKB 4N0FA 4WI3A 2W80C 3CFBB 3BP4B 2J8HA 2UVEA 2VDPB 2YN5A 2Z8WC 5GGRB 1NFDE 3IDYB 3KHOA 2F7QA 4XODA 3VAEA 1WC7B 1AD0A 4JM0A 3OV6A 4FNRA 4U1IA 1CWVA 1JHLL 3UAEA 4QXUH 4LPCA 4ONFL 1EAPA 1NCAL 2O6EA 1RV6X 5AG9A 3S37L 2PCFB 3LEXB 4A67A 1E4WL 1KIRB 3NDZE 3I74A 3PWJB 5AD0B 4TVSa 2HMIC 5CLXA 1IKNA 2AV7A 5C09B 2BC4B 2QR0A 5IIEB 2WLMA 1BM7A 3V0GA 2QSCL 2XWXA 1G7JA 3MNVA 1QZ1A 5L4MA 4YSPA 3GM0A 3WXVL 4KKZA 3V55A 5ALCL 1E8XA 3REVA 2FX9L 3EYSH 4NFDA 4GQRA 1OSMA 3ZW3A 5I66A 4RNRB 2WNXA 3QQDB 5E2VH 1OP5K 3QQ4A 1NGYB 3HJEA 2P8PA 1B90A 3IJYA 3LNIA 3MREB 2UWEE 3KL3A 4HHGA 4F3FA 5IB5B 2CZNA 5FUOL 3RWEB 4G59C 2JKLA 2WWMD 4Z0BL 2CO6A 5SX5H 1UXWA 1TVHB 4NC1E 4ZUVA 2I07B 3T2NL 4S1DC 5TE4L 1I9JL 1TTAA 4G6AD 5JIMA 3G6DL 3MOQA 1FORL 4K23L 2ZLDA 1A6VL 2Y7SA 3BZ4B 3P0GB 4OV5B 3VXRB 1RUPH 1I8KB 3HLAA 3P9LB 2AXJA 2WYIA 1JF1A 1ZT7A 1T7YA 3HB3D 1GZPB 5AKVA 4WSKA 2QTEA 1JF5A 4P2QD 3V10A 1HQ4B 3KE0A 5D1ZD 2XQYA 1UTDA 3BW9A 3EYQD 3VFOA 5IB2A 2A0LC 1LWHA 3QIUA 4FQIL 4JZJB 5HJ3B 3LK3B 1RZJC 3NQIA 1N2RA 3ZQWA 3BPLB 3O8XD 3A5VA 5FYKU 4NHCL 1WG3A 3KDMA 3NDYE 1N8ZB 3MJWA 4JQVA 1UZ6E 1H8SA 4F57H 1G0YR 2IALB 1YYML 1CE6A 1W0YT 4I1NB 4POZC 4Z7QF 2RD0A 1FC1A 5D7LD 4E42A 4XRCA 4FUVA 3HVNA 1AO7B 2IG2H 1B6UA 3B6SA 5JW4Q 3ARXA 5HGAB 2YAQA 3P11H 4CA4A 4YXKH 4N0CC 3QUMH 2F54E 4CL7A 4HUVA 3KMDA 5ABZA 4JFZL 2VDKL 5L0QC 4HCIA 4MD4A 4V1DB 2O72A 3NVQA 2RAMA 4YR6B 3CFKA 3POQA 3ZMEA 4XPTH 4PVBA 4DW2H 3EAKA 3TIDB 4ZNCD 2OMNA 4L4VD 4N90E 2ZOLB 3HI6L 2VOTA 2AJZA 1ZPUA 3NZ8A 1HL5A 4ZBJA 2H3XC 2R89A 4Y2OA 3QIBB 1YNTF 3UJTL 5GPRA 2O6CA 4UB8O 3WD5L 1S7SB 4U2YA 3VFWB 1BZEA 1VGKA 4F8QA 3KPQA 2BY3A 1P6FA 3EFOA 5B1JC 3FTZA 3OB0H 3GJFK 4JG1L 5GGSA 3FCTB 4G8FB 3K72A 1P6WA 1A47A 1HNGA 3QCVH 3UEZA 5GS0C 2WHVA 1PIGA 5EZJA 2CIKA 2W95A 3D2UB 3QHTC 1JXGA 5MENE 3GRWL 3ZZLA 4ZS7H 4B61A 1MAJA 4XMLH 3MRDA 5LUMA 4C83A 1ILUA 1U4EA 4CGTA 1BD2E 2UZIH 5K9JL 1BVLA 1XCWA 4ODXA 5EU3A 2JI2A 5FYJH 3LRHA 4F7MB 3RL1B 3H4HA 1KYOJ 5K9OA 4WY7H 4OZHE 4OZ4B 5C0GA 4NO0A 1JVOA 1YRKA 2DQFA 3OLGA 4NQCD 4BKLB 4JHWH 5J1SC 3D39A 3V8CA 5D7JA 5AVUB 4G83A 1BAFL 4NQQA 3K91A 5IR1A 3SE9H 2I60H 1CFSA 1MFCH 3SGJC 2EXTA 4Y5YC 4X5RA 4U6HB 1GY1A 3II1A 3BGFC 4KZEL 3IMUA 5EIVA 3JXAA 3TX4A 1CI5A 4M6MH 