2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Immune system
molecule keywords FACTOR H BINDING PROTEIN
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
3KVDD 3VE1A 2W80C 1YS5A 4U9CA 4AYNA 3V8UA 4O4XA 4O3YA 2KDYA 4AYEC 4O49A 4AYMC 4O3XB 3PQUA 4O4UA 4AYDC 4AYID 4Z3TA 3PQSA 2LFUA 4O3ZA 3UAQA 3VE2A 3HOEA 2KC0A 2W81C 2Y7SA 3HOLA 2YPVA 4O3WA 5EE2A 5T5FA 4QQ1A
chains in the Genus database with same CATH superfamily
4N0FB 2KLSA 2V5RA 5I30H 1KWGA 4XBPB 1I1CA 2GK0A 2WVSA 4FNLH 1T16A 1AGFA 3EJZC 4RMTA 4ABQA 5C2BL 1MCLA 4XMLH 4X8XA 4B27A 3UBXA 5KVEE 4CNIA 2DKUA 3L3HB 1I9RH 2X7LB 4XOBA 2AEOA 3MLTB 1U91A 4ELMB 3H85A 1KYOK 1KZYA 3VQ2C 2GK0B 2YRPA 5FOBA 1M2OA 2F1BA 3EJPA 2ZOUA 3MRCB 5IQNA 4TXVB 1MFDH 1TO4A 3QQ9D 2GTQA 2NY0C 4ZPVA 2XETA 3WAKA 4DGYH 4CBPA 1G7MA 4J2XA 1Q8MA 4O02A 3LN4A 4WWKA 4XP1L 5EC2B 5D9SA 3OKMA 4Y19B 4ZBJA 4E9TA 3KPSD 5CGTA 3UU2A 4JB9L 5DRWA 5C0CD 2BVUA 4XVTH 5EU6E 5FOBB 3HG1D 3KH3A 1C12B 1EGJH 4V1DE 5FDWB 2YPKB 4ZPVB 2ZCLH 5I73B 4EI6B 3F00A 4XMPL 1OIOA 2WHVA 2X4SA 3TCXA 3L2LA 3GBNH 4N2AA 5E5MB 4HIPA 3ZDZB 5E6YA 3OLIA 4N8VA 5F89A 4KHTH 3FQYA 5C0CE 1J8RA 1U41A 2QHLA 3MBEB 5D7JA 4OCXL 1O7DC 4AQ8C 1CGUA 1EHAA 1N0XL 1NCJA 2FJFB 4NN7C 1V7MH 1EDQA 2EYSA 2MNWA 2OV0A 1YEJH 2BWIA 2Z6FA 3AS3A 4FNLL 1SBSH 1N2RA 1BWWA 2PYFA 4HIJA 1J1XL 2VDML 3PU7A 2QFPA 5IJBC 1HHKB 4G8GB 2APBA 4AEIL 4MRCA 2A4EA 2FJFA 2F7OA 1R3LA 3EO9L 2A4CA 4F91B 4QOKE 1U4EA 2X3CA 3QIWD 4GCSA 5IHUL 4ZOAA 3G6DL 5IFAL 5GS0L 5FPIA 4PJAB 4LGRB 3T3PF 2XPGB 3ZKNC 4F58L 1T89A 3SOTA 2FHCA 3DX6A 1ASQA 4X83A 4RLBA 3QJTB 4JRXA 5FKPA 5DHYA 1Y6KR 5TPWL 1JXDA 3L45A 3TONA 4KVNL 2A7BA 1KLUB 3RBSA 