2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
b'GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR H BINDING PROTEIN
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
2W80C 3VE1A 4QQ1A 5EE2A 3KVDD 4AYEC 4U9CA 2LFUA 3PQUA 3HOEA 2KDYA 4AYDC 3UAQA 1YS5A 4O3ZA 4AYID 4O3XB 3V8UA 2YPVA 4AYMC 4O4UA 4O3YA 4Z3TA 2KC0A 2Y7SA 4O49A 3VE2A 5T5FA 3HOLA 4O3WA 4O4XA 2W81C 4AYNA 3PQSA
chains in the Genus database with same CATH superfamily
5KSBB 3TFKC 1MHPH 1HH6A 4EN3B 5SWZD 4LHJB 4DAGH 1D5XA 1ET5A 2C9RA 1ZA6B 1QFWM 5F0LB 4X8CA 5HVGB 3QG7L 1KYDA 4BQ9A 3Q8EA 5LN8A 1RZQA 1ETZB 3MRCA 2F7IA 1J1OH 2GFBB 4UQIM 3LIZH 1WTLA 5ANME 1VIWA 4IJ3C 5EA0L 2R8SL 1AY1H 3SO5A 4P2CG 4HULB 4XPBL 5INDB 1RVFH 1I53A 2Z4QA 1EJOH 1M57B 1ZIAA 2Z35B 4PRNA 4FQHB 4K8RD 1CGYA 5TJWK 5ISZE 1M56B 4ZO7A 4LFHD 5ERWA 2R4OA 2N7BA 2BFVH 5KYUB 1OGSA 5DD5H 3IDGB 3FFDA 4N2MA 4A37A 5JHBA 3IM1A 1XL6A 4UT9A 4G42B 1T0PB 3PXLA 2AXFA 4U31A 1ZT1B 3C87A 1JF6A 5D2LB 1E4WH 4P05A 3QFJB 3VW3H 3LN5B 5CIPA 4M1GL 3F5WA 4MHHG 5C8JB 4D0CB 1J8KA 4Y1TA 3I2CL 4MNHB 1CTMA 3CNKA 1XGTB 2EE0A 2MNUA 3AXLA 2JE8A 1K6QL 1WUZA 4NNYA 2P46B 4FQXC 4N85A 5C7XH 3JWNH 3ILQC 5ACZB 3RNQA 5CGTA 1YVLA 3LRSA 5DUPL 5B8CA 2DLIA 3O4LE 5IWLA 5DQ9B 3FTYA 3D69B 1ZHYA 3MFFA 2X27X 1MLCA 2BOCB 4FTVA 5BOJA 3ELQA 1CDHA 3BC9A 4K2UH 5J89A 4JM2F 2J55A 2NPLX 1YPZA 3NA4A 2WGNB 4XT1C 3VFGH 2AQTA 3A6CL 5CGYD 5L4JA 2W0KA 1TIUA 5EORL 4PY8I 1P5UA 1BGXH 1CCZA 1DBKL 3WLWC 2QSCH 2P7TB 2Q86A 2QELA 1R46A 2FWLB 3WN5A 2K45A 4NNXB 3LVEA 2V2TA 5B22A 1UACH 4L4TA 3FHQA 4R7LA 4AYDC 1U2CA 5F93C 1M9WA 5F21B 2CGRL 3UX9B 4KO5A 5CS7A 5D7HA 1RZIA 2ZWSA 4MSWA 1KCKA 3U4BH 3CN4A 2WP3O 3ARWA 4MB3A 1TKWA 3SPVA 1A4AA 2HPOA 3RIKA 3KG5A 5CHNA 2WVSA 5EIVA 1FAKT 1R5WA 3EFDL 4J1UA 4NP4H 4YBLC 1EWHA 2CLRB 3T3MF 4AH2B 2PABA 4H8VA 2KT6A 1T7VA 3MLYH 5KVGE 3HUJF 4FA8A 3S36L 1JPST 2HX9A 3LB6D 3EO1B 4M6OL 3ZHLA 1OVZA 2CKBH 1M1SA 2GPZA 1JZDC 4W1TA 3A3YB 5HGHA 2BSED 1B4RA 1ZTXE 4MA1C 1MXDA 3V0EA 1YEWA 5KVEE 4HCFA 3GBNH 5AVXB 4XCFL 1GGIH 3X1FA 1JK9B 5D2LE 3QFJE 4ZOEA 2OTUB 4CDHA 2CBOA 4JG1L 2H1XA 5J5EA 1CE1H 5TF1L 2VH5H 1OT4A 4J6RH 2H1PH 2AXGB 5FUCC 3TYGH 2IH1B 1QACA 3KGTA 2AERT 5EBLB 2OW7A 4NQEE 1NC2B 4JGUA 3TVMA 5GGSA 3DGDA 5IESH 4KKCC 4B5EA 4UDUA 5ICUA 2CJ3A 4OLYH 3S88H 3ZQXA 4OI7A 2NZIA 2ESVB 2N2MA 3FB8B 3O6FC 5TDOA 4C00A 3MLRL 3OLEA 3B9DA 5FYLH 2RCSH 3TYFA 2BSBA 4AL8L 1DVYA 1BAFH 3FB7A 4PS4L 4FFYH 2YSSB 4PWIA 1JWMB 1YMHA 3VZTX 2Y23A 3LX9A 4ZUUB 2GABA 4YH6A 2W07A 3C5JB 4R4FL 3RTLA 3VG0L 3CSGA 5K69A 3M1CA 1L4IA 2DH3A 2JF1A 3RWEB 2R4RL 1T1XB 3SYSA 5GS0H 5T1LD 2NYYD 4TSAH 5JW4M 2PXYB 4R7XA 3HZVB 2I07B 3RTQB 1UWXK 2L8AA 2NOYA 3OXRB 3P77B 2OYLA 1QSZA 5DFTA 1FLRH 4U4IA 2PP7A 5F71A 5E6IC 2FGZA 1UA7A 5DUBB 3DWTA 3LXUX 4U6XA 2VJ0A 4XZUA 3QCUL 2H8PB 5JMOC 2J8UA 4HAGA 2JQAA 3NSGA 1JGUH 1Z2KA 5D7JB 3S48A 3ZDXB 5HYFA 1BX2A 2XXMB 2G5BB 3O4LD 1AGEA 3O3BB 5EEVA 4Y1AB 3GMRB 3RFZB 3D0LB 4LDEB 4DEPC 4N26A 4UOQA 4PJBF 4ZUSB 2WYTA 5GIRA 4FZ8H 5C6TH 3VXTA 4TUUA 4S0TD 3MNVA 4NKQB 3HG0A 3N1FC 5E9AA 5IBLD 4XMVA 3QEUB 4M6MH 2FYVA 2AQ2A 1SDYA 4PJ5B 3LS4H 3UBXG 3DOIA 1CBVH 1EO8L 5DL7A 2OMTA 4QGYA 2SEBA 3PWUA 4D0BA 4XHJD 2PO6D 2XQBH 4JY5L 3U9PL 5DJAB 4ZSOB 2CDEA 3LAFA 1FO0B 1NLDH 4S1RH 4EN3D 1FIGL 5L8JB 3L3GB 3POCA 2ZXWB 2FZ3A 3LHPH 1A8ZA 3Q5OA 4L8SB 5BZDB 3Q1EA 1DZBA 2GEEA 2B8OT 2IQAA 2EE3A 2ORBH 2ZCHH 3MNDA 3UXFA 5IQ9B 2ESVE 4ZNEE 2E56A 2G3MA 3GMMA 1KJMB 2CUHA 5E99H 4OVUA 3ZDWA 1MW3A 3PG2A 4XMXA 3SDAB 1TXKA 3QUZC 4U2YA 1R3LA 4PFEA 3GJFB 4C57C 3HNVL 1M71B 2LTQC 2GSIA 2DIBA 2OZ4H 1B2WL 4I4WA 1SY6H 4APQC 1SJXA 2VSKB 2E59A 1I8AA 4K3HA 3D09A 4LBEA 4ALAC 5CAYB 3V0AC 2NY5L 5CJBA 3WTUA 1MRFH 3D06A 3ZL1A 1LO0L 2WLLB 5JHLH 1SMDA 1FE8L 3RYMA 2YPVA 4WK2B 3QFJD 1MFDL 3GDCA 2A83A 3GRGA 1BLNA 1DO6A 1PDKA 3N85H 4KMLB 3OZ9L 4IRJA 3TWYA 1R34A 1RZKH 2FEEI 1HKLL 4W9ZA 2XWJB 2Z9TA 3C09B 3CDYA 3NFPA 4JZOB 5ES4B 2FGWL 4NQED 4I85A 5D1ZI 2YO3A 5E0FA 2Q8AL 1OQXA 1Q9FA 4QTFA 1HZHH 3ZDXE 3RVXD 1I85A 1UWEL 43C9B 3EOTL 1RFDL 4PGCA 3QJHA 2XIDA 4Y1AE 4CVUA 3P40A 4P4KC 3NCJL 3DO4A 4AYMC 4N1CA 4NQDE 4P3CL 1ACYH 4QDGA 3NJNA 4HKXB 2WJRA 3IGUA 4G7YL 5JLZA 1FH2A 1P5VB 2NZ9C 5FDYA 5IEHB 1U8LB 3UAFA 4Z7AA 1JI1A 4FJ6A 2XZQH 1M9SA 1ZWIB 1ROWA 4X7TB 3QC6X 2NUTA 2J71A 2JJTC 3ARGA 2CALA 3PNRB 5E08L 5DJDA 5KANI 3ET9F 5DC2A 1TZHB 3E6HB 3GMOB 3DDGA 5DTFA 2H0FA 3UZQA 3GBMH 1JYNA 2NY6B 4XN9A 2Y06H 3CFNA 4V33A 3S37L 2I25N 2WKLA 4FQQA 4M02A 4KKBD 3BVDB 3VGAB 1GFPA 1CICB 3D0VB 1CR9L 2M83A 3L9RA 2EYRB 2RACA 3QEQA 3AU0A 4NRXA 4OGAD 3VQMA 2AEPH 2JB6B 2VT0A 2ZKHL 4ZO6A 5AYUL 4HGWA 4GXFA 1UM4H 1I1YA 2OMYA 3JWOL 2HWZH 4NSKA 4OZHF 4YQXL 4F33A 1HE7A 2MFNA 1MLBB 1RIUH 1B0IA 1WG3A 1FNEB 5K33A 2DL9A 3R7RA 2H6OA 3IDMA 3F7VB 4UI2A 4Y4HC 2KPNA 4DW2H 2XETA 1EHAA 4JE4B 4POYA 1S5HB 5KTEH 4GCPA 5I16A 4EKXA 4H8QA 4MZ3A 1NCDH 2XXGA 4PV9A 1P7KA 1CDJA 2NT1A 3QDGE 4KXDA 3T0EC 3JVGA 4IQHA 1QEWA 2APTA 4WSJA 3SQBA 1U3HB 3CLEH 4G6ML 4WO4B 1NSNH 3ZPDA 4KRAA 3WMPA 2IO5A 3NTCH 4NUJB 3CN3A 4EPSA 1QASA 3B56A 4LMQI 4GFTB 4OZGA 