1NL0H 4B6ZA 3O0RL 4N20A 3CBKB 5DD3L 5DRWB 3TN0D 1YO4A 3BAYA 4LL1A 5ADXL 1BQRA 4KKLD 1FIGH 1TEFA 1EH9A 2FJFB 3FRPA 3MMEA 1KELH 4DKFL 4M6AA 4D3CL 4DGIH 5GHWH 3REWA 1FZKA 3MJ7A 1IBHA 3CIQA 5T1KD 2N3JA 4TNFA 4WWKC 4QHMB 4FL4B 5T8IA 4XP1H 3VXMB 4MB4A 2Z92A 1JPST 4Q74A 4JFQA 1UGNA 3W39B 5EMYA 4NQUA 4CADB 3MZGB 5E9DE 2FJHA 1S7WB 4ERSL 3B3IB 2IMMA 2QDVA 4BUQA 4M7JH 1T6BX 1GJIA 4OLUL 2E9IA 1XVSA 4HP5A 2CKNA 1J8HB 4J4PA 1E7VA 2FEJA 3OAWA 1AC6A 2FLRT 3O2WH 1PY9A 4JHAL 4XNMB 3COOA 4ZMPA 2WANA 3C5JB 5E6IB 4A1RA 4EDWL 2G2NA 3VD0A 3FQYA 3U4BH 1TTFA 2KZ1B 2IADB 3DDFA 3T1FB 1NDTA 1UVQB 4OCYL 1UD3A 2E5EA 1IEAB 4LCCC 3RVXC 3ZE1E 2HFGH 3OGCA 1MCNA 3K46A 2IWKA 5ILTL 2AVGA 1KYFA 5MP6L 1F4XL 2KT6A 1INQA 2CNYA 3N44B 4MCZB 4XBEL 3UFIA 5JXAH 4FOZA 5CP3H 4NN5C 2Z0BA 4GG8A 5D93C 5L8JB 3JV4B 1WWCA 3EJQA 2VL4A 4HU2A 2SEBA 3GZKA 4LCIL 1KGYE 1SXBA 2IVFC 4F1ZA 1PAZA 4PWJA 5KBLA 1YVLA 5FYLH 1BV8A 2FZ3A 2A9AA 1VESA 4JUSA 5DMGC 1MHEA 4Y4KB 4O3YA 3QZBA 4BK5C 5I28A 1A9VA 2PUQT 2Q0ZX 3WS3A 1Q72L 1KJVA 1P2CB 3RWFA 1GYCA 4AUIA 3DGGA 4M56A 2CKBA 3Q8FA 4A66A 1XSKA 3AG1B 3L16A 5M94B 1TEYA 3GGWA 1ZLVH 2W1NA 3G9AB 3R18A 3TEUA 3GSUB 2E6JA 5BVPL 4B50A 4A63A 2BZ7A 4XVUC 1NGWA 3DJZA 3EH5B 1I1YB 2VC2B 3VH8B 3WUWG 2F1EA 4K94C 5JHBA 1AGCA 3BXNB 2K8MA 2Z35B 2DS4A 4OH2A 4TUOB 3DA3A 3RY6A 2DEYX 3QAZB 1EFXD 2C9PA 3ORJA 2XWZA 3I3BA 5C0FB 5CBAA 4C69X 3DUHA 5E2UH 4P9MH 1G6RB 3S96B 3U4AA 2JKXA 3FZUD 4PJ7F 3H9ZA 5DA4A 1UZ8B 1TT6A 4QLRA 1J87A 4MJIA 4WEBL 4EAEA 3T1WA 4FQQA 3BC9A 4JJHA 3AA1B 2I9TA 4WIQA 4YDKL 3HVDA 1E5CA 3BMWA 3SBRA 2ODHA 3VMPA 1OY3B 2YEZA 4YHOH 4MMXA 1B3IA 3D50A 1SEBA 2Z31C 4OB5H 1EO5A 3EIFA 2ENPA 1MFUA 2GCYA 3BUTA 3L3OA 4FFWD 2P5WB 3O6LL 4N0YL 3C09B 3PJSB 5B8CB 4PRPE 2FSEA 2ZSVB 1NAML 4KY1H 2E7BA 1DZBA 3KBHE 4GLRH 5T3ZD 1QR1A 2EE6A 3MRNA 3PQSA 1QFWI 3LRSB 2DDQH 1K2DB 2A5UA 5FHAL 1YPZB 5IF0B 5C86A 3OAZH 1DBAH 5B39G 3M8OH 3C6LD 5BV7L 2XZAL 5J6SA 1HINH 4W9CC 1F00I 5DO2D 4PJ5B 4EOWL 2OYLA 4GKOA 5CR8A 4C4VB 1GFPA 1NKRA 1XR9A 3FQRA 1UA7A 2DLFL 3FAWA 1MWAL 5H37A 2X3AA 1Q4NX 2X05A 2BOBB 3SY7A 1OM9A 5HI5C 2E9GA 3BDBA 3TP4A 4Z5RB 2V17H 3SPIA 4HUUB 2EZ0C 3HE6C 1MCIA 3RIFF 3UC0L 5IGXL 4HH8A 3HFFA 1A2YB 2A77H 1HEHC 3QPXH 4NUJA 4YL4A 2EH8L 5EOQL 