4Z7AA 3MLRL 3HUJF 3PS6A 4M6ML 4KC3B 4FQXD 3RTQC 5AW9B 3V6BR 4FLOA 4FQEA 2GITA 3CU7A 3MJ8A 2LHFA 2EC8A 1EEYA 2GUOB 1H9DA 3VGFA 1WGVA 4U1MB 2EABA 1BXAA 1IFHL 3WKYA 2CO4A 2V17H 2EH8L 4KNTA 1UA3A 4MDRA 5B3JE 3MBEC 3NACL 4JCMA 5LXGL 1YMHB 3T2QA 4OTXH 5BOZG 4JCLA 4M1CD 1YA5A 4M7KL 1TXKA 3ECUA 3IGFA 2R39A 4I18A 5BS0E 1WICA 4OIIL 3UJIL 2RHEA 3SQBA 1XAKA 2X3BA 5TDPA 3FT1A 5FS5A 4XVJH 1UFGA 1WG3A 1LK3H 2IMNA 1IGFH 2HUHA 5I5IA 4Z8FH 1JV2A 2F53B 4BZ1L 3TH3T 1U8JB 1TJXA 4LSSL 3SPVB 5DL8A 3LNHA 3O6FB 4U31A 3WKQA 3MOQA 5EO0B 2MHAB 3LKOA 1UG9A 1F18A 4EQ2A 3GXPA 4Z78B 5SV4A 1XGQA 1UM6H 1J8HB 2UUDH 4GXVL 5HYSB 1WTGT 4TUUA 5FVNA 1AE6L 2YMOA 4ONFL 3KWTA 3GFUA 3WE1A 1JERA 5DXWA 1I1FB 4H8WH 1WAEA 1HHJA 2EECA 4G9FB 5C9JB 2B15A 4QI3A 1PYWA 1F11B 4PJ5E 4UT6H 2MQ3A 1P7HL 3K6NA 3OGOE 4P5TD 1K4DB 2Z8RA 1JG9A 2EH8H 4Y1SA 5DHMC 1IAOA 3MRCA 3DX0A 4POZC 4FXGA 3PQUA 3T6XA 1UKSA 1IEAA 3ROOB 4AQ8A 4OIAA 2WVUA 4I1RA 3T0SA 5EMYA 3C6EA 3ZRSA 3KLSA 4HSQA 4KJPC 5ADOL 1M42A 4X2UA 3QUMH 4R4ND 4BZYA 3DYPA 1U3HD 1NCWH 2ZKHL 1PIGA 1QSFA 1UATA 2KI6A 4OGAD 4JHWL 3FUFA 1EGJL 3JTTB 4ZTEA 4ZUSB 4DGVL 1MCJA 4C56E 2YAMA 4HALA 2PWHA 5T1KA 4PRNB 4TV3A 1YNTF 2W9LA 1XCTA 4JDTH 5F8QC 1IU1A 2I9LA 4PH8A 3SYOA 3WCYA 2CIIB 4U1LB 3KLAB 4XXCA 3LXUX 4CMMA 2MQ0A 4ENEC 5I73C 3EXJA 2CO7A 1N70A 5JXEA 1NPJA 4W9EC 3IDXL 4F7EB 5FYKD 1CGYA 3UJTL 4PJ7E 5LWYH 3MJ9H 3NZ8B 3BSZA 4XCNA 3EYUL 3KGUA 3NG5A 1MVUB 2I9LB 1EO8L 3QG6B 2EACA 4W6WB 3OL2A 4PLJC 4ONHB 3P3SA 4PW9A 1HHKA 1SBSL 4WI0B 3VD1A 3QVAA 2ICWJ 1V3KA 3KWWA 5F3FA 5GGTH 3INOA 4Y1AA 2JXMB 1JWUB 3ZE0B 1UWYA 5AVQB 1L9SA 3IXTB 5J6HB 1CBJA 3SE4C 3DOSB 1BBJA 4IBVA 3F01A 2LTQC 