3GKZA 4XCYA 2OQJB 4UT6L 3LK3B 2APFA 2R1YA 5KYWA 4W9FC 1P84K 4WCYL 1KJVA 1OSYA 2ESVD 3MLZH 3VG9B 4NENB 1RU9L 1YEGH 3HPLB 3F7LA 3TONA 4E9TA 2L7JA 2X0UA 4CC1A 2GITB 2Y7QB 2P43B 1RK1B 3RIAK 3HZYA 1MOEA 3R19A 4YHKH 2NY0C 3UYPB 4CAGA 2R9HD 4JUTA 2FJUB 2G9HB 3QIBC 3WEOA 1OO2A 2NY2C 5EZPA 4LCCC 1N4XH 4RAUA 3P0YH 5I19L 3R18A 1VZGA 3QIUA 5CP7A 5D5MF 2PXYD 4DPRA 4ES9A 5DEFB 1TJXA 1U9KA 3KD4A 4CSTA 4IGBA 2NMSA 4DO5A 5BPPA 4I5BA 2C1PB 1MWOA 2WKGA 3BVUA 4UB8O 3W11D 3LVTA 3ESVF 4PW4A 4G43B 4I1PA 2VDQH 3FB5A 2CIIB 2EDJA 2Y36H 4CJ1A 5FXCH 1CFQB 1ZPLA 1KJ2B 2VLRB 2ZE0A 4J12A 4M3KB 4JPWH 4UT9H 5D7JD 5FW6A 1NFDA 3NGBB 3NZ8B 1J0KA 4CMMB 1OSEA 4Y1AD 5IJDC 4LLWB 1J10A 3PDGA 4NQDD 1KMGA 1AOHA 2WCGA 1V8HA 2O6FA 4GW5A 3ROOA 3LKNA 1AZVA 4I18A 3PUUA 4ODUB 3EDDA 4NQCA 4DERA 1E4KC 1PFCA 3DC0A 5CF3A 4GF4A 1MZZA 3IEAA 3PY9A 3BZEB 3GS0A 1I9IH 4O3WA 4LIQH 5GGRB 4CRPA 5LDSA 3KBEA 5EBWA 4WWKB 2WTRA 5DVMA 3DX8A 1MAMH 4Z7NF 2UVEA 2Y3AA 3NZHH 4GAYA 4FLOA 4KR4A 1GW6A 3GK8H 4ZFGH 4XMTA 1JNHA 3V0FA 3FUIA 1K85A 2FR4A 4L37A 3CUPB 3B2MA 3V4VH 1T3FB 5JPNA 2HVBA 12E8H 2BDNH 3FUKA 3KGRA 1NGWB 5CFAA 3BUIA 4JRWA 4D3CH 1H3VA 2EVFA 5JXEA 4FESA 3MJ8A 3QUYC 4G75A 2XPGA 5KVFL 4JY6B 4J3XA 3QE5A 3WFCH 2WK2A 4DH2A 1JJUA 4HHAA 3B5HA 2D0FA 2FIRT 2JB5H 2PPDA 3SDAD 1H6UA 2WJ5A 5JHDE 5D6DA 3KVQA 4YSRA 1T89C 1Q9KA 2X4PA 4ATWA 4EN2A 3X13B 5J56B 3MLSL 5JO5A 4EOWL 4HWBL 4GRWF 4WW2B 3UPCA 1LE5A 4BZ1A 3GXDA 1E9QA 4Y2DB 5F0PB 3THML 5HVWA 3C5ZB 1GXEA 5GZND 2RGSA 3HZKA 3G6JF 3LH9A 4NKMB 4WV1A 5JQ6H 1RUQH 3H3PH 1O7SA 4XPTL 5GS2H 1QUPA 3X3FH 5IB5A 1R1CA 2WUBL 1WF5A 4R5XA 3QDGD 4MNGA 1TDQA 1HWHB 4R97B 4AYFB 1A5FH 3RDTC 2ZP9A 4NERA 2IG2L 1ZY9A 5HY9B 1JPTL 3BP7B 3VXNB 3WGUB 1NCAH 4ZQTA 5D4JA 1U8JB 7FABL 4NFDA 1H3TA 2R59A 2VLRE 1IQWL 4HJGB 4D7BA 2N56A 2XNAA 4OW6A 3SE8H 1TLKA 1U8NA 1J5HA 1XF2B 2R23B 2V3EA 2NQDA 3JBG7 4FYSA 2JCCB 2LE9A 3A6OA 4MB4A 3VO0A 4K9EL 4BFKA 2NX5A 4BK5C 4OLWH 5KSVB 4HBCL 5F7DA 4HS3A 2Y6SD 3P02A 2BOBA 4HJTA 1T04B 3T1FB 2PYEA 2H2PC 1JP5A 3VSTA 4PR7A 1RJLA 2P3YA 1D2OA 3L3OB 4UAOC 3CVHB 4FFZA 3P2BA 1H6TA 2AITA 4TUJB 1E2ZA 4Q9QH 4C4VB 1I7TA 3O4OC 5E2WL 1NFIA 2H47C 3PL6B 2ICEA 2GC4C 4JG9A 1INQB 4YVUA 2ZX5A 5CZVH 1TCMA 3E2HB 2NY6D 4OJYA 1OAUL 1MUJB 2DQGL 3O0LA 4YGAB 1BG9A 1CICD 4Z7UA 1T2QL 1GGCL 2EQDA 5EZOH 5FOBA 1I9RL 5B1JC 3G3LA 3ARVA 5C09A 3VGGA 1NBVH 4HV8A 1FWXA 1IFRA 1JVOA 4Y5VA 5K39A 3KPRE 4Z7IA 2QZ5A 3H53A 3HLAA 3VXUA 1NAKH 5KJ7E 3CV5A 1W0VB 1UG9A 1RZ7L 4JPKH 3EYSH 1XGUB 2LHFA 1YQVL 1BQHB 1LEGB 5I1IH 1JPSH 2DJUA 3S96B 4ZYKA 3D18A 3QISA 2CBPA 2ICES 3VDAA 4BK4A 1LMKA 2FD6H 2FSEA 5D1XE 3DIDA 4HC1H 1ET8A 1GY2A 3L3JA 4JANB 4AKQA 3QO1B 1N8ZA 1XVSA 1JZ7A 3DRQB 3VXUD 1C8QA 5GRYA 1B3IA 3P1VA 1HU8A 3OWRA 4WO4D 3SKMA 4RNRA 5L8KB 3I6GB 3UADA 3ETBF 2XG6A 2AJZB 5C92A 5BZWB 5I1JH 3BAJA 1C9SA 4E9QA 2AEOA 2NNFA 3EBHA 3HHSA 4ZPVB 5I66A 3K91A 1XXFC 4HEPA 2IXQA 4N5UA 4XP5L 2XWBA 3GI8H 1WT5A 3RWFB 1F8TL 3MV8B 3WENA 1W8EA 1DQLL 1CYWA 2B1HL 2ZKMX 5BJTA 4CU8A 2VXTH 4MMYA 5C0FB 5JHDD 6CGTA 5KVGH 1YY8A 1ID2A 1SFHA 3BE1L 4X0KA 4XNMA 2FL5B 2VMJA 3WNMA 5AB0A 3V4PH 3S34L 2VDKB 3OPZL 2QPEB 4ZUTA 1V55B 4QLRA 1NCNA 1KBWA 2E86A 4U1GC 1N7ML 3SPGA 5KVEH 3R4RA 4LLUA 1ZLSL 1HL5A 4XZ4A 5DJ2A 3QPKA 4LLQA 3FFCE 1FNSL 4ODSL 1OP5H 1HIMH 2NLJB 3T0SA 2R7EB 5FW7A 4AGNA 3VU2A 1A1OA 1X6NA 3UEQA 1PKQA 4LQ1A 3AMKA 5A2CA 4IBTA 2O4EA 4WHDA 4ONOA 1BD2A 2ZSWA 3VE2A 4N9OB 3RWIA 3NRPA 4FKKA 2VLRD 3SPIA 2VDMB 2IMNA 3RQ3A 2DM7A 3KBFA 2VZUA 3DA0A 1AO7B 2ENJA 4S1QL 4YDJA 1KFAL 1OZTG 3BT2L 2YPVH 3HI5H 2ZCKH 1FVEB 1VCAA 2VDNH 4KKPA 1L9TA 2CIKB 3BISA 3G9VA 1ERNA 1IC4H 4XHQA 5I1LA 3WHE0 1EDYA 3TV3H 2IWVA 1CE6A 1S9XB 2K4AA 4YIQB 4AXWB 1MCEA 5FA3B 3P4LA 3FUNA 2WBJB 4OIIH 4BZYA 5B8CC 3GO1H 5JUEH 2XBDA 3TEUA 4FA7B 3B34A 3IJ7A 3LIUA 1HQ4B 2QZQA 3JTBA 4PG2C 3W9EA 5T1MA 2FEDD 4JO5A 2CMRH 3STZB 4V1DB 3UJJH 2HG0A 1XF5B 2ARJQ 4P3WA 5KUKA 4ICXA 2DLFL 1HHIB 1B0WA 2B1AL 2OBGA 3K72B 3SO3C 4F7MA 1J8HA 2P1YA 4XP9H 1I7ZB 1ZJAA 4N5EC 4YO0A 5F3BA 4HJEA 4CBPA 1P5UC 4JKKA 3SOBL 3U7YH 5CD5C 2MTPA 2DLTA 3WN5C 1TQTA 4LEOB 3KPRD 3W38A 3OKNB 1ZSDB 1GFOA 1NKGA 5EZJB 2XICA 3IGFA 4QXUL 1D5MB 2HKFL 3H55A 1T0NB 2C34A 3ZVVA 4HKJA 3IJHB 1K4CB 4DP8X 4XNBA 5FKPA 3EGXA 1RAMA 1D3CA 4UM9B 3DRTB 3C5ZD 1LWRA 1H15B 4RJWA 1IC1A 1PCXA 4KTGA 5D1XD 3I6KA 15C8H 2YUXA 3PJNA 1DN0B 2PR4H 2XKNA 1NCBL 2EINB 2W9LA 3CFJB 4Y2LA 5A6LA 1OTTC 3GSOA 3NSYA 4KNUA 3MJ6A 4AGOA 3V6FA 4MA7L 1ZHXA 1OP5K 1Q8MA 2WC7A 1OP4A 5AKRA 2DD8H 1TMCB 4OKVA 1SOQA 4N8VB 3R1GH 2YSTA 3ECVA 4UOW0 1WEJH 4I8DA 4B6ZA 2P80A 4NO0B 2Y0HA 1F6AA 3MYZA 3OMNB 4TMPA 1W72B 3P0VL 3TIDB 1G7QB 3RWCB 3UTTA 1JZ3A 3UC2A 5ALBL 2A6JB 3SGEH 2YD7A 5EBGA 2HP4A 4ZUVB 2D3JA 1QPPA 1S3KH 5BNXD 3H42L 2R1XB 3KL3A 2DQJH 1M2VA 3I3BA 5I9QB 3LH2L 1Z5YD 2ZUTA 4LSUH 3FU5A 1SN5A 3TVMC 5FECA 1OAQH 4YHIA 3KPSA 3ELAT 5IVXE 1EDQA 1Z1WA 4PJ6A 2AK1L 1S7XA 1L9OA 1OTSC 1JPFB 3BGAA 3CSYA 1AGBB 4LOFA 3ZE1F 1AD9A 1WWWX 4R90H 3FFCD 3VI4A 3PL6D 1UB5A 4HXBL 3QT2A 5DJ8A 2WXHA 4V1DE 3FO2A 4X6DB 1MXGA 2OL3B 3HC3L 1Z0NA 4N2LA 5J3HC 