3ARBC 5CEYA 4XXCA 5DSCA 1L6ZA 2WVVB 3QXDA 4BWTA 3AGVA 1KXTB 5FW6A 4MZRA 2XE5A 4IRJD 1XL6A 4UU9B 1SYVB 4WHTB 4C47A 2BW4A 2G3ZA 3SPHA 3P73B 3VCLA 2PYFA 5F96L 1QFOA 4KO5A 4X5XB 2YGVA 3A0OA 3L5HA 3RAJL 4K3HA 2BS9A 2LU3A 2BRRL 1VFUA 2D7NA 3IDXH 2EKSA 2KPNA 4M1DL 2H32H 4J7RA 3T0XA 4PJ9B 4HPYL 4ZQTA 5M95B 5E99L 4AOFA 4XAKD 3JV6A 4AJVA 3KLHC 2VYRE 1JWUA 2AJXH 3ECBB 4XPHH 2WTRA 1SHWA 3CE1A 3I75A 3QJHB 3KYMA 4G7QB 4IRSC 1IGCH 4MDIB 3UPGA 5HYIA 5JO5A 3UAAA 5IT2H 1BIHA 4BH8B 2ZPKL 3O3EA 5AW2B 5GJSH 1GGCL 4LLYA 1ZANH 3WJJA 3K6SB 1QG3A 2KERA 1AGEB 1JGIA 1AQKH 1KBPA 4L9LC 3DX8A 1YUKB 4RFOH 4XBPA 3SHSA 1RL1A 4DGUA 5KTEH 5AFUK 4Y1SA 5A1AA 1OL0A 1FFOA 4HJTA 3RDTA 4Z76B 2WXRA 2VXTL 3UO1L 3O3BA 3HI5H 1CURA 3C5XA 2AMUA 2QHRH 5EEXA 4PGJA 4A6YL 5SX5K 1IAOA 3MBWB 4CC1A 3WTXA 4M03A 2N7AA 2DY2A 4G1EB 4R90H 3OKLA 1IQWH 1T4KA 1VFMA 1T20B 3N1GC 5DVNA 2XG4B 3V95A 1DVFD 2CRIA 2WZAA 4KAQL 5DL5A 3CLFH 2EO7A 3P0YL 4FNSA 2ZKMX 1MPFA 3EFDH 3RTLA 3CVCA 1CL7H 4HXAL 4GCPA 5G55A 1U8PA 1ZT4B 3OVUB 3PNWA 5C2UB 3DV4A 1LQBC 5DHDA 5KSAC 1ZRUA 4LRNH 3VGHA 2XE1A 4FABL 7FABL 1QASA 3EJZD 3MCYA 3CSYA 4ODTL 5EHFA 5INDB 1I8MB 1TMCB 1ZWIB 4RL9A 2BHZA 3TBYA 4MAUL 3R06B 4RX4D 4I5BB 3UPRB 4K9EL 5CILL 4KROB 4P46D 2OX5B 3DXAE 1S7UB 1IC5L 5DDHB 2BVPB 2HFTA 3KL0A 3UABA 4LSRH 1GKEA 2WYHA 5FO9B 5I1DB 1YEGL 2HZHA 1SLVA 3DVIA 3RGVA 1J5HA 3KXFD 3T0AA 1E6JL 3KL5A 4I0KA 1ZTXL 1NC2B 2ADGA 2R0KL 3GXDA 4NDMA 3HFMH 2LLLA 5DJ2A 2FHFA 5C92A 4GEJA 3LEVL 2CR0A 4U05A 2VKXA 4ODHH 3S4SB 3ZDZE 4F91B 3D39E 1R0AH 4QRSB 1T2QH 3GJFB 2JJVA 4NN6C 3TYGH 3OC8A 4IIQB 4PD4K 4KXBA 4NQEB 4XMVA 2VJXA 5AUMA 5CJQL 4Q9RL 1Z1WA 1U8HB 3MAWA 4JMNA 2AJYH 3MRIB 3CN0A 3D52A 2W9DH 2EEXA 4PJAF 3UGXA 3IEAA 4P9HH 1D9KA 4XX1E 4ZMXA 4AUJA 2FYVA 2F6AA 5MI0B 3L5XH 1SNRA 3IGLA 2MQ3A 3KPSB 1ZHNB 5D70L 2YSTA 2WBJA 4QJ4B 1NGXA 3T71A 4X0NA 1R5WA 4OW6A 3SCMC 3B8YA 1U8JA 4AM0B 4MSWB 3VGAB 3TO4A 1AIZA 3JCUO 4V2BA 5D7IF 5FGRA 1J9RA 5I2IA 3UTPE 4NRXB 4RGOH 3DOSA 1W72A 2ADFH 5DJ0B 5G5DA 2DTSA 4LRIA 1LDPL 1PCSA 1YY9D 1UKQA 3QEGH 4ORGB 5LBVA 4ENEC 3IJEB 4AENA 4XPFL 2BIMA 4BZ2H 2BSTB 4DFIA 4EN2A 4J1UA 4MS6A 3BMVA 1FNSH 4W6YB 4W9GC 4KR4A 1XGRB 2X38A 3CZGA 3ZKXB 1XF3B 4YVUA 3SQBA 3PQYB 4PGEB 3LN9A 5IQ7H 