3B6SA 4L5FH 3VXUA 2BWDA 1KN4L 1XH3A 4PJHA 1WISA 1XF2A 3DV6B 1Y6NR 1T83C 3HS0C 5IVXF 3HJEA 3TJEH 3U0WH 4R7NB 4L4TE 2IWGA 4ZAKC 3DJTA 2QZ5A 3HHSB 2WNXA 4WFED 4F8LA 4NPYB 1R5VA 5D72H 2CIKB 3HMXL 1EANA 3IMSA 4IMLB 2JB6A 5ENWB 1EEYB 3ISWA 4QOKB 4Y4FA 5E6UB 2BNRE 3LN4B 2VR7A 1LM8V 3VB9A 3TBYB 5IESH 1F4XH 3WFHB 4DK3A 1ZGLP 4AC4A 4PUBL 4QRPE 2ZG1A 3RL1A 1UXSB 1YEWA 2R15A 3L3OA 3K74B 4JDVB 4BFGA 5T5FA 1WAAF 5FM4A 5ETUB 3Q43A 5E6IC 3DO7B 4G7YL 3HIZA 2MTAA 2B9BA 2Q7YA 3DKHA 4GP8B 5T8IA 3V6FB 3WU2O 2APXA 2EXYD 4NKOA 5ICYA 5E79O 1MAML 3AS2A 3L5XL 1HWWA 5F1OB 3V0WL 3ARFB 2BSSA 5TISO 3ISRA 2E74C 3WXVL 2VR6A 3BUYB 2OSXA 1UVQA 3DO7A 2F54A 5FX3A 3W0WD 3ZKXB 4X7EC 2JKJA 1TQBB 2JJTC 1Y1DA 3FFOA 1DN0A 4XNQB 5HGAA 1RZ8B 5GGVL 5K9OB 1OD9A 2DIJA 1SQ2N 1T1LA 2Z3FA 5DF0A 4XN8A 5IG7A 3CC1A 1NIBA 4LSDA 4I3RH 5DJCA 1AC6A 1DJIA 3AAZA 4AL8C 1KB5H 1WZAA 1GH7A 1KIUA 1NCAH 1ILUA 4C56D 1HDMB 2VC2L 5DHVA 2AEWA 3OLGA 4UTBH 1MRCL 2F5AH 4P04A 2WVVB 2NNCA 4K5NA 4YHOL 1QLEB 2XFXB 4B9FA 4BSWA 3M1OA 5EO1A 3L6FA 4JFXB 5KW9H 3LQMA 1W6WA 3T3MB 4FABH 4HWBL 5BOPA 5F7MC 3GNMH 1UM6L 3J07A 4QF1B 1OPOA 4BSVB 3R4RA 1C7SA 1Q0YH 9CGTA 1RUQL 1JPTH 4KTGA 4GQ9H 3W1ZA 2IDCA 4MA8L 4RFNC 2R0KH 2L7UA 5DRXA 2R23A 3KNBB 2YRZA 1D6VL 4I85A 1XF5B 3GBMH 4UQAA 4NO0A 2JLPA 4OCNC 4KQ3H 4RDBA 2OXHB 3LKPA 2NSXA 1C5BL 1S7TA 5SWZD 1R3LB 5EOQL 1P1ZB 5D7LA 4YX2L 4WNJA 4B61A 3O4LA 3ABLB 4AM0Q 3LK3B 3TOPA 1XH2A 4M8VA 1F97A 1KY6A 2PXYB 4YHLL 2P80D 1IC4L 3X1FA 3U2SA 4WUKH 3QZLA 5I1HH 5FA3A 3N44B 4G9FD 3H2WA 3W9DB 4TLTA 1BXUA 2YPVL 1ZWIB 3N44F 3OLEA 3QDJA 2ZF8A 4HT1L 5LUMA 2HRHA 3NMEA 2CUHA 1DVFC 2QQKL 3QR1A 3JWNC 5TE6L 1H8SA 1HEZB 