3IDUA 1KCUH 1XR9A 1MG3C 1AXIB 1I4FA 2EC8A 4TSBH 2V5MA 5K9QI 4Q14A 4XC3L 5DL6A 2BRRL 1IAOB 2XV2A 5G4MA 3RWJB 4AOFA 1TNMA 3QJRB 2ATKB 4FLQA 3WIHH 4OGXL 4G9DB 4PS3A 1XCTB 3V0WL 3VQ1C 1OOAA 3U0WH 4FHJA 3G04B 5J57B 1FYTA 4YSQA 3RBHA 4M8QA 1DBAL 1M3JA 4JO4L 2R1WA 1KIUA 1MPAH 1IGIH 4JFTA 2H45A 1WS7A 1CI3M 3LEXA 4UCFA 3LNIA 5DSCB 3FW6A 3ML9A 5EO0B 1BMWA 1NUDA 1A9BB 2H26B 3FF8A 2BS9A 5D2NC 3HI6H 3LNFA 4ODHL 5D72H 5FVNA 1N2RB 3WN6A 5DJYB 1KBGH 1TZGH 2BIHA 4S1SL 1UWFA 1NMCC 1LL1A 4B95C 4EI5A 1E9PB 1RZJC 3DA4A 4OR1A 4MAYD 1FORL 1G84A 1BYPA 3PNWB 3QI9A 2LGNA 5FO7A 3VGHA 5C71A 1FO0H 5DCCA 1ODAA 3FONA 2QT6A 1PEZA 1XV8A 1IB5A 4JHAH 4FMKA 1HEZA 2C3WA 2UZXB 5TK4A 1WFIA 3BZFB 3D50A 3O0RL 4FEMA 5BVPL 2YPLB 3AS3A 4WHCA 1X4YA 4QTHB 4AQEA 4RLDA 2X2IA 3ZHFA 4BGLA 1AYOA 3P4MB 3V55A 2X3CA 3T0WA 3QEGH 4DK6A 2QV2A 1T4WA 2XA8H 3MUHL 1G7MB 2FCBA 5D96B 1LP9B 3QDMA 4JM0A 2TRHA 3IPBA 4M7JH 2GIYA 3B9AA 4Y19A 5AL8A 5DS8A 1DJGA 5E2VL 5HYIA 1DSFH 5I2IA 2HMIC 2QQKL 5EOQH 3S8GB 1AQKL 1BT9A 4DEUA 3M8OH 1S4IA 1I3RB 4BM7A 5F9AC 4NBXB 3ZR6A 4DKFL 3F00A 3MNMA 2ZAIA 4IBVA 5J13C 1ULVA 2FJFB 1SUHA 5DK0A 4ZMAT 3KR3H 3KZIO 2FQGA 3ZN6A 1AD0A 4X6DE 2X5PA 5J1AB 3E7JA 3F12B 1CS6A 3FQWB 3B9KA 1PD1A 5IBUB 4FL4B 3GHBL 2CGYA 4LVNC 3ASNB 4U0QB 5F9WB 1U8IB 2ZONA 1FAIL 2EXSA 3FOLB 1HQRB 1HC1A 4NRYA 3HUJB 1QOKA 2XN9B 4IRSA 4PGBB 1Q9WA 1USQA 3BPCB 5I5RA 1FFTB 3VB9A 3L1OH 1NPNA 3IMWA 2KBGA 1KPUB 3UPRB 3OKOA 3B9KD 3UJTH 4KJWD 3CLWA 2ZX6A 3NCYS 1DUZA 2P28B 2B7DT 1PZ5B 1XB6A 3MRMA 5CLTA 1U2HA 1TCRA 1I85C 5DQJB 2ZAGA 5EV7A 5T3XL 4F1ZA 1G6RB 3WDHA 2BCKA 1FGNL 3QFDA 3NN8A 3PWLA 4GT0A 3APFA 4PJEA 3PJLA 3LKRA 5I75C 4V1DD 3FXIC 2ZJSL 1KN4H 1O5PA 1SN0A 1ZKAA 4EZLA 2BHYA 3PF1A 2I9TA 4KK5C 5AEAA 1S7QA 3ARGC 3PRNA 5GQBA 3CC5B 3DURB 3AUVA 3V4UL 2A9NH 1NCHA 1J05A 2VCOA 2A99A 2YKKA 5IROA 1YN7A 4LOEA 3SDDA 5F7FA 1QPXA 4MGXA 2LABA 3MRDB 4FFVC 3HE7D 4M61B 3U9UA 1RUAH 7PRNA 3MBXH 1LP9E 4NZRH 1GC1L 4OSUL 2GBVA 4FQ1L 3SPJA 4LNVA 5HPMB 1ZRUA 4K3JL 2GBTA 3GJFK 5J6HB 5FO8B 1MCFA 3O3AB 3UZVB 2ILLA 3MYJA 4GNKB 1KG0B 1PZSA 3V6ZA 1I1AB 3U4KA 5CR8A 4R8WH 1CIUA 1QBLL 3L3IB 1L9SA 2BY2A 2G4GA 2ZTBA 3IK2A 3RA7L 3BOVA 3MX0A 5HXMA 2X7LA 1WC7A 3BUPA 5JW4R 1J7VR 5D93C 2F8OA 1M7IB 3TNMA 1CUOA 4XWOD 5F97E 3TA3A 3SKJH 2MOGA 4AX3A 2W65B 1C5CH 2DQUL 3RFRA 2F61A 2BMKA 3RX8A 4R96B 1OAXL 4NKOB 2NDGA 4YHOL 4NO0D 2VLME 1C08B 4PJBB 3FSAA 4JHZA 1MJ7H 3HUJE 2AEQH 1OSPH 2XN9E 2NYKA 3JVGC 4NWTH 3V0VB 1EO7A 2W5PA 2IDCA 1TYRA 1NCOA 2F19L 2UUDH 4A7VA 3F7RA 3EYVB 5C9KA 5JIDA 2R0KH 5E00B 1P1ZA 2ARWA 2AI0L 3REWB 1QZNA 4DZ8A 1QPKA 3QYCA 1C5BL 1J11A 4OJAA 5T3ZH 5K9JL 4ODTL 1QFWH 3ARBB 2YC1B 3FBQA 4HF5H 5D1ZA 1JDAA 1QLEL 4OZFB 4TVPL 3VXSE 3QULB 4DN4H 1P2CA 4PSPA 4Y7MA 3TTYA 3MUGA 3V52L 2Y2YA 2DWYA 2QGCA 4AT6B 4FSPA 5KS9A 3PV7A 5TE7H 3ZDYF 1OAZH 2WUCL 2DMHA 5DJZB 3IDXL 4POZC 4KTEH 2KHAA 1S7SA 3KLLA 4U1NA 3BP5B 5IFJA 5C0DB 1PMYA 1GW0A 3BPLB 3I9GH 3KYKL 2LFGA 4ELMF 1DFBL 3C08H 3DPDA 3ZTJH 4Z3JA 1E4JA 1OAYH 2CM5A 4QWWC 1YN6A 4QNPF 1MQ8A 4YXHH 3GINA 5D9SA 4IGBC 5AZUA 2XCMC 3D9AH 5IQLA 3MV7B 1PEWA 3WEBA 4B9FA 3RZCD 4BYHA 1P1VA 2V7HA 4NWUL 1SUJA 3JWDH 3H9YA 3WE6B 1HT6A 4FX5A 3VTTA 1EGJL 4ZNCD 1A6VL 3BP6B 4ZTPL 4PRDB 2BWQA 4J39A 5EEXA 1GYAA 3B3IA 2YKLL 4MD4A 5JZ7D 4E9WA 5T5NG 1ZLUH 3F7YB 3DIFA 35C8H 2PLTA 4HFUL 2EECA 4ZAKD 3EW3B 4FZMA 4UV4H 4EZKA 1AIFB 4NQXA 1KC5H 2Y2WA 4M5SA 1XF3A 3RIFF 2F74A 2WN2A 4M7KL 3QFGA 1DZ0A 3P9WB 4HJJH 1BEYH 4X5RA 4I18C 3WO4C 2YPKB 3EOYG 2R89A 3KLSA 2CBMA 5E6YA 3NG5A 1E27B 4PJBE 3LS5L 1N70A 1O7VA 1XCQB 1TMQA 3OJDA 4NXSA 5L6YH 5J0BA 1TQSA 4JO2H 4HWZB 1BBDH 3H4FA 3KYMA 5I6NA 1INEL 2VISA 1TO4A 3NPSB 3A4FA 5EEYA 5JPNC 3OKKA 3HAEA 2XRAL 1T1ZA 2C3GA 4ANWA 2WINA 5HI5C 1U8HA 1KCRL 3CPUA 4GMSH 4QJ4B 1SXNA 1VB9A 1AIZA 4UTAA 5E9DE 5JXEC 4M00A 4YWGL 3MRGA 3BGFC 4FRXA 2LHAA 3T2NL 3CFCL 3MBWA 3F3HA 4UDTA 4GXUM 5DYOA 3W0WE 2VAAA 1FQ9C 3CMOL 3QJFB 5D6DC 1HXUA 3VGAC 4JFEB 5I1HL 2VWEE 1NEZA 1S7RB 2Z3FA 5FM5M 5T1KA 5C0RH 3VFTB 4N0UB 2ADGA 1GZPB 2FRGP 3C5OA 2XZZA 2EEAA 4TNEA 1CXIA 4E41B 4OZHB 3BAYA 4ONFL 2D31A 3O41B 3MOAL 2VLMD 2ODHA 2R0WH 4LLDB 5AYTA 3KWWB 4P57B 4JZJB 4U6VH 4YHYB 2XN9D 1QNZL 3MV7E 4OM1H 4U6HA 1R3JB 3QHZL 4M7LL 2M07A 4GRMA 3MLUL 4PG9A 4C4BA 1FUNA 1JN6A 2ZXDA 3L4UA 4UQBA 2XE5A 4O3YA 1FRGL 1ZEAL 2GUOB 2ICWI 1TSHA 3L5XH 5F6IC 2OMZA 2VL5B 1DN2A 1XGZA 2XWTB 3CVHH 3GKWH 2C1OA 3U0TA 3NJTA 3BFQG 3IMUA 2V7NA 2R2HA 2GK0B 5JORA 1PLAA 3VA2C 1QR1B 4IEFB 4KI5E 1AYRA 1WCBA 1PKOA 2CO7B 3VXSD 2UYLA 1YEDA 2FATH 3EJYC 1PRNA 4NQUA 4G8IA 1ZLUK 1E67A 1NGPH 8PAZA 4WUUA 3FH5A 3EH4B 1RMFL 4FQJH 5ADOL 4XCCL 4GIPD 4Y7OC 3H4HA 1R9FA 2Q76A 4YXLH 5SX4H 2IGFL 4RCAA 5B8CB 4AENA 3DO7B 4LL1A 4CSZA 6PCYA 2ICEC 2EYSB 1EZSA 5KANG 4DVRL 2JVUA 5F7MC 1HXTA 2XBZA 3WJMA 5L88H 1OT2A 2VO8A 5E95B 5CSBA 4JPIA 3B2VL 4GMTH 4K7PX 1L9QA 1SOKA 1A3RH 4YE4H 4Z0BL 3X3GL 1EVTC 2F7PA 1JRHH 4WK4B 5FWQA 5IUCA 5DZ9A 1A4BA 2PCPB 4GP4B 1KCWA 4PJ7F 2PWDA 3GTVA 4Y5VC 1I1AD 5I1AB 1HINH 1TQBB 1J88A 1MAKA 2E4FA 5D7LB 1HH9A 1JAEA 1MCLA 3B2UC 3QZWB 5HHXH 