4FQLH 3MACL 3UDWA 4M7LT 5C7XH 3KZ8A 4JKWA 3WV0A 1YS5A 5FGBA 1HS6A 4ELME 5KAQG 2F74B 5HGDA 4JZNB 1YDPB 3IETA 5MEOA 3O3AB 2NCMA 4JCMA 2WINB 4ALAC 3IFLH 4U1GB 3GMQA 3C60C 4P4KA 4Z7OE 5GRUH 1TNMA 5JIPA 4MAYB 4AK2A 3DVNB 4ONHA 3S9DB 5E5UB 1HH9B 5IHZA 2NZIA 3SKOB 1P7BA 1QLEB 5LCVH 2YPLB 3SY0A 4HFWA 3V4VA 2TRHA 1QFHA 2GJ6A 2IPTL 3QYMA 4JK0D 1AHWB 5EEZA 4GRLB 1JGVH 4KX9A 1CFQB 1OAUL 1E4JA 3X13A 3ECUA 1N0XH 3X14B 3ZGHA 3GZPA 2XKSA 4LLDB 5BRPA 3L5WB 5CS7A 3T4AB 4L5FE 3ULVL 3RU8H 2QPFA 1CGXA 1A5FL 1WGOA 1ZSDB 3BWUC 4GAYA 1MRFL 1H3GA 1UXSB 2Y06L 3MRPB 2AC0A 3SPJA 5A2LH 1F3JA 4PJIF 3FT2B 3QUYD 4LBEB 4QRBA 4AYEC 4WU5A 4S0SD 4CNIA 5D1XC 4MNQA 4R2GB 1INDH 2ADIA 3HG1A 3VUAA 1BHGA 1UD4A 2G9HB 3ARQA 1JVLA 4C57C 3F7RA 3QUXB 2G3XA 3OQ3B 4CGUB 4IS6A 4L8SB 3GMMB 4Q14A 2CO7A 2GE4A 3L8QA 3BD5A 2X4PA 5DK2B 3VW3H 1RZFH 4Z7NF 2F53B 3PP3H 1HDMB 1KLFA 2I24N 3AA6A 1OP3K 1RY7B 2EIJB 4MJIE 2NW2A 4MHHI 5F0JB 3S98A 4FQCH 1LLAA 2ZG2A 3GS7A 1YNKH 5IB1A 3GT6A 1KLUB 4RISL 4I18A 2CLVA 5FW8A 4PJGB 4JAMB 3SDAD 1YN6B 2EXWD 1O9ZA 1QNIA 2GG1A 6FABH 3H0TB 5IMMB 1EQWA 1KJ2B 1CXIA 4YHPB 3W9DB 2B1HH 3A67L 5AWNL 2E8YA 1U6AL 5J3HD 3RY5A 4HJEA 2BY0A 3VXSD 2DQGL 2J2ZB 5BV7C 4AWJC 4OLVH 2XZQL 4PGBA 2CGYA 4Y5XA 2NUTA 4R3SA 3A4FA 2UZYB 1U3HB 4ETQB 1NINA 3TBSA 4YHML 1C5BL 5JTWA 4YXLH 2APFA 2IAMB 2QADD 4LDEB 4AQ8C 2Y5EA 3U6XA 1NMAH 2OMYB 3H3BC 4QY8A 6CGTA 3WTVA 2QZ5A 3AXHA 1T21B 3B7RL 5JPNC 4RDQG 4PJCF 2OA9A 3NJIA 2QPUA 1QFUL 1T1WB 4R4FH 1DLHB 1RZPA 3DNKA 4CC4A 2YFOA 3BPNC 4LKCB 4LESA 3NPZB 5GGTA 4DVBA 3QEQB 1J10A 5CZXD 5DHEA 4F2MB 3WNNA 3MV9B 4CJ1A 3KYOA 3PWVA 4CMHB 5B38G 3CFEA 2O4EA 2B1AL 1D5BA 4UTAH 3NCYS 3O45B 2QQLH 5E0QA 4N2AA 2OMXA 4ZI8A 3FRUB 1G5GA 1EEQA 3CZNA 3NACL 4R4NC 2VLLA 2YGQA 3AWFA 3F6IA 4QOKA 3NIDF 5CN3A 3QZWG 1CCZA 1Q0YL 2WXKA 1A1NB 4UF7C 5EORH 4LHUD 3VGFA 3CVIL 2OMTB 3DX3A 3HS0A 3JT0A 4QIRA 5GGQH 1NKOA 2Q6WA 4OM1L 5BNXD 1EHXA 2FLMA 2JMMA 3DX0A 3SE4A 4RAVA 1YEKH 1P5UC 1TZAA 3FTYA 5EUKA 5A40E 2VLME 4PFEA 3PWPA 3IGFA 2QLVB 4L3AA 1EHLH 1JOIA 1OD7A 2CE6A 2AJSL 4XNUL 1ID2A 4JO4H 5HVWA 4TNVF 3A0BO 3AUVA 5TH2A 2WC7A 3UZEC 5C6TH 4ZW3A 4C56A 4F7PA 1QSZA 1MKFA 1Q9KB 4CBPA 4FFVC 5E8DH 5DMIL 3WIFA 1OPFA 4Q6KA 4JY5H 4CJ0A 1X7QA 3EJJX 2LVEA 