3BPCA 4XMXA 4X8JB 4L3EE 3SKOA 3UBXI 1TVBA 2QVTA 2HG5A 1RZIB 3BVXA 3HBPA 3OR7B 2NW3B 3Q6GH 4LVOC 9PCYA 3MRKA 4HEME 5E2WL 3KL3A 1QKZL 1I9EA 3KVPA 3G08B 3HC2A 5E9NA 3UEQA 2NYZA 3VWJD 2P52A 4PJGB 3VDAA 1GHFH 1MM5A 1B4TA 5HPMB 4YDJA 3QPXL 4G80B 3APNA 3F5WA 4MHHI 1X5JA 2R0KL 4NI6A 1E3XA 4JKKA 3C60D 4FOZA 3NABL 5D1ZI 4O4YH 4DIXA 4OLWH 2IF7A 4HD5A 1P6WA 3QG7H 4OFVA 2Q9OA 4JKMA 5FFLA 4ELMA 5D2LE 3IDYC 3CV5A 4JPKH 5CM1A 3QW9A 3NBNA 1VZIA 3NUKA 2EXWD 2ID5A 3TA3D 1WFOA 1CT8B 3NRFA 3RVWD 1Z0MA 4ZO9A 1FBIH 2Y72A 4HWZA 1TZHA 4HZAA 3UAFA 1CFQB 4OF5A 5I1HL 1A3QA 2V9UA 2XWXA 4YZWA 4HC1A 4JDVA 4BA0A 3CFBA 4XPTH 3KPSB 3LHAA 5AWNL 4QD2E 3P9MB 3GSUA 4X80L 3ZDXF 1UCBH 1VIWA 3GD1C 3MV11 4HGWA 3O6KH 3OR6B 4G6KL 3PHAA 5GRJH 3CHXA 2B1HH 3CVHH 5F21B 4UQ2B 2O26U 4OV6F 1IZKA 1NH6A 4NAMA 5D1XB 1ET5A 3HVNA 4E41A 3GEFA 4FMVA 4HXAL 2CBPA 4HLEA 2UVFA 1NCOA 1UVQB 3N42F 1PSKL 4I5BA 3ZE2E 5I1AA 3G6JF 3QK0A 5DEGB 3AABA 3BLBA 2HT4D 4IRJD 4JRXB 1CBVL 2K70A 4F37K 2XNAA 5EBLA 4PJ0O 1NC2D 1NKRA 3BPLB 2OMNA 4GH7B 5JDPA 3WNLA 4PMEA 4HJIA 4UQ3A 1K4CA 3WEOA 2O6EA 1A9VA 4JFQA 2SEBB 3TZVB 4D0DB 3RDTA 1FLTX 3BKYH 3RFZB 1HN1A 2FDBP 2OYPA 1UCTA 3D30A 4EBQL 2P26A 4R0LC 4KFZC 2HKFH 3I6KB 3N91A 3QUYD 4UM8B 3MRMA 5EN2B 4PRDB 2O93L 3SE3C 5HHPB 3LPWA 2FH6A 5FECB 2VDRB 1JYWA 4K7FA 4B6ZA 4AQ1B 4F7KA 5HHOB 1A1NB 1K4DA 3AWFA 3HC4L 2YPLD 3D4ZA 5CEXB 25C8L 2JCCE 5AFUK 3PCYA 5E1IA 1JZ5A 1CXHA 3FQNA 2UXFA 3HNSL 3AA6A 4U4IA 5I1GL 4X7CC 2ZTBA 1JZFA 2Y36H 4Y5XB 4PRHD 3ZJAA 3IVKB 4XR8C 4P2CG 4XWOC 1FYTD 1MOEA 4U1NA 3SOBL 1R9FA 4K23H 2NZ1A 2F5BH 4KOBA 3SKJL 2B59A 3QYMA 1J11A 2EDOA 4UZUA 4Y4HC 1F8TL 5DURD 3AQDA 4H8UA 2EUWA 