2VRAA 1BZ7A 3HTLX 1NPUA 4XPHH 2YAEA 4FAAB 2BO0A 4RRPA 4RSVA 4JFEE 3PHOA 1DL7L 2FLMA 3ARXA 2NXZB 4JDTL 3VXPB 3SDYL 1JV5B 5JOPD 3SY0B 3AG2B 3BVWA 4N0UE 1XQ4A 2C4FT 3C12A 1MFEL 4E41E 2EIEA 4OZHE 4LPVA 1PY0A 2BNQB 2XTQA 3CX5K 3T09A 4S0HA 3MNZA 2B77A 3MRIB 4PRBA 4QXTA 1T80A 3DHPA 3N42F 4X5QA 5EOCH 3BN9C 2VLLA 3N9GL 3PGCB 2EE6A 4JW3A 4P23A 3KS0J 1MCOL 1TTFA 3OSVA 3PS6A 3D2TA 2FGQX 3EJCA 3BYTA 1R3HA 5IFHH 4K3EH 5FF6B 4ZMYA 2HJLA 1U8QB 1ADQA 3HAEG 4ZXBA 1I3UA 3SDCB 2GI0A 5KYXB 2BVQA 2CJSA 4L3CB 5E9DD 2VDKH 4BUQA 3BH4A 4R0LB 3K81A 3LXAA 5I76B 1WT5C 1PZAA 3DJTA 3KLAB 1YYMH 4Z7NB 2R4LA 1UT1A 2B2XL 3GSQA 2DZEA 3GZPA 4HDIB 4OCYH 5TH2B 3W0WD 2OK0L 1QA9B 4O02H 3LJ3A 3U6RA 2JI2A 5EWIH 1A8JH 1DBBH 1F2XK 1RI8A 4TNVF 3HG4A 4WEMB 1DQJA 4O4UA 4XBEH 4CVXA 1NEZG 5F1NB 1D5ZA 2ZKXA 4KO7A 3W57A 2X1QA 4WWNA 3IFOA 1KB9J 1CQYA 3GWJA 2XQ0A 3QG6B 1JHLL 3MR9B 1CK0H 4AK2A 4ANUA 5I15H 1HWGB 3MV7D 3T77A 4XBGA 3QUGA 4XMZA 1PG7H 4N0YH 4D0DA 1E40A 4GRWB 4JO3H 3TPUB 3ARFC 4XAKE 1MWAH 1MNUL 2IQ9H 1AKJB 2FH8A 3G6JB 4IOIB 4P9HC 1SDDA 5LCVA 3X2QB 1A02N 2C7UA 2NUPA 3RWDB 1OP3H 4K07A 5BZXA 2EICA 3IDJB 4I1RA 5D7LE 1OCCB 2RAMA 4KI5D 5E1AA 5DUML 3TO4C 3FN3A 2XG5B 4JQIL 1AGDB 4PJIA 3TBYB 3A0HO 4PGZA 2R4PA 4JJOA 3LNHA 5D7SH 2GCYA 2EH8H 1LTXA 2IAMA 2MPAH 3TNNB 4CKVX 3QNZA 1HYSD 5AYQA 3Q8CA 4PTUA 1P4BL 1VGEH 1EAQA 1CLOH 5D8JH 3VM7A 2G2NA 1QYGL 5A7BA 3EHBD 3IXTA 3NFSL 4JS7A 3MKKA 5FOJA 3WY1A 4HGMA 2BNQE 3AA0A 1IM9B 4AYSA 5K9OB 4J3OD 5ESVA 4KZEL 4ONHB 1XH3B 2APSA 5CZXD 3HKFA 1T4KB 1PG7X 5K5YA 2CLVA 2OJZH 3KPQB 5MEPB 2IH8A 3NFNA 2N0MA 4BFEA 2O5YH 2ZSVA 3MQIA 4IU3B 4NHUB 3AB0C 4WI0A 4ZFOA 1F0LA 5C97A 5ICXA 5IMOB 5JIMA 5JW4N 5LAXA 3VM5A 3ZRFC 4KX9A 5BRZB 4Z77B 4Q6KA 1H9DA 1MJJA 3DTUB 1INDH 5JR1L 1S46A 4LXFA 1DVSA 3W2DH 3QZOA 2X4QB 2BCMA 2VM9A 4NPYA 5AOJA 1IGTB 2XHNA 4AVIA 1UD6A 3PAZA 4CADB 1O5DT 2YR3A 2FQEA 1T1WB 1MH5B 3AU1B 2EH7H 4JFED 2VIRB 1QWUA 3BD4A 2A6DB 4R26L 4RRPG 3WY3A 1XGRA 3MZGB 5IB2B 3ULUF 3ISYA 1U8PA 1H3PL 3NCFB 5JPMA 3WS6A 1URLA 1YA5A 3DMMA 2ZCLH 3IETA 4E41D 4Z7WF 3H8NA 4R4BB 5GGTH 2J56A 3ZSSA 1MM5A 4AM0B 2I9LA 4OB5H 4F15C 3KYOB 4N28A 3M7FB 2BY3A 4QHNA 1V7NL 1W72H 2AZAA 5E2JA 3DGCR 4GRWE 3L5WB 5CSGA 5E7BA 3TEWA 6TAAA 2YGQA 1KYFA 3TO2A 3O6KL 3QJVB 3G6JE 1E7VA 5LBSL 4C69X 1MHCA 4UUJA 4OQ1A 3VI3F 2YFOA 2IOMA 1FPTH 4GKNB 1ASPA 4QRRB 3VTAA 5IQMA 4XMUA 1A14H 2C26A 2G30A 32C2A 4U49A 4BQ8A 1TQCC 3QJOA 3BEWA 3DHMA 2UZIL 3NP4A 4QTIH 2FBJL 4KJPC 1CF8L 3F04A 4WWOA 4BWUA 3P4OB 1D9KB 5IK3A 1EA9C 4UT7L 4Z0XA 1O7DC 2O6CA 3ARPA 1G1KA 3WD5H 1H5BA 2GT9A 5ABAA 5J6GB 4Y2OA 4JAMA 4ZW3A 4RBPH 4YK4B 4DOHB 3GSRA 3BVTA 2YEQA 3NOIA 3QUKB 3SKNA 4OF3A 2B08A 2YOAA 2D7TH 4KDTC 3M1BA 5EIIB 3VD9A 1IKFH 1OSZA 1TVDA 3FRPB 3MV9A 1TTBA 3WDIA 3ES6A 2DQDL 4Z9KB 5C9JA 4HOXA 1L3NA 4JZNA 1KEGL 4JN2B 2ZYSA 4X9BA 4XAKD 3O2DL 2C9AA 3II2A 3VFNA 2ED8A 2J6EL 5BRZE 2ZOTA 3VXOA 2Q1EA 5FIEA 2CHDA 2R56H 3QWNA 4Q4EA 3LZPA 5KSBA 3EYFB 3KE0A 3WJJA 2PW1A 1WZ1H 3U82B 4X5WB 4ELKB 1HOCA 3WFBH 1I1CA 1IAIL 3HN8A 4R2GC 4MJIB 4PRHA 1NTDA 3K6IA 3SEPA 5A3ID 3MV9D 5L2KB 4LCYA 4DAGL 1ZA6A 2XLLA 2FECL 2AV7B 4OLVH 2DQHH 3HMXH 5E51A 3E8UH 4N9GA 1FL3B 3U79A 2ZNWA 3RBGA 4AIZB 4ZS6C 1F4YH 2NXZD 1CD1B 4NC1C 3UERA 1QFUH 4DCQB 2QFRA 2Y6TE 3PHQB 2VXQL 3ULVC 1J1OL 3PXJA 5JHMA 1VPOH 5A6IA 1PYWB 4LU5H 5INDA 3VU1A 2WMPB 4GEJA 2BNQD 3APNA 2Z35A 5IQ7H 2RBLA 1YUHB 3M17A 3B43A 4F57H 4EI5C 4RFEB 5H2FO 3TH2T 4DGVL 3IDGA 3QI9C 4LSRH 2IIJA 3WUZA 3Q43A 2CO4A 2EYTA 4ZK8A 1SYSB 4G42A 4ALAL 5DWUH 1U3YA 2E9WA 4U3CA 2MJWA 1WBZA 2OMXB 2ZICA 3L17A 3G7GA 3SDCD 5CINH 4EDXA 1BFTA 2ZYRA 3MBEC 4QRRE 4U1HA 3VW3L 2Z0UA 3QXWA 4UBDD 4D0CA 3CAFA 3KCPA 1ZA3A 4MNHA 5TQ2L 3PPSA 2JWYA 4PWFA 5DMIH 5EU5B 1OSMA 5JIHA 4GBXA 1Q9LA 2Y24A 1ZIBA 3BKYL 1UCTA 3C6LB 1NDMB 3DI2B 4I3SH 5IVZB 2X4UA 1YS5A 5AAWC 2LLNA 4YMPA 5C7XL 2E6PA 2VLKB 2D3NA 3K4DA 5DRNA 5MENA 4OIFA 5DQ9A 3L9BA 3NDZE 5HYSB 4DOHE 4Y5XA 1MVUB 4C54A 4OGYL 3V9FA 3IU3A 5ID1A 1CFVH 3RPKA 2BJMH 5IB4A 5DRWA 4K23H 1QFPA 3NIFF 4JJ5B 1L7IL 4O51A 1PZ2A 1CD8A 2PCXA 4WI8A 4Y0GA 3BDYL 5IFAH 1BAWA 1TU2B 5DMKA 1OCZB 1AKJD 2CU9A 2QSCL 5GS1B 4NNXA 1SEQH 1OWWA 4H2AA 4TQ8A 3EJZD 3UAAA 4ZMVA 2XVKA 3ESNA 2GSMB 1GMEA 4U7MA 3PU7A 5D71L 4MJIE 1CYXA 2P5WB 4IRSC 4G80A 5L2KE 3WEXA 5EEWA 5CO1A 2ZXCA 2ZG2A 3FZUD 2G0LA 3QQ3B 2CGZA 1YNLH 2B1OA 3RGBA 5HDBF 2X1XR 2XG4A 4D9LH 2FAUA 4U6TA 1TPXC 1WFJA 1XDTT 2K9UA 5BVJB 1MIEH 1KIQA 3B8SA 1IBBA 4HK3J 1ML0A 4PQXA 5I6OA 1LDPL 4JVWA 3SBWA 1LWJA 5L0QC 1IM9D 1AR1B 4U1KB 1RHHA 1OHQA 3F6IA 3ZT7A 3PFQA 2FB4H 1ZVHA 4NN6C 5TE4H 4JFHE 3G6DH 4PJFF 3ARYA 4MBOA 4YSUA 1DQQB 4M1CC 1ZGLP 4IK7A 4IMLA 1AXSA 4TLSA 3U6XA 5B66O 1ZV2A 1UD4A 2XY2A 3EUDA 3ZYZA 3IS1X 1E8YA 3GLZA 2N3JA 5BRZD 1JK9A 3VSUA 1S8DB 2WQAA 4MCNA 1FSKB 2H32A 5C0CE 5IROC 4A2MA 4QF1A 2JKRM 2QGBA 3DO3A 2H1PL 3UROR 2XXFA 2BVUA 2WXPA 2J2ZB 5FYKL 1NC2A 4BK8A 2HTLC 2Y7SA 2AEWA 5IJKA 2VLKE 1N5AB 4JCHA 1TETH 4GAAA 4KROD 5GHWH 3S88L 3FU0A 3D30A 3ZTDC 3DHJA 5F0MB 2HG5B 1Y1DA 3T04D 3TT1H 4TUKH 1JWMA 3L81A 3U6XS 5L8LB 1W9XA 1CD9B 