1BMZA 1OK0A 1MCHA 1TITA 3GXUB 3IFOA 4AUYA 2PXYD 5F88B 2R0ZL 1AGBA 1IAIH 4JRWA 4YO0A 3RA7L 4KKBC 4IJ3C 5I0ZA 3M46A 5GQBA 1UB5A 4PJ8B 4N0UB 4BA8A 3MJ8B 1BFTA 3PFUA 1JGLL 2PR9A 5ANMA 1FSKB 4YN3A 4PR5B 1NCJA 1C1EH 2ENJA 4IKIA 2Q8AL 1JWSA 1TFPA 2DAVA 2FYYA 1XGYH 3KBFA 1DUYA 2L8AA 3KGRA 2DQDH 3ILPA 1CLVA 1OTSD 4TPRH 3RTQA 1JD7A 2ITFA 4AFKA 3OR6A 1G9NL 3SOBH 1MI5B 3U1PA 4NZTH 3OWEA 1H5BA 1YNLL 4TOYH 2AABL 3S34H 1J0HA 5LBSL 1KPRA 2ZXQA 1F90H 3H9HA 1XCQB 4E9LA 2HT2D 4K3DH 1YEFL 1U91B 5JORA 3T04D 2COVD 1CYWA 2E4FA 4UM9B 4Y2NA 1IIKA 1WD9A 3MO1B 1WTLA 2VLKB 4NNYB 2BCKA 5IJVB 1ZHWA 1PD0A 2E86A 4RGMB 3RWJB 3ARGC 1A3RL 3Q8BA 1CXLA 1F18A 1KYAA 3FUJA 4PS7A 1OHQA 1ED3A 4K9EC 1JK9B 1MUJB 1PZBA 4KFMA 5IQ9B 1XZWA 2N0KA 4JANA 1P4LA 5FO8B 3NRFA 4NJAH 1P1ZB 4H0LC 3FQ2A 2WLZA 3QISA 5EU6A 1OF2A 1A3LL 32C2A 5EN2A 1WF5A 3AGWA 4HF5H 4DN3H 1XGZA 4LSSL 5TDPA 5LGJB 1JRHH 1CLYL 2BVQA 1WGVA 1RK1B 2P42B 2E27L 5SX4I 1UWFA 4K5PA 4GRMB 2HT3D 3QUHA 4OV6F 1AH1A 1XGUA 4IJTA 4X8XA 2XTJC 3MLZH 4HIEA 3VXOA 2QQQA 5F89A 3S88L 1XGQA 1V5JA 2FLBT 5HHQB 3HN3A 3QDGB 4CVZB 4YSOA 5J1TC 3QO1B 5KW9L 2Q3ZA 2EACA 5EBWB 3VWKA 1IEBA 3QCTL 4DEWA 5FUCC 3LH2H 3LMJL 1CZ8H 1TOXA 3ARED 4X9BA 3VVVA 3RKPA 4G70B 5I8KL 1UT9A 1P4IL 2DYPB 4PTUA 5CJBA 4GG6B 1HK6A 1RUQL 1RZKL 1TQWA 1INEH 3Q43A 4GJTB 1K8IB 4C4KO 5DLML 2N59A 3PYCA 4NAJA 3QUMA 5KJ7E 1OTUC 3QJVB 5FGCB 5CGYD 3UZQA 5DFAA 4Q6IB 25C8H 2YGNA 3AC0A 1ZGLM 2NNAB 4L8BA 1CN4A 3LZOA 3GSVA 3RIAF 4LU5L 3CFNA 1AQMA 1U8OA 1Q38A 3C5ZA 2IO5A 3LN4A 4JHUA 3MVSA 4OF5A 2F2HA 1IL1B 2EADA 2IV8A 4YSUA 1M9SA 3TZGA 1QVOB 4HS6B 4OT1H 5DJ6A 2Q8BH 2GK0A 4S1SL 1XMWA 5DHVH 2YD1A 3IMBA 1EDQA 1OSZA 1RZJH 2YD7A 4GO8A 4E41D 3GUTA 4NP4H 3RVUD 4I4WB 4ZTOH 3WXWL 3BVNB 1ZS2A 1NFDB 4RDBA 2BOCA 2R4SH 2DQTL 2GSMB 5ECGA 4XN9A 3UBFA 2GTZA 3OJ2C 4U1HA 1AR2A 4L3CB 4MS8C 3SGDI 2BO0A 4XP6H 3E2HB 1LEKA 2KYIA 1SMAA 2Y07L 4MCNA 1OSPL 1W0WB 3D1MC 3B2UC 1RUAH 2NY6C 2GIMA 4NLAA 4DEPB 2I5YH 4ZUSB 3H3PH 3L95B 5HYJE 1EO8H 4JB9H 3GSOA 5D8JL 4PJXF 3ML9A 5GRVK 3V6ZA 4F33B 1N4XL 4G7YL 4MVBD 3BKML 4OR1A 5IFHL 4LE8A 1R5VA 1TQBC 2XV2A 5T3XH 3FQ1A 2YK1L 4RZKA 4P23D 1YYLH 5I6PA 3IU3B 3RWHA 1P6AB 2X3BA 3HNVH 1WZKA 3DSNA 4PP2A 2XQYK 3FB7B 4HKXA 3VRJA 3WKMH 4JO2L 