4AGMA 1LGVA 3C5ZB 4Y4KB 3TBCA 2IPKA 2XQYG 5IHZB 1G7PA 3K72B 3TNMB 4AGOA 2YPLB 1FFQA 1J9SA 1CE1H 1Z0NA 3KLDA 5DR5H 3IRZA 4ZW3A 3N1MC 5IFHH 3JTBA 5GGVY 4V33A 3RJDA 3BRDA 3NZ8A 4NT6A 5CP3A 3UL4A 3PXJA 1JE6A 4HCGA 4MNQA 5EUOF 3D3VE 5FYLD 1SLXA 4DFHA 4AJYV 3DRQA 4PJFA 5JZ7C 3VWKB 1FSKB 3VXTA 4O9HL 2W92A 2CALA 5AW7B 5AKVA 3T0EA 1ZHXA 2BSCA 3MA9L 3QXVA 2QT6A 4LP8A 1WIOA 1Z3GH 2N59A 4MKMA 2R9HC 3ESUF 4OF7A 1ZJAA 2J6EH 3PL6C 4AYID 4WEBL 4TL5A 3OVUB 3PV6B 4GIAA 5CU5A 1H5BC 4R2GC 5JPNB 3RL1B 1PZAA 1YDPB 1NC4B 3NJMA 5J9PA 3F5WB 4XE5B 2J4WH 1QHOA 1PLBA 3RB7A 3ZGHA 2W9DH 2A74B 1FH5L 1MJUL 2DEYX 1IX2A 2NY7L 4OFYD 1TPXC 3FDWA 2VLKB 1XCQA 2LOEA 1HK6A 3PABA 2HVJB 5E6ID 2PR4L 4X98A 3T4AC 4OV5B 1NC4A 2AJVL 2CIKA 2KKQA 3QHFL 1JYNA 3Q6FA 5A2IH 2KUTA 4P5TC 4JPKL 5K93A 1TEYA 1JGVH 3BJLA 4XI5C 1MCFA 4JFFE 5F3HA 4CJ1A 2X28A 1S7SB 5I6MA 3MROB 5HI5C 1XF4A 1JPGB 2H2PD 4ORGB 4S0SD 3MX0B 1BZ9B 1U0QA 4S0TD 1BVNP 4K3CA 1LWRA 4XX1G 2VOTA 3WFCH 3KBEA 3RLSA 3FYXA 5J6SA 3FNKA 2G75A 5DD1H 2XXFA 5I74B 5IW6B 1UQSB 3V6ZB 3VQLA 4ZUUA 3ARDA 3JVFC 1TOXA 3C75A 4XZUA 4RAHA 5CJXA 1E42A 1SEBB 2BSSB 3BEVB 4M7ZB 5MERA 1E8XA 1PS3A 1RZKH 3HVDA 3QEGH 2J6EL 5ITBH 5B38B 3DIVA 5I8KH 3H9SD 3CDZA 3B9DA 3RYMA 1OAZL 4PRHA 3CBKB 3CVHL 1BOGB 4RMUA 3BZFA 5FHAH 2YEZB 5GJSH 3UBHA 3N43F 2DDQH 2KZBA 2QKIA 4KHXL 1KBKA 4Y4FB 1DQML 1KACB 3IXAB 1N7MH 3QUXA 4Y2OA 5C07A 5IB3B 4LVHC 1P5VA 1SJEB 1AIFB 3L3JB 3R06B 4BSWB 4QAWA 4F8PA 1UXWA 2A5UA 5JYLA 3AC0A 3H9HA 3WDJA 1HSBA 3V0HA 2E7LA 1BSIA 2VR4A 3C60C 3WELA 4FXLA 3A21A 3STLA 5DHXB 5TH2A 2C4FT 1MRFH 1DSYA 3ZIMA 1KJ2A 2CHZA 1ID5I 3DYOA 4M5YH 2Z35B 4ZFFB 1I7UB 2OMWA 3BP4A 5D7IB 4EBQH 