1GKEA 3TM6A 5I6LA 2NXYB 4UTCA 4AE1A 1WHPA 2FT7A 5F89B 5CKAA 1A7RH 2GIXA 5ANHA 3RWEA 3LKOB 1T1XA 1GOHA 4FQIH 4GO6B 3TA3C 3NJMA 1Q94B 3POHA 3FH8A 4ZFQA 3CFKB 2NNCA 3HS0B 1KTDB 5DVKA 1O9VA 1NIBA 4QRRD 1VF5C 2I07A 1FBIH 5D55A 2G9KA 1NGZB 1J5CA 5F6HJ 2ZPKL 2HFGH 1JZJA 4GH7B 4CKQA 5AWNH 4QHUB 9CGTA 3GB7A 2BY0A 3O3EB 2VNCA 1GAFH 4JGJA 4QOKB 5DUBA 1LEIB 2WBKA 1JNLH 3CD4A 1U8KB 4D2NA 2K4WA 3VFUA 2P5PA 4HIHA 2G5BA 3FQRA 4NM4L 1T21B 3GMRA 1ADQH 1DDHA 3Q8BA 1RERA 2Y7MA 5J1TC 2X87A 5KVFE 2IPUG 1FJ1B 1WWBX 3K80A 3QO0A 4P2OC 5D1ZC 3UBHA 3NH7L 1JZIA 3EFFA 4LHUA 4PVMA 5AKTA 3DKHA 3K6SA 4JRXB 4NN5B 1OB0A 4D9QE 1A0QL 3SDXB 1RZGB 2V9UA 1ZT7A 3P30H 4G7QB 4U3XA 3U4EA 5DHVA 3W39A 1KPRB 4PJ5A 1F1DA 3U7WH 5FUOL 4C4UA 4B9YA 2JELH 3L95A 3GEWB 3TBBA 2Z8RA 1GTNA 1EVUA 5HGAB 4RGMB 1HWWA 1YEJH 5DJAA 4ZSOA 1FG2A 1TJIH 1OM3H 2B4CH 3DBXA 5HDWA 3BKJL 4A6YL 5AENA 4MJID 5K9QG 3Q06A 5L2KD 3MA9L 1E4XI 3K6NA 1ILUA 4FI8A 2B59A 2BSTA 3IFPB 3HE6B 4UTBA 1JWUB 5BZDA 3KL5A 5E5MB 4W4OA 1U92B 2J4WL 4XXDB 4IKKA 3QUML 4B9GA 4BCZA 5AUMA 2CCWA 2ORBL 3QG7H 1KJMA 1S7WB 5LCVH 3DSNA 3LD8B 2OMWA 4EIBA 2DYRB 5E99L 5CNHA 1OGTB 1T20A 1NH6A 4X9GA 5EA0H 2WOBA 1ETJA 4J3OH 1GGUA 2IFGA 4XX1G 1ID5I 2E5EA 4OAWA 3WKML 1QKZL 2O26U 2RFXA 3FK3A 2OR8A 3NT0A 4JFHD 2KUTA 2WLLA 5A16A 5DVPA 1J12A 2VLJA 4AQ1A 1UD5A 1PS3A 5JHLL 3C5SB 3RAJH 4PRPE 2APBA 2XBTA 5T5FL 3VFRA 5C0CD 5JOEA 3TOPA 3VE1A 5F7HA 1TITA 1CVRA 1DVXA 3QNFA 2K6YA 4I9WE 4M1GH 4XVTL 4OCMC 1MREL 3PP4L 3SGJA 1FDLL 4QOKE 5KSAB 2HVJA 5E6SB 3QORB 4FLRA 3C6LD 3MROB 1LO3L 1Y18B 3WIFB 1J18A 3BT0A 1HHGB 2VLKD 2E7DA 3GD1C 5E1IA 2EZ0C 1BQKA 2BVEA 1G1OA 3FN9A 2QADC 5AOMA 5AZEL 2JMMA 2A4ZA 1KXQA 5DUPH 2X9ZA 3DX2A 4ORZC 3T1WA 4HGKC 5FO9A 5JOFB 3K5RA 3ORJA 4HKXA 1URZA 3PABB 5D4IA 4JRXE 3ZZ1A 3KWTA 4CC4A 2CAKA 1XHHA 4LLYA 2JJSA 3SDXE 1HSAB 1U4FA 1CZ8H 2K8QA 3D07A 2RTTA 1BM3H 3A6CH 4FZLA 3MODL 3F7KA 2GHZA 3QDJB 3VFSB 1UGKA 4PLKD 5EORH 3GMOA 4O3ZA 2CLZA 2A74B 3T0BA 1DBKH 2I7OA 5EB9A 1A1MA 2ZCZA 4LKCA 2BSDA 2CJTA 2W95A 2E76C 2C9VA 4H8WC 5DXWA 3QRCA 4RGNC 3UTQA 4XOEA 2M26A 4XP6L 1YJDC 3GBML 3RVWD 1KYAA 4AMKL 2GVYA 4MCZA 2DWDA 4FNQA 5EN2A 3VGEA 2NSMA 2FYYB 2PP9A 2CGRH 1QO3A 1VENA 5LQBL 1CFNA 4LL9A 5FLVA 2CXKA 4XVOA 1T6WA 1X4XA 2F53A 4U1JB 5ELIA 3W56A 2H9GA 2BY1A 5E1GA 5DZNA 3QPXL 1OARL 4JY4B 5KAIO 4I7ZC 1R24A 4RFOH 2R27A 4DQAA 4B41A 3P2DA 3K71A 3EFDH 3MGOB 1AR1D 5HDQL 4LHUG 3GMPA 5FW8A 3T2OA 4D9QD 2HTKD 5F1IA 2FX7L 3MLVL 3S36H 2B15A 1OL0A 5I6XC 1WO2A 3LKSB 4M6OH 4YC2C 3C8HA 3ZE0B 3KAAA 3X12B 2HFFA 4KNQA 4FZEH 4NFCA 3UABA 1JI2A 1NCDL 2F53D 1I8MA 5A6MA 2FO4B 3OAWA 3ZX1A 4XO4A 4XCFH 4YDLC 1U3HA 2HUHA 3HB3C 1WFOA 4JG1H 3ZDYB 2VMEA 4DSYA 4ATTA 1Q72L 3CDGA 3NTCL 4YDVA 1XCWA 2J25A 4P2YA 4I3GA 3T8MA 3NEXA 3VH8B 3EADA 4K0OA 4I9XA 1KBBA 4ELMB 2N7SA 1MCIA 3KDMB 4N20A 3RUGA 3U2SA 1KTBA 2I27N 3MLZL 2KZ7B 3HFML 5IJVB 4R4ND 4X4XB 1JXKA 3F85A 1FCGA 3MLRH 4PUBL 4QO1A 3V7AE 1XBDA 1LO5B 1OCWL 4PS4H 1AZRA 3RPIA 3S36X 3QUXD 1ZV5A 1RPUA 5JNYA 1WGOA 3QCTL 4LSDA 4R4FH 3ZBMA 4N2KA 3VG0H 3GMNB 3QDJE 3NIDF 3SD5A 5ICYA 4C56A 5IG7B 1F13A 2R4RH 3BRFA 1BPVA 1RL1A 4PRPD 4LPUA 4LNRB 1IAMA 4DNLA 4K8RC 1X5KA 4X5PA 4NQQA 4IIZA 2X70B 4X6CF 1JK8A 4G43A 4TM9A 4L0YA 4I9WD 5L2JB 4N68A 1RXLA 1QSFA 2CIIA 4HYTB 4QOKD 3T0DA 1CFQA 1CL7I 2I69A 3MU3A 2WIIB 3A6BL 4NAMA 1ZS2A 5E4EB 1NAMA 1HSBB 1K5NB 2FO1A 4IKIA 3UO1H 4UT9L 4ZXBC 3QCUH 5DC0A 1YNTA 4PP1D 4LLWA 2UWEA 5G2NA 3LK41 1UH3A 2ICWA 5H4YA 3GM0A 4KTYA 4J3SA 2AJVH 4JRXD 4PD4J 3ABZA 3ALPA 2DI9A 4NT6A 2OCCB 4ANKA 3FTZA 4GS7B 5DZAA 4WZ9A 3ZE0E 4GRWH 4BELD 4EI6A 2VUOA 3L3DA 5E8NA 5GGUA 3HC0A 2YAFA 3WHXB 3TFBA 5K1NA 1NWPA 2HA1A 1ZS8B 4ABWA 4JFYA 1JGIA 2FBOJ 5GGRA 3RP1A 1I9IL 3QQDA 4JDVB 4KKQA 1EO8H 1G4MA 4LIQL 2O93L 3BD3A 5IY5B 3P3RA 5MHSE 2GJ6E 2RQ8A 4MD5B 3ZDZB 5CGYC 1X3DA 1UVQB 3NZHL 3U9PH 4LSIA 2NY3C 4LGPB 3GK8L 1T3FA 4HIJB 3M1OA 4PLJD 4XXCA 4OVVA 3IXAA 1UATA 3HE6D 1FV1A 1FIGH 3GUTB 3WSQL 3FTGA 4EXPX 3C8KB 2H5UA 4ELME 5FB8A 1IT9L 1YLBB 2A6KA 2QTEA 3O2VL 4JY6A 4FOZA 4DPAX 4GG6A 4RIRB 2DEXX 4QNPE 5IT2L 2AQRA 5IBTL 3OLDA 4BWTA 2VSCA 4G6AD 1XTMA 3RVTC 5CN3A 1ND0B 1DUYB 1E6OL 1S7UA 2JKTM 3MXWL 3AT0A 4RMTA 1A6AA 2XTJC 3QNYA 4HIIB 2ZZUT 1R5IB 1WICA 1B2WH 3G5VA 4Y2DA 1ZLVK 5AW1B 4NKMA 2OA9A 1JUFB 2DN7A 2OI9C 1AANA 4NO2B 4OZIB 2NY5H 2HX8A 3BWAA 3SGDI 1EJFA 1Y07A 2ISDA 4LEBA 2L7UA 1KN2H 2GAZA 5HY9A 1MFDH 4LLAA 3RVVD 2MQ3A 2J4UP 3OZ9H 1P9MA 5ALCL 5KSAD 5CEXA 5IUSA 3RX9A 4A7GF 1HKLH 4NOBA 4U05A 1MCJA 5GSVB 4H4NA 4TN9A 3S3PA 2R23A 2JCCA 1XH0A 3WHE1 2IH3B 3KXFA 2Q8AH 2CDGB 3L4TA 3BVVA 3EDFA 1YC7A 5GGSY 3S5LB 3T2PA 5KSVA 1UWEH 4F37F 3EOTH 1RFDH 4YAQA 3B3BA 5E8OA 5HJ3A 4JFFB 1T04A 5TE6L 5CWSB 3CN1A 2DKUA 3NCJH 4YN3A 2ZKWA 2R8AA 3FOMB 4GRLD 4P3CH 1T6BX 1WAEA 4FSOA 3EF7A 4G7YH 1KLFA 1SJEA 2FT8A 2FQDA 5FCUL 4BCYA 4EUPB 1KLUA 5IM7A 3BW9A 4JM4H 3QDJD 3QH3B 1ETA1 3C2AL 5JPMC 2K3TA 3Q13A 4QIRA 5L9DL 3DMMC 3R0NA 2MHLA 4HUVB 5BRQA 4Y4FA 4LP5A 2BW5A 3SCMA 3V9CA 4BSJA 4ZPTA 2KC0A 5CZVL 4ZO8A 3ZDZE 3BGMB 2IOIA 4LKXB 4G6JL 1R5VB 3L9EA 3V5KB 