4KK5C 4YPGB 3EUDA 2JJTA 5EC2B 1DBBH 1N6VA 2K0LA 4M61A 3RBGA 2Y7QB 2GT9B 3K6IA 1KCBA 3D4ZA 2J5LC 5DQ9B 1BBDH 3WN5A 4JFEA 2XWRA 2NY2C 2NOYA 2QELA 3QORD 4UINH 3NJLA 3RRQA 3W56A 1UENA 5DJZA 5DQDL 2GJ6E 1CE1H 4YUEH 2D0GA 1MRDH 4R6UA 4Z3HA 2E4TA 1DFBH 2QGBA 3VXPB 1WAAF 2F18A 2CJUL 5CAYB 1ETZA 4KJYB 2OSYA 4H8UA 4N3TA 1KCUL 2ZG3A 4G6FD 3N0PB 4JMXA 4UI2A 2VDLH 5F72S 3HOEA 4Y1TA 2PORA 1EDHA 1S5HB 1IT9H 2CMRL 2WKOF 3FCSA 4GW1A 1F02I 2BNRD 3HG1E 4JZOA 4MNQE 5EFIB 3VJ6B 1WT5A 3BZDA 3GIVB 2GUOA 1MFBL 2IBGA 3SDDB 3IFPB 3LDBC 3A6CH 4Y16B 3RIFK 2HPTA 2DMBA 4UDUB 2Y2TA 1M4KA 1ZSHA 5ID0A 5IV2B 2F8OA 1FUNA 2DIEA 1F58H 1LMKA 2V3EA 2E7DA 1R3KB 5T3ZL 4OFYA 4N68A 5AAWC 5FHBH 3IM1A 3QARA 4LSFA 2Z1KA 2FUTA 4HCRH 1RLWA 2EIMB 2UX7A 4I3RL 4QHUB 3ARDD 3W3BA 4YIQB 3BSHA 2K0RA 4ZPVB 5IB3A 4H1LB 2VABA 5CP3A 5C71A 1XTMA 1UD5A 1OE3A 1DJIA 2YAFA 4QWWD 4JFFD 5IQNA 2EH7L 5JHAA 3QUZD 2ZJSH 3B7YA 3PS6A 3KPRA 1UT1A 1NEZG 4L3ED 1FNEB 4WGVB 5CR1A 3MV8D 1KGIA 3SE3A 2DBLH 4LL4A 1XD0A 4M9PA 3VI3F 3PL6B 3Q0HA 5IEHB 1IKFL 5T1MA 4OGAC 2A4CA 5SWZA 3SODB 4FERA 1SMDA 2EYRB 1HSAB 4N6QA 1VEOA 3VX0A 4Z8FL 2XG6A 3K2UH 3A23A 1AD9B 3CFMA 4NS0A 4MD0B 1VFOA 5DFTA 5DZVA 3IJ7A 3JTSA 3S36X 4JVUA 2VMJA 4Q7DA 1ASOA 5E8OB 2HFFA 1J5OL 3PP3K 3JWNE 1D5RA 2R9HC 2L7QA 1AIFB 1X5GA 3IKCA 1L9SA 4LHUG 1TVDA 3LRMA 4XPBH 3ZHKA 5JDPA 3PNRB 1FL6B 1P7QB 1BQ5A 1XB6A 3QNFA 4QTHA 3WEMA 5KVFH 2WWNA 3S5LG 5TK4A 2IF7A 3G3LA 4PBDA 4QOKE 1GYAA 3BUIA 3DJTA 2HKHH 3FO2A 2K4TA 2XUWA 3CDZA 4XNZC 4R0LB 4X2UA 3CUPB 3TZVD 3ZR5A 4PVMA 2PO6C 2VDRH 4IGBB 4BFNA 4Y8DC 2WSPA 1ADQH 2B5IB 2R8SH 4H0HB 5C0EB 4I1RA 4Z7QB 5AYUL 2BVOA 3PWPE 1U41A 4KXCA 4UTBL 4URTB 3V4PH 2HXAA 4MJ6A 5T1LA 5D71H 2HP4A 2XWJA 5AVVB 4NENA 2XZZA 1Z9SA 3DX7B 2F19H 4JFHD 4MA1B 5FA4A 4C56E 4F4BA 1F6AB 3SDCD 1JHKH 4K94H 3SJVB 4OIFA 4U1KB 2H0PA 4QXGL 3K8KA 2RJMA 4WI8A 3HN8A 4J3SA 1G9NC 4OSUL 1RHFA 2BIOA 5E9DB 3RE0A 1SGKA 3MBEB 2W65A 1KIUB 3SZKC 1KT2B 1JZFA 4FTVA 3VI3E 3AAZA 3MZTA 5ANME 4GS7B 1YNTB 1IZKA 4M8VA 1CDBA 4HLZG 4LCUA 1VZGA 2BXZA 5TE7L 4LVOB 4JBSA 2WXMA 3ZGIA 1ZHYA 1M05A 3W2DL 4N8CH 3KWTA 4DGVL 2WWOA 3SPGA 1M9WA 4XNBA 4HBCH 4FSPA 2P52A 1V10A 3GSXA 3L1EA 2X4QB 2P48B 1W6WA 1T22B 4DZBB 1LNUB 1R34A 5CEXB 2ADJA 