3FCTB 2DLFH 5JIIA 3KHQA 1GIGH 1TO5A 3IDIA 4ZD3L 3KBPA 3JV4A 5DS8B 3VD2A 2YD2A 5D72L 2R69A 3VGEA 5L2JB 1EAQA 2MPAL 2QLVB 1TG8A 3AMLA 4AYDC 1PW3A 1BFOA 1TZ8A 2RR3A 3K2MC 4G7QB 4N0FA 4PGDB 4WAFA 3JCUO 4NQSA 1WA0X 4ACPA 4AQOA 1R5IB 2VLRD 5LGYA 2MEJB 2C9PA 1L5GB 5I0ZA 2OM5A 3MGTA 5EBMB 4WJKB 3ULSA 1V3JA 2IWEA 2VLLB 1ZT1B 3FRPA 3K4ZA 3N1PC 3D3VD 1OP4A 4PJ9A 5FYLE 1O9VA 2FE0A 4YGAB 1G84A 1MFBL 4HS3B 1F86A 4PSRA 1GKEA 4UM9A 5DJ2A 4YR6A 3GIZL 2YKLH 3I6LD 3LPGA 2OW6A 4B0MB 4YQXL 4P9HL 3S7GA 4FFVD 3ZO0A 4FP8H 3FU0A 1FG2B 1JRHI 3WIAA 1OT4A 2I5YL 3NGBB 1M53A 1IT9L 5EFIA 1OW0C 5IJKC 1J0JA 3VWKA 3VXTB 5AYUH 3DUUB 3A6OA 3NDYE 1YRKA 1LDSA 3RZCC 4DGIH 5BRZA 3QJZA 3ECWA 4RX4A 3U7AA 1VESA 2SEBA 3TZVA 3BRZA 2XN1A 4CU8A 1OAKL 3EYVB 4WEBH 3MDJA 5EIQA 4M6NL 1X4XA 4BHUA 4A2DA 1IAOB 2DLFL 2K7PA 2A74A 2DQIH 3QFDB 5DT1H 5JIKA 2ESVD 4YC2B 3KCPA 5ISZB 1A6WH 2X89A 1AAJA 3MV9E 4KFMA 3EOAB 1F1AA 4O5LH 3WHE0 4A39A 1P4IL 4R4BB 4XO3A 5IJDC 4C4VB 4Z1PA 4XVSH 5FV2A 1Q1PA 3KWWB 3MRJB 4NBYB 1TT6A 1WD8A 4OLVL 1NIEA 5EH1A 3UAAA 5I9QC 2HWZH 5F0LB 4JHAL 4JFFB 3K6FA 2Q76A 3DTDA 4O51B 4JREC 4A6YL 2VXVH 4X9YA 1OWRM 1FAIH 4NO0B 2NY4B 5K9KB 5T3XL 1IIKA 4BM7A 3APFA 5D5ME 4LU5L 5C07D 1A4KA 3KS0H 4PJ8D 2R0LL 2NQ3A 2X2JA 1ET8A 1WVZA 4N85A 1K9TA 3BD5A 5AW3B 1B0RB 3HNTH 4KXZH 1JXFA 5E99H 1R0AH 1TCRB 3CNKA 4CL7A 1U8HB 4C54A 3ECBB 3I9GH 4FG2A 4GRMA 4YHLH 3NGBC 2QTEA 3DROA 5DGQA 2UY6B 3QEQE 5HDBF 4WWKC 5F0PB 4JRFA 5A2JH 5E08L 2CBMA 4FTVA 4MS8D 2CRIA 4LVNB 2AK1L 1SVCP 4YSEA 5EIIG 1WFUA 5IM7B 4FAAB 2DQEL 4QHKJ 4DZ8A 1M3IA 1RZGB 3F58H 4NIYE 3T0BA 5I1DA 4Z8FL 2A6JB 4CRPA 4FXKB 3SE8L 4UQ9A 3EJYD 3FT9A 5GTIO 1A14H 