3S37H 5F7WC 3WG7B 3AREA 1HXMB 1L0XA 3RJDA 1ZHBB 2NYYC 1CR9H 1NBVL 4H8HA 5KSUA 1RQ5A 4UQ2B 4IOSD 2ZKHH 2OXHA 1BIIA 3N42B 2ADIB 4FQEA 2XTLA 4Y9EA 5AYUH 4KZDH 3AA6A 3JWOH 4YQXH 3N40F 1OGAB 4KHTL 1AQHA 1U2YA 2HH0L 4LCVA 4QYAA 4QYOB 3GP6A 1JG9A 1LEGA 2X2YA 3S7GA 2VRKA 3WAJA 1USZA 4M7ZC 1VEOA 1SF5A 5I1IL 5EZLA 4QT5A 3ZRSA 1RUPL 2VGLM 2YMXL 2FD6L 4OZIE 3AQYA 1ORQA 5BV7B 1H3UA 5F9OL 1T22A 1NC4B 4R3SB 3PJSA 4RZCA 2WBWB 3O3DA 5DZJA 5BRPA 2K0LA 5MHSD 1RZJL 1O6TA 2GJ6D 1XAKA 3VRJB 1TZIA 2VXVL 4XNZC 4G6MH 5IBLC 5GRJH 3K46A 4L8CA 3QYNA 2HZHA 5I0WA 3D3VB 2C9PA 2A7BA 3MV8A 3ECUA 3EOBB 3WJJC 4WCYH 2W81C 5BS0B 4RESB 5LGKA 4JFFE 1XZ0A 4KKAC 1RU9H 5JYLA 4LPTA 1YDPA 2N01B 3KHOA 4X50A 5BQ7B 5BMFL 3VX0A 4BFBD 3RILA 4X4YA 4YHPA 2F54B 4Z76B 5HYQA 3KJ4C 1JYVA 4JDZB 2Y5EA 1ORSB 3B6SA 1QJ8A 3QXDA 3GUFA 1LMIA 3UBGA 1G9MC 4B7IA 3I02B 5T3XE 5I19H 2R7EA 3M6DA 2XIIA 2CHNA 4WKZB 3RNKB 1HIML 2ALAA 2IFFL 1QSEB 2WQWA 3OB0H 3OSKA 4UNVA 1WAAA 4BZ2A 2P8MA 4HUXA 4OGZA 2XJLA 2PWHA 5JDJA 5DD6A 3ROLA 5H35A 3SODB 5AVSB 3EO0B 1AO7A 1K8DB 1QQDB 3IJEA 4XPFH 2VXSL 4XPGL 5DWPA 4A2GA 2JXMB 5IHZA 2YNKA 1UJ3A 2ENPA 4PB0L 2YPVL 5IJBC 4FXTA 1EHNA 1LE9B 1VACB 2VDNL 3IB4A 3QCVL 5EOTA 1OGAE 2OX5A 3FCGA 5DHYB 4MDJA 1XGQB 2CUAA 2NNAA 3WO3B 1N10A 3NRFA 4GBXC 1S9XA 2BP8A 4RL9A 1VFAA 4WF7A 3N1QC 4YIQA 5SV4A 4AXWA 4MA3A 3RKPA 2ERVA 4FDWA 1UXSA 1OE3A 2WBJA 4D8OA 4JFXB 3CZKA 3TT3L 4X2UA 1Z0MA 4A2HA 4JFWA 1JZ6A 2MH4A 4Y5XC 2J73A 2X2UA 3DOSA 1E9OB 2SODB 4U6YB 3QRGL 3STZA 2KMWA 3D08A 4M4PA 4MJ2A 1R3IL 1HHIA 1I3GL 3K72A 4PYHA 1B4LA 1I7ZA 1QBBA 3AM8C 5DR5L 1EERB 1E5YA 3BMVA 3EYQD 3PGSA 3O9WB 1ZVSB 3D3VE 1IZNB 4Z7WB 3STLB 3U7YL 4CN6A 2X3BA 3MJ7B 3R8QA 3OKNA 1W8NA 2ZUQC 5HHNA 5EZJA 2JJWA 2VKXA 4BKLA 2E74C 3GIVB 5KVFH 3I9IA 1O9ZA 1AOZA 5HHPB 1XCXA 2Z7YA 3CN2A 3GXMA 4HQQL 1XBRA 2EVGA 4OFYD 1BQHG 3BLPX 3MRBB 2F54E 1PVHA 2EDKA 3VI3B 1H15A 3B5TA 1QATA 3MLSH 4NOFA 3HLKA 4QRPB 4EOWH 4RWYL 5HD8D 3HI1A 1HXYA 4GXVL 3MUJA 3GS4A 2HB0A 15C8L 3THMH 1Z9PA 4TL5A 3VZWX 1DN0A 3FQ2A 4XPTH 2PR4L 3A24A 3CFJA 3FU6A 4JFPA 3VFPB 4TVPE 1QSEE 1PCSA 2WUBH 3C9NA 5G3AA 2HLFC 2EDNA 4NNPL 4AJWA 1CXFA 2IG2H 5C07B 4ELDA 5IHLB 4YNYA 1B0RB 2LOEA 1AVAA 1HILA 7FABH 2W60B 1RULL 1WWAX 2Y7NA 3REVB 5B5EO 3RY4A 2MKWA 4MJ5B 4WHTA 2Q8BH 5GZOA 1IQWH 3FO1A 4PJDA 4L8BB 2DMGA 3KPPA 2WQXA 2OYKA 1G7QA 1XGYH 4NQVA 2J88L 3T20A 4K9EH 2FJGA 4JFFD 4QJ5B 1M6OA 2FWUA 4HBCH 4M93C 5ADXK 4B7LA 3D1MC 1EQWA 3LZNA 3TIEA 4XH2A 2VDPL 1FNHA 1VSCA 5IJKC 4KK9D 1KELH 4GKSB 5BCAA 3VY9X 2NW2B 3MRLB 2VKWA 3BAEL 1QRNA 1A22B 3F64A 1KCVL 4CU6A 5T3XD 3DVGA 2CR0A 2YRZA 4Z1PA 1BVZA 1UH4A 1GFMA 1D5RA 5ESAA 1ZHKB 4GAJL 2OL3A 4IRZA 5FCSH 4PCKA 2HLAB 3DXAB 3PWNA 3O6LL 5IMLB 3GHEL 1OAUH 4TSBL 2IANB 1FZMA 2DQGH 4AE0A 4OD2B 1UURA 3DVIA 4MXQD 1AHKA 1CLCA 1GGCH 1T2QH 3M46A 3P9LB 1I9RH 3BAWA 1SRDA 1VADA 1XCTA 3OQ3B 4G9DA 3CDZB 4GI8A 4P48A 3G04A 3RTQC 3P54A 3GMQB 4LF3B 1YAIA 3C60B 4LOUD 5DZLA 1OGAD 4N90E 3TBTB 4OLUL 1IGIL 1A7NL 4JPSA 5EO0A 1FFNA 4X7DC 1RZ7H 2WTOA 1UT9A 1SFDA 1SVBA 4F8QA 1E5AA 1MAJA 4QRPE 5D72L 1BXXA 2DWSA 2ZP8A 3RVUC 5JW3L 1WPCA 2GBAA 4P46A 5F3HA 4GXUN 3WI5A 1P7QB 2E9IA 4JFOA 2WO4A 1FL6B 3BWUC 5MERB 5MP6L 2H3NB 3LSOA 1IEAA 2Z91B 4OF5A 4N2IA 1PD0A 5KG9B 2DIJA 2R88A 3T6ZA 5LVEA 1HZKA 3MUZ1 4AQZA 4XBPA 5C07E 3TN0A 3MCYA 4ZQKB 1KTCA 3ML8A 2D2CC 4I2XB 2UZXA 3D3VD 3AG1B 2O61B 2YPLA 2HFEB 4MHHI 5DRZB 3NSJA 4JM2A 3KH4A 3QQNA 4HCRA 3SGKA 5EF1A 1L9MA 4PRAA 1P69B 4XP5H 4WEEA 1F8TH 2XA8L 4Z3GA 4ORGA 1DQLH 4MFHA 5F7AA 1CGUA 2B1HH 5I5IA 4PJHB 4FABL 5J06A 2ZUVA 5CU9A 2HJKA 2F54D 5EOQL 1I3RA 2AJ3B 3BVNB 1A6TB 2DM2A 3AMLA 2A2QT 2XPZA 3EYOB 4W9LC 1IKOP 3S34H 3OPZH 3BO8B 2J8UF 5IB1A 5H2BA 4IW4C 8FABB 1N7MH 5BXFA 1ZLSH 4TVPD 1QSED 3APMA 1MFUA 4QHLB 2L7EA 3C6EA 5J1AA 1FNSH 4ODSH 3ZT5A 5EO9A 4PJXE 4B3VA 4I0PB 4PI0A 3DXAE 5HDBB 4UNUA 1QLRB 2XACC 3NMEA 3D8MA 2KLTA 4FQXB 2IANE 7TAAA 4N8VG 2XN0A 1BFVH 2IV8A 4MAUL 4AQ1C 4RMWA 2ZOWA 3ZKNC 4BZ1L 5HHQB 2AK4B 2Y22A 2FIKB 3JV5A 3OV6A 3B9EA 4LSFA 5FGCB 4S1QH 3BPCA 3DVNB 3LPPA 1KFAH 2X10A 1II4E 3BT2H 1JXFA 4PJFB 3OL2A 4ICWA 2O5XH 3ZLQC 3SGJC 3UPRA 4ZW6A 1N68A 3V79C 4OH2A 4XVSL 4MZRA 4KU1A 4Y5YA 1PZ5A 2DV6A 2JK5B 2WXLA 4U2ZA 4MCMA 1T66D 4K9JA 2OR7A 1L7TL 1LNUA 1Z66A 3MUUA 2Q87A 2PW2A 4B3EA 2V9TA 4KVCL 1WH0A 2ODIA 5E94B 1COBA 4MD0B 1WIOA 1CDBA 5DJ6A 3UDWA 5HVHB 3ABLB 1YNKH 4CC4C 4RA3A 2JJSC 3FT4A 2CM6A 1W8OA 4PAZA 2UZYB 3N50A 4H40A 5B39B 3EOAA 4I2XE 1OPGL 1MCBA 2DLFH 4IHBA 4NKDA 1UADC 2B1AH 4WTZA 5CBAB 4N75A 2WO3B 1M05B 1EXUB 4FFZL 4WRLA 5GISL 2A9NL 2P45B 3TJEL 2Y0KA 2OXGB 4M61A 1M7XA 4YBLB 4Y4KA 2NY6C 3HG2A 3S2CA 3CX2A 3SD2A 2Z92B 5F70A 1QHOA 4N90D 3MBXL 1CQKA 3KPLA 2HKFH 4PWJA 3ZXAC 3WBDA 4PJHE 2XYBA 1EZLA 2QVIA 5AW7B 5FO8A 1GGTA 3O3AA 4ILDA 4P49A 3WNLA 1Q1JH 3KNBA 4A2EA 2DKSA 3BH9A 5ACLA 4QRPD 4MA1B 4XCEB 2EUZA 3X14B 2HJFB 3Q6GH 2WW8A 4DKTA 1GVIA 3NCYP 3QBTB 3QXAA 1A4JB 2IDSA 1TEGA 2O4VA 4L9LB 5LJYH 1M7IA 4KK6D 4PS8A 5HDBE 2V37A 3K2UL 1PJ9A 5EG6C 5D4QA 5C07D 1D5BA 1F4HA 4MKMA 5BUPA 1IGYB 1OAJA 4MA7H 4AWJC 2XN2A 1SEBB 4ZUWA 5EC1B 1G7IA 1G6VK 3DX7A 2AK4E 2K78A 1SXZA 3DWNA 1I8KA 3BP4B 2WCSA 5D1QA 2QTKA 1MJ7L 3O6FB 5FGCE 2AEQL 3DDFA 1U3HC 1E90A 2XC8A 3QXVA 2MRYA 4NWTL 2W9DL 4A7QA 3EYVA 5FA4B 5IOKA 3D39B 3LQZA 5E00A 7PCYA 5ADPH 5ALBH 5E4OA 3KH3A 5EF0A 1EBPA 4KWUA 1OK8A 3H42H 1HHKB 1LQBC 4ENEC 2E8ZA 4I89A 1LEKA 1IM3A 2FWSA 4D9RE 3LH2H 1T6VN 3ARBA 3BAXA 2BXZA 5T3ZL 3T4YB 4G3YH 5ESQA 2JKXA 4Z3FA 4O2EA 4DN4L 2AK1H 4AT6A 1C16B 3L48A 5ECGA 4OBSA 3PWPB 1OAZL 1TT6A 4HXBH 4DP4X 5EUKB 3DXAD 1QBAA 1YY9C 5E6IB 3UBXI 4L1LA 1MNNA 1OAKL 3IFNL 5C0DA 2PKDA 5IBUG 2IAND 2YWZA 1JFQH 3LKQB 1AGCB 5C08B 1XX9C 3AAZB 4CVZB 1PNDA 3K6DA 2BRRH 2DQIL 5FHAL 2JQZA 1AACA 4DEPB 4OGXH 2IAAC 3V0WH 4U1LB 2IDFA 2IWKA 3GBEA 2V8MA 4P5KB 1DTUA 1TG8A 4JO4H 4WWPA 1BXVA 1UQSA 3FQTB 3JWDL 4XO9A 1MI5A 4F7CB 5IF0B 4PRDA 3FYIB 3GXPA 1WFMA 5CP3H 3QZNA 3F7YA 4ODHH 5SWSB 1P7QD 4ODWB 2AV1A 3JVFC 1TTGA 2LAGB 1WBXA 3W3BA 4S1SH 3L13A 2Q6WB 4MDIB 3NEOA 1DVQA 1WZKA 2VQTA 4O2CA 3PGDB 5C70A 3TFKD 3FTSA 2H0EA 3RX7A 2Z8VC 2Y72A 3MV11 5FUCE 2HT4C 1QI3A 2GB2A 2LLLA 2XE1A 2OS7A 5EU4A 4AKMA 3J27A 2LLGA 1DJXA 5HHMB 1FZJA 3WXVL 2YEVB 3H54A 4WJKB 1IILE 2Z31A 3DV6A 1OPOA 3J7HA 3JTSA 4WWKC 5FFOA 2MKLC 2QR0B 2XVGA 1VESA 3BJ91 1T5XB 3O0RH 4M62L 5TGBA 5BVPH 1EK3A 4M4RA 3QUZB 4R9HA 5K1VA 4JO2L 4PP2A 4MLIA 1BBDL 3D39E 2FLBT 2NY4B 2P5EB 4CGTA 4GMSL 3PCYA 2QQKH 5AVRB 1DLHA 2NR6D 4FQCH 4CNIB 4PB9L 3MRKB 4RX4D 1AQKH 3UTZB 2QEJA 3OR6A 25C8H 3HZMA 3ZGIA 2R4NA 2YOCA 3BIKA 1NFDF 4XCNB 3RGVB 1YG9A 2D4FA 3N04A 3PWPE 5CXPA 5EU6B 5JDSB 1WVZA 2FJHA 4I0PD 3R0MA 4WW2C 1I8UA 4PJGB 1GZPA 3BQUA 3D2UB 2D03L 1Z5LA 4K7PY 4N87A 1VFUA 3MVSA 2HKAA 4Y2DC 4FQXD 4CN1A 2Q7AA 3RIFK 3N44F 3ILQD 5C08E 2BVOB 1OANA 3SYPA 3QQ9C 3HS9A 2AK4D 2AKRB 4P57A 3FQUB 3OZLA 3P4NB 3FQXB 1DE4A 5G39A 4TULL 1FAIH 1R3JA 4P4KB 3SQOH 4FNSA 2FVNA 3U0PB 4KQ0A 3VD7A 3GBLA 5AW4B 3VCLA 5FR3A 1X5ZA 4QMEA 4UQDA 2LQRA 1VA9A 1P9MC 5FV1L 3IGKA 1IGML 1FNGB 4K7PL 2GUOA 3KLQA 1XGPB 2NY1C 5DJ0A 4OZ4A 2WVVA 2VL5A 1KEML 4BFNA 5I1KL 1UOVA 1ZLDA 1JERA 4L5FL 4D9RD 1FNFA 4L1SA 3WLWD 4IEFA 2N7AA 3WS3A 1MRDL 4BSVB 1U8OA 5SWSE 2L04A 4NI6A 1FFPB 3DV4A 4OZFG 5T3XH 43CAB 4DUVA 1FGNH 2ZIDA 3GI9H 2DTML 4NCC1 1RPQA 4DKAA 2E9BA 1CXHA 5C0EA 1BZ8A 3DYOA 3DA3A 2CKNA 4ZMTA 2ZJSH 4MMZB 2F18A 1GRWA 3G5XB 4GLRI 3ISWA 3DTXA 3US1A 2IWFA 2W0FB 3BI9X 1MFNA 3ESOA 3KHQA 5HHME 1E5UI 2G4EA 3ABGA 1MFMA 1QRKA 4Y4FC 2OTWA 1TFPA 2AAVA 4J3WA 3SCMC 3V4UH 2BNRA 5IV2B 5EZIL 2ZFGA 3E2HC 4O4YL 1G1YA 5CLXA 5G5DB 4NO5A 1MHHA 1KZYA 2F1TA 4CSPA 4FJYA 1A3RL 4LDCA 1DR9A 4MYPA 4PJAA 1IBFA 3MRFB 4H20L 2P5EE 4J3UA 1NBCA 3AREC 1GC1H 3PLYA 2WLKA 2VC2L 3ILPB 4FQ1H 1UXLA 5D5MA 5DVOA 5INCA 3AAEA 4UANA 5HHOA 4K3JH 4MQXC 3U1PA 2B9AA 3FAWA 3GZOA 5C0AB 5LO7A 3K6OA 3UOAB 2AAAA 3VFMB 1TYJA 3LEYH 3T0EB 2ARJB 5DUJA 3UTOA 3NJJA 1QBLH 3E9TA 3MO1A 4H2CA 1AG6A 4TLKA 3MRNB 3GSXA 3RA7H 5DZPA 5EU6E 1QLFA 4H5SB 3IJYB 2JKWA 1KCBA 4PJGE 4X5XA 3W1ZA 1KENL 5IOPA 1ZHLA 2DQEH 2XQYK 4TNGA 3BZDA 4ZD3L 5LBSA 3BS0A 4NB7A 5CMAB 4F8LA 3ARSA 3ULVL 3IDNA 2DQUH 5AQ0A 4V2CB 1F3JB 3SYAA 1OAXH 2A77L 3O6FD 5EHFA 3HJEA 3KYNA 4X4ZA 4O5LL 2CJUH 4I88A 2YJQA 3D39D 1LK3H 3DK0A 4BXVA 4GW1B 3QIBB 2F19H 2YA0A 2NY2B 3V7MA 3WFEL 4L3CA 3H7BB 5KYXA 3SY7A 3BESR 3CSBA 4NO3A 5CGMA 2AI0H 2FWOB 4HUWA 3WUWA 4TQIA 3HBGA 4GI6A 4F7EA 4JFDE 2FO8A 4B27A 1C5BH 2EEDA 5EPMA 1YYML 4JL2A 5TH2A 1S9YB 4ODTH 4PVLA 5DD0L 1N12A 4PGEB 1QLEH 3DX9A 3AROA 3VSQA 2M06A 3D4ZA 4TVPH 4B9IA 3PWPD 3OMAB 1MFVA 5L4IA 1KXTB 4NQSA 3V52H 3T8XB 5FEBA 1QWHA 5E6ID 2WUCH 3T3PF 5F1NA 1A6ZA 1BLIA 2CA4A 4PRIB 3IDXH 5EUOB 5KVMC 5C08D 4DGYH 5F7LB 3IBEA 3NPZB 3MR9A 5I17B 3MLTA 3KYKH 2R83A 1MFCL 3F7QA 4XRCA 1DFBH 5IW6B 1HOEA 1KGJA 3GRWA 3D34A 4OFKA 2CZNA 3QA3A 3NESA 4ZODA 4EDWL 1RJYA 1PG7L 2GTZA 4N2HA 2OSWA 4JFVA 5C1MB 1KBVA 2BSSB 1NBYB 4WU5B 5KBPA 1SBSL 1FHNA 2ENQA 4NWUH 3MGAA 4ZFFB 3N41B 5JA8B 3P2TA 2AVGA 1YSOA 5C0AE 1EGJH 1A6VH 3P3UA 5SWSD 4GKLA 1FL5B 1UJ3C 4M48H 4ZTPH 4D8PA 4NGHL 2YKLH 3T0EE 3F62A 4A6YB 3TNNA 1S7VB 4G8GA 4F2MB 2MPAL 1JWSB 4G2AA 4ZMQA 5FYKE 5GRWA 4M7KH 4DFIA 3DVFA 1Q0YL 2WBJC 5D8JL 4C59B 1UTDA 1S2EA 4TNVK 2CH8A 5HHMD 4LLVA 1BG1A 4MA8L 3EH2A 3QUYB 2IGTA 5K9OA 4APXB 5DLLA 1QBML 1YYCA 3U46B 3BPOC 3RJQB 2X40A 3BKCL 1BXWA 1IFHL 3LS5H 4HHGA 4AC4A 3MJ9A 2DDQL 3QUZD 3GSUB 3ZKQD 4IU3A 5MEQB 2O5YL 2APXA 3B4NA 4APQD 3ZHKA 1JF1B 1UKSA 1LM8V 2NY4D 3SJVA 4XN7A 4FLSA 4UM8B 2P5ED 1W2KT 3LXBA 4WI7A 1GZQB 3I84A 5AW9B 4HH9B 1KCRH 3HVDA 3MRQA 2X4QA 4K94C 5DU7A 2J3SA 1BZ9B 3QZWG 3T2NH 1M1XB 4I48A 3RX5A 3CFCH 1T1YB 1EFXD 1Q9OA 3RGVD 3RDTB 4NIYE 1KXHA 3CG8A 4L29B 2N1TE 5EU6D 3UIYA 3BXNA 5AG8A 4FNUA 3CMOH 4HD9A 1JDCA 4JG0L 2UY6A 3EGDA 1EHKB 2BFGA 4PRIE 3KPTA 5EUOE 5I1HH 3RE0A 4AZ8A 1CPUA 3DX3A 1S5LO 2LFUA 4QEGA 4DP1X 2ZCLL 1G1CA 2PP8A 5DHDA 1FFRA 2CWRA 4U1SB 1WTGT 4JDEA 3PDOA 1FI8C 4NEHB 2DS4A 4IM8A 2HN7B 1KUMA 4ONFH 3BUBA 4P4KD 3H56A 1A21A 1NL0H 3MOAH 4F58L 4H7VA 5E8DL 3WEAA 1MDTA 2Q7YB 4M7LH 2F1VA 3QHZH 2JIXB 4Z3EA 4UZSA 2NZ9D 4U1IB 3DX6A 4YEEA 1FPTL 1ZEAH 2F1EA 2AJYL 4MZIA 4G1MA 4JFDD 3WUWG 1G43A 3LK2A 3UYOD 3O4OB 1D9KA 1AHWA 4RFNB 3ESUF 4G7VH 3QZBA 3OGCB 4F2ME 3MRPB 5F96L 4A1RA 1SNRA 3EJRA 5I9QC 4WI4A 4QKTA 4LCWA 4FMVA 4F9PA 4HZLB 1BVKA 4G8EA 1T0MA 2FEEL 2D73A 4FFTA 4YS4A 4HPYL 1F4XL 1RMFH 4WNSA 3IVKB 2X1OA 2E7BA 4Y1SA 4FCAA 2D7TL 3VRIA 4BCXA 3GJEA 5M7QA 1IKFL 4QRUA 3ZU8A 2IGFH 4PVNA 3V95A 3HRZA 1NJ9A 3G5YA 4HS6A 4YHZL 2AFNA 4ZI8A 4GUQA 4DVRH 4L4VA 2Y0SA 4FRTA 4NC2B 2C9QA 4H13C 4PW9A 4AGQA 4YSEA 1GSMA 1C5DB 2IADA 4NM8L 4Y4HD 3B2VH 3HCVA 3N91A 4X4MA 3G7TA 2KQMA 3G6AB 1LK2A 3AQDA 4Z0BH 2XSKA 4Y16B 3X3GH 2QV4A 4QAMB 4NXKA 1I7RA 3U4AA 5E56A 5C0AD 3EFOB 3MDJA 3WNKA 2YD1A 1RZ8A 5FPIA 1HJBC 4N86A 3T0ED 4Q58C 4E9LA 4C55A 5ENWA 4PH8A 1FL3A 2WNWA 5CD3B 5AOKA 3VWJA 2Y5TA 4HJUA 3EGSB 2RR3A 1FNAA 2DBJA 1WE5A 5FYKD 2P44B 2Z93A 3OHXB 4XWGL 4RMUA 2FNBA 1DL7H 3VFWA 4JDTH 3SDYH 4NCDA 1HI6A 4OY9A 4LCCA 4P46C 3VVWA 4HH8A 3QQ4A 2E7HA 1MFEH 3MXVH 1OW0A 4RFEA 2ZOLB 5L7XL 2GJZA 2WWNA 2XTRA 4IHOA 1FZKA 4HLEA 4OF7A 3N9GH 5DHXB 3VMNA 5K9KA 3A4AA 1XT5A 1D5XB 4LSTL 4KXZH 4NUMA 3TN0C 2NY0D 3MGTA 4OD1L 3QIBD 4HKZA 5ABZA 2NY2D 3F01A 4NHCL 4DHLA 1SM3H 3V0GA 5CINL 1V7ML 3MRCB 2WLYA 4JM2C 3A0OA 3SGKC 1T16A 1U3ZA 2F0CA 3BAIA 3UCQA 3DETC 3ME0B 3TBSA 5D96C 4L0PB 3SBQA 2Z4QB 2AP2A 4IJTA 5ERWB 2VDQB 2WV3A 3BUTA 1JXGA 4X8JA 3RWGA 1NANH 3VZUX 4PRID 2OMUA 3SE9L 5HYSA 2UXFA 3FFDB 3WIAA 4HEME 4UTAL 2Y69B 2WLNA 4D7PA 4JJ5A 3ULVF 4MDRA 5A2IH 5CIPB 3QIWA 1HNFA 1JHLH 4YZFF 1M7DB 3L1FA 2BIQA 5I8CA 5FGRA 2ETWA 4ADJA 3AXLB 5A2KH 4NNYB 3RKDC 1KGYE 1TVHA 5FK9A 4PR5A 2DOCA 3AA1A 1U91A 5ID0B 2JI3A 3RNQB 3LRSB 4XB7A 1UKQA 4IU2A 3GSVA 2K4TA 1OIOA 2EEBA 3A5VA 2ITEA 4PMFA 3T5WA 3L5HA 2P5WA 3FPXA 4P2QE 4H8WL 3NAAH 3MFFB 1YJDL 3QQ3A 4XMPH 1MLCB 4FTVB 5DEGA 5DUMH 5JW4Q 4JQIH 3GEFA 4KZ0A 3V6OA 2YQGA 1XMWA 2XUWA 1T89A 3WI9A 1E2WA 4D9LL 1BIHA 4Y5YC 3VXMA 4NYLA 5BVJA 2PMZA 2B9BA 2VZTA 1P4BH 2X89D 4F2FA 1P5UB 2PPEA 4YL4A 2E7MA 2PN5A 1SMAA 3WY4A 3QUYD 4AK1A 3R06A 3WN5B 3N2JA 2V2TB 2ZUUA 2QL1A 5EU7C 4PV8A 1PIGA 3UDWC 4BH7A 4L4TB 4HX1A 2FB4L 1DQQA 4EIZC 4XODA 3TZVA 4KZEH 4OCLC 2XKUA 4HOWA 2ATPA 1JGLL 4B9JA 1RZIB 4MSWB 3ULSA 2YGOA 4GP8B 3IMVA 4JLRA 4H1LH 3L3HB 3ALWA 1TKWB 2WTPA 4NLAA 4W9DC 3SPVB 5CHNB 3GMLA 4B50A 1KACB 4ZFZA 1EH9A 4J1UB 2L3BA 1A66A 1C7TA 2N2LA 5IVXF 4Y4KC 5JR1H 1I1RA 1BEXA 3OKLA 4LOVA 2YRPA 4BK5A 1EEYA 2J2ZA 1TZ8A 3ECBA 4BSWA 3RDTD 2EXWC 1S78D 4XE0A 1OALA 1N5AA 3QJQB 2VUYA 1TETL 5HGHB 4R26H 4J6IA 1I1AC 4P5MA 5LXGH 2WLIA 1H3PH 3HA0A 4R5VA 4DGWC 1E65A 4BDVA 2D7PA 1V7NH 3F2LA 4Q97A 3WU1A 2IEPA 2MCG1 2PPFA 4IIQA 2BINA 4FQIL 3KW8A 5D7IA 1JGVL 2H2PD 1FN4A 1G7LB 4ESKA 2NTFB 2WKOF 3O6KH 4KKLC 4XNXL 5GGSB 1E8WA 4H25B 3P69A 5LBSH 4UDUB 1QMUA 2QPSA 4XI5C 1FBIL 5T1LB 4UV7L 1G9EA 4UU9B 5D1QC 1X5XA 5TDOB 4LIQE 4BJLA 2AXTO 3TYFB 4ZW7A 3O3EA 1IGJA 2V0AA 1HDMA 3FB7B 1LEIA 4FTVE 2FBJH 2V2XA 1CF8H 1YMHB 4LAQL 1YPZE 1E43A 3O45B 2W07B 5JW5A 4UT7H 1EHLL 1RH8A 1T21A 4N0FA 4I0KA 5FGSA 1ADQL 5A2FA 1RK7A 5HYSG 1FJ1A 3ARBC 4MNQA 5GS3A 4YPGA 3POUA 1RK0A 3I74A 1CFTB 1R4XA 2YD9A 3ZHNA 4IBUA 5T1DL 2G5RA 4HKBB 5JIPA 4L4TE 3DUUA 1RZGA 5GJTL 2DLEA 5CUSL 1EZUA 3FUEA 3LDBB 2VWEC 4S11A 2IALB 2DQDH 2ADJA 4J2QA 3CMGA 4U1MB 1E6JL 1KEGH 4XNKA 4XN2A 2P8PA 4U6XB 3U7WL 3CXHK 2Z65C 4XZUB 3NJLA 3O2DH 2J8UB 4RMBA 4OI9A 4L1HA 2J6EH 4A2DA 1AGEB 5EO1A 1U58A 3QUHA 4P2QD 3T08A 1N67A 3QJTB 2WVTA 3B7YA 3TPKA 3IFPA 1IAIH 4HJ1A 1U36A 3MFGB 4HS8L 1JWUA 3PWVA 4XMKL 4X98B 5B1AB 1ZLWH 4E42A 4EVNA 2VDRL 1U92A 5F7KC 4QXWA 3VXTB 5EBMA 1F3DH 3OAZK 4X6DF 1T7WA 3MNVB 4N6RA 5GRVL 5LCVL 5KYYA 1NOFA 2JJUA 4L1BA 1OGTA 1RHFA 4ODVL 1ES0A 2VXQH 3FKUS 4F2EA 2EDYA 2OMTB 4JHUA 3PWUB 4D0BB 5AD0A 1D2PA 2CDEB 5SWQA 1WD8A 1E28A 1Z9OA 2PTTA 3X1EA 4DGVH 1PX4A 2W80C 1ED3A 3SSGA 3UACA 3C5SA 5CFHA 1ZGLA 2FT6A 3V4PB 2FZ3B 1W6WA 4GQPH 2HSIA 4HK0A 4PREA 4ODXA 4ALAH 1QW8A 3RAJL 3G5WA 3NIGE 4B5ZA 1AKPA 3OMZA 1ESOA 2Z31C 3GMMB 3MCKA 4MCYA 4B53A 3L6FA 5KAFO 5J13B 4FULA 5EU3A 5HJBA 5ICZA 1R3LB 3QORA 5TQ2H 2EDOA 1HAUA 1F58H 1KV3A 3ARTA 2GSIB 2CBTA 2X4TA 2QSQA 4KPHL 4I4WB 3FQYA 3GQFA 4L4JA 3VYPA 1N19A 1CLZH 3BKYH 4ZFOL 1YEFL 4LBEB 4IK6A 3N0AA 5IEKB 4NQEB 2QQQA 4Z78A 1T2XA 3PIQA 5C3IA 1NFAA 4GO8A 1N0XL 4OGYH 4G8AC 1IFGA 2VDNB 2ICCA 2A83B 2C9SA 3UAEA 5IMKB 1BLNB 4PG2A 5ETUB 1OWRM 4IRJB 1CZ8L 1L7IH 3VFSA 3IRCA 2BX5A 1BM3L 3BQUC 4NZFA 3T6XA 3H3KA 2XU9A 4PTTA 1LP9F 2X4OA 4YHLL 3NFPB 3BDYH 5CJ8A 3WFHA 4QRTA 4U7KA 2J8UE 3UBXA 4N59A 1D6EA 2XZCL 4JQXA 5AVYB 5GPRA 4PGCB 3QJHB 4KRPB 2E7CA 3S3SA 1J1PL 4FXKB 2K7PA 5D71H 2FYYA 3G5ZA 4PJCA 4FTVD 3SZVA 4RJXA 5FO2A 1FP5A 3CBRA 3T65A 5JLZB 1EEZB 4U1JA 1TQWA 2NUTB 1G9NC 4JREB 1ZLWK 1A3LL 1DVZA 4N5ED 1BJ8A 4YZWA 3ARGB 2WN3A 5I74C 4CN4A 1OF2A 2QQLL 4RFOL 3QRFM 3MGOA 5CD5D 4M8UA 1KWKA 3TP4A 1LDPH 3O11A 3F6LA 4G9FA 5LLIC 4L4TD 3WJLC 1FZOB 1X4ZA 2BPBA 1NCTA 3CHXA 1BECA 3QHTC 4FQQB 5E2TH 1NGYA 2J20A 4X5LA 3W9DA 4FZEL 1EFQA 3L9RB 3AA7A 3UPGA 1UOWA 3QEQB 4F92B 4NRXB 1OK0A 2BLFA 2K6WA 4HGWB 5GS2D 1I1YB 4NSKB 4F33B 4HWEH 2K1MA 1HHJA 3AVEA 4IBYA 4KJYB 4K3GA 2H3XC 1OTTD 3IDMB