1XR8A 2WP3T 3BH4A 1I9RL 1HHGB 1HIMH 1MELA 3RWDB 3RVWD 2PNDA 2YAHA 4YBLC 1X9UA 5E56A 4WW2C 4WFHE 2HX9A 4FD0A 2V37A 2A83A 5KVEH 1OQXA 2MHAA 4X7TB 2WQRA 3ECWA 3RKDD 2WSDA 4K7FA 4S2SA 2OXGB 3OHXB 4LZKA 5CJXC 2FJGA 3DROB 1GSKA 3QIWD 1DSFH 3C6EA 1DANU 4J3TA 3K74B 4ZW7A 3EOBB 4YDVB 4O49A 2X4OB 1PZSA 3PDDA 1QLRB 2CDEB 4W9KC 2CDGB 1TO5A 2ZX9A 3A24A 2DTMH 5DD0L 3F7YA 2H32A 5E4AA 4HIXH 1A1OB 4HKBA 4KKLC 2WVPA 2V7HB 3VZWX 3SO3B 1JGUL 4L0ZA 4Y4FB 4NKDA 4LEXH 1J88A 4YK4B 2XRAL 3TFKD 1N5AB 1OTTD 1FP5A 3NFNB 1JE6A 1RZKC 3FN9A 1BPLB 5GISL 5E4OA 3H9SD 3OKEA 3GXTA 2RHEA 1FBIL 4LLMA 1UQSB 2XIIA 3TPKA 5BPPA 3MRMA 2OZNA 1AE6L 1AHMA 2ZNXA 2ZOTA 2OULB 4XVSL 5T1DH 4N26A 5FWQA 4PHZA 3UBGA 3X11A 3E6HA 1B0WA 1I3UA 1LD9A 1RPQA 2FBJL 4WI6A 4TULL 3BEWA 4HK0A 4X80H 2J7LA 4U6YB 4H88L 5J11B 2AEOA 1OGAD 2ZSWB 4YC2B 4PYHA 1HKLL 4FXTA 1ADWA 2NY5L 3E1F1 3ZPDA 1KIPA 4PJEF 4ZFOA 1P4BH 1CTMA 5JHLH 4HW6A 3BPOB 4ANWA 2KXPB 4I3GA 1U8MB 4RGNC 4EXPX 1TVBA 4FQJH 3LZFL 1SDDA 3SZVA 3GMPA 5LDUA 3US0A 4B5ZA 3EYFA 2ICEA 3S3BB 2DQEL 4HMEA 4U3CA 3BWUF 4QTFA 1BOGA 3DMMA 3WYRA 4AQAA 1JGEA 2WO2B 3CZSA 4I0PC 4Q0XH 4Y19D 2WJ5A 3JYCA 4NUPA 1YEHH 2V5YA 3P2BA 2VXVH 1J0JA 4M7KH 4PRDA 4QXTB 2R56L 1ASPA 1ZV2A 2YD0A 1KPUB 5HYQA 1RKRA 3L3KB 3ZHFA 4NOFA 1DVTA 4FQXA 4FNLL 5DTFB 3EO9L 3WFBL 2NNXA 5B21A 1E2VA 3G08A 1LWJA 3MNZB 1BEXA 2L7JA 1RMFH 2R1YA 2XN9B 4K3EL 4LLWA 4XP9H 5HHME 4KZDL 2YXMA 4JO3H 3D34A 2JIXD 3U7YH 5EEUA 1UJ3C 1HC1A 2O6PA 1MREH 2IPKB 2OBGA 2ICCA 1BFOB 1A9BB 3EJTA 3R4DA 3MGTA 3O6FD 1SMOA 1S9KC 3GSRA 7PCYA 1JTTA 4F7CA 2ERVA 2QR0B 2RQEA 3SIKA 3TBTB 1BYPA 2VITB 2APXA 4UB0L 5FLUA 4QJ5B 4B60A 1H6TA 1MJ8H 4RMBA 3ATFA 3FSOA 1E5ZA 3DVFA 5TD4A 4A7GF 4AZ8A 4OD2A 4CKVX 3F01A 3ALXA 4YHYB 3KJ4B 2QMJA 2R88A 1AMYA 1UD8A 2JKIS 3BQUD 2E7HA 4F3FB 1S9XB 4P5KB 5C9KA 4HIIA 1J9CT 1GSMA 3ZOAA 4KR8A 1PYWA 3HLKA 3NSDA 1K3ZA 5J1AA 3X3GL 2IOIA 1AZCA 3B9VA 4PJ7B 5CSZB 1E9OB 4YPJA 3EFFA 4JFEE 4X4KA 3KWVA 1BIIB 4NKIH 4O2CB 3GK8L 2M2DA 4MX7A 2VZVA 1GW6A 3DHJA 1SY6H 4YNYA 1PSKL 1KIQB 2EECA 2WM0A 4ZFFA 3W9EB 1JZIA 5FB8A 2MNJB 2VH5H 2BSRA 1MJJA 3LKPB 5GGUA 3WUWB 5C6PB 2NY0B 1QATA 3ZE0F 2Q3AA 1ZGLA 2K6ZA 4FP8H 5IB2B 3ZDYE 1QLFB 3CN1A 4OJYA 1Z3GH 1JVKA 1IC4L 3VTAA 2N1TE 2BWQA 5FEBA 4BZ2A 4PLKD 2G4GA 4U7MA 5I0VA 3BRZA 3F2LA 3U9UB 3KDMB 4BXSV 4M3KB 4Z78B 1XH3A 2HJKA 4FQ2L 4JGUA 4M5YL 3HE7D 3WEBA 1M2OA 4GUOA 3FO9B 3ESUF 2J4WL 4JDEB 1K4DB 3LCYA 4XT1C 4KHTH 1KTJA 1KTLA 3E8UL 4PLOB 3ZX1A 3UYPB 5DWUL 3HZVB 4JFVA 5GS1C 4KTDL 3U7WL 1OM3H 4OVUA 1U3JA 5H35B 2YAPA 1ZVSB 1GOFA 2WXNA 2GTQA 5BOPA 4KJWC 4MDJB 3ZTDC 2Q2LA 5F9DC 1FFNA 1G90A 1NBZA 4JEGB 4TNVK 5AW6B 2V2TB 2IH8A 1O7DE 2FL5B 4BFRA 4L2YA 2I85A 3KPRE 2ZT9C 3MRGA 5FYLE 3TNNA 2JLPA 1TCRA 2AJZB 5LCVA 2FR4B 5BZWA 1CIUA 1NIFA 2YPVH 3S2CA 4ONOA 5I1CL 4HLZH 1ECZA 8PAZA 5CEZH 1U3NA 1CLOL 3IGUA 3UTOA 1PLGH 4BSJA 5JW5A 5SWZE 2VN4A 2CAKA 2APTA 1S7RA 2X9ZA 2Q7YA 3MNWA 5B39B 3HNSL 3EFOB 4RMQA 3QEUB 3QJFA 3JTYA 3PGSA 3FTGB 2FBOJ 1KMGA 4X6EB 3R7RA 4XB8A 3EYVB 1XF2A 5E94A 2OI9C 4XBEH 1A8ZA 1I31A 4XC3H 2ZF8A 3DXAB 2HVBA 2Y36L 3F7QA 1R33A 3JWDC 1QSEB 4KUZL 2PW2B 3IJ9A 4OUOA 2R4RH 2R2HB 2X4UA 1IO4C 2A38A 1S8DB 3FFCD 4NHUA 2OMVB 3MLSL 1G7MB 2YLHA 5MEPB 4ZD3H 3OAYH 2HG5A 1UM6H 5D7SL 1T66D 4ODXB 4LPXA 5H4ZA 4KTGA 3QR1A 4F24A 4LK4A 3QDJA 4KQ3L 1FNFA 4ALAH 4P2QA 5AB1A 5D1ZA 5AZ2L 3BKCL 5C0GB 2MQGA 4NM8H 5DUJA 4EBQL 2NMSA 3D18A 3AU1B 3TEXA 4FG6C 3K0WA 1X5IA 4ZS6D 3CX5J 5HDBE 2XIDA 5CM1A 4ZFGH 2I69A 3O8XA 3QRGH 3D06A 3TA3B 2EDDA 4RMVA 4KH2A 2CHZA 2PYED 4J6RL 4D0CA 4W9ZA 4X4ME 4FXKB 2ARJB 5LXGL 1JG9A 4GBXD 4K07A 5A6IA 2G5BA 1ZVYA 2G2PA 4JRFA 5TDOB 1W0VA 3V0AC 2PCPA 3TVMA 3VFRB 3IBOA 4M3JA 3NN8B 5T33H 4YHIB 2A4ZA 1CUOA 3H9YA 1NFIB 4JM4H 5E5RB 2X7LB 3VFGH 4JR9H 3CZFA 4Y4HD 4W70A 2XKUA 4ADJA 4N2IA 1I1AB 3GI8H 2MQCA 4LEOA 4BSVB 3FQWB 2FX8L 1FHGA 1YEJL 4AYDC 3DHPA 5DVLA 5BMFL 5D2NA 3F85A 2HWZH 3F84A 4HC1H 4PG9A 2A9MH 3KPMB 3GMLA 4V2CB 4X42A 1HILA 4L4VA 4WRLA 4NQDB 1TZ8A 5HYFA 4LEEA 1UCTA 3ESNA 5TQ2L 2AQPA 4K15A 2C8NA 4PJDF 1MFEH 2BDNL 2WYTA 5EU7C 4NUGL 1A66A 4IBYA 2VSMB 4B9PA 3WJLA 2WQUA 3MTRA 5AW0B 5GS2H 3WNJA 2WLNA 3QJSB 4RRPM 5D55A 4OLZH 5LBSA 2Y1VA 1JFQH 4UTAA 4XBGA 4N0YH 3TL5A 3T0VA 1OAZL 1VACA 5C0RH 4PJ0O 5AVXB 4BELD 2WLIB 3Q8EA 3H2WA 1UXMA 2R7EB 4ILDA 3MRRA 5DJ8A 3KDPB 2ATAA 2OM5A 1NMBL 5DJCA 3RWCB 4KQ0A 1S46A 1SJVA 1U8IB 1EEZA 4G2AA 3SBPA 4J8QA 1L4IA 3RIAK 4X6BA 3BUYA 4MQTB 1E4KC 4L29A 3QGVA 2YOCA 2HKFL 3HHSA 5I1AB 4YFLI 1S7TA 1SF3A 4B9JA