4MSWA 3RHWF 3MRKB 2VXQH 3GZQA 1Q90A 3UPAA 1VFBA 2IGFH 5C07B 4N2NA 5I0WA 3IFOA 1MCSA 5C9KA 2VQUA 2NPLX 5A2FA 2NY4D 3E3QE 3NCMA 4U05A 4UMGA 5DRZB 1HESA 1DBJH 4IRSA 3KDPB 5FW8A 3U6RA 4PGZA 4GKNA 4O4XA 1AKJA 1EZUA 3TJHD 2ARJQ 5D7JD 4NUGL 3V0IA 5IMOA 4PD4J 3L4XA 3QRGH 1BFVH 3L4UA 4HGWB 4WO4A 1PLAA 2E8YA 4P3DB 3VXME 1GYWA 5EU4B 2LLLA 5AENA 4MA3A 4M00A 3KPRD 3RU8L 4TSCH 1BG9A 1JNLH 5T3XE 4QJ5B 3U4AA 5KUKA 3DTXB 5DS8A 1QTPA 3B8SA 3NJKA 2RA1A 4UI2A 3RJQB 5SWSD 1AS7A 1GIGL 4EOWH 3N9GH 4Z7VF 3AA0A 1F3JB 5L2KB 4YZFF 2DJSA 1IEHA 3RVXC 2B20A 5KVEH 4RMSA 1JXKA 3ULVE 2CGRL 2GQHA 4G9FE 4KK5C 4QR7A 4OFIA 3LKQB 4TNVF 2XWEA 2H0FA 1PYWB 4NWUH 1JK8B 3IFLH 3BUYA 1FORL 3ET9F 1GR7A 1LEIB 1RK0A 4F57L 2XQYA 1DBML 4GO6B 5KOMC 5B7EA 2EVJA 2EIEA 4TSBL 2W91A 4YAQB 4HW6A 4F5CE 5D2LF 5DD5H 3SDYL 2GTWA 1I82A 4FFYA 4Z0XB 5EIIA 1Y07A 1E2ZA 5I19L 3O0RL 1AGEB 1LO2H 4F92B 5MEQB 2BOLA 4N8CH 5D1ZD 3VDBA 4QT5B 4UILL 1C7TA 1HYSC 3O11A 2YD8A 4YDKH 1CB4A 4JFBA 2FQFA 3VFSA 2VN6A 1VSCA 5IMLA 3ATBA 3JTTA 5D9SB 2EDBA 1FVDB 3IDMB 1HHGB 1BQSA 1U95B 4WKXA 5IOPB 2XN2A 3KL0A 5JPNA 1ILSA 1UWFA 1USZA 3EG9A 3CG8A 5FA3B 2EQDA 3QFDA 4L9LB 2Q1EA 2FO4B 3GSNL 5HDRA 3BYTA 3RWFB 2I60H 4DVBB 3RJOA 1ZE3C 4F7EA 1USQA 2X4PB 1ZVYA 4KAQL 1YUHB 2DLIA 3MUGB 5J13B 3O6MH 2C9AA 2B16A 3SBQA 1M6UA 5JQIB 2RQ8A 3J2PA 1DBKH 2OZ4H 2R2CA 3KZIO 1MVYA 4WY7L 4XH2A 2GFBA 3V4LA 3WO3B 1ES0B 2ZXBA 1WZMA 3H9YA 2VJXA 4FG6D 2CXKA 3HE7A 4OT1L 4S10A 1ZDQA 2J21A 3OR7A 3ZE2F 1I75A 2VZVA 3GM0A 2ZYIA 2SODB 4CGUB 2EVGA 3VTAA 4TN9A 2VXUL 3BPOC 2PCPB 4JN2B 3QZWA 4NZUH 1INDH 4A6YH 2B59B 3OHMB 1C8QA 4ZX3A 4LCCA 4MJ6A 1FE8H 4P06A 2ICWB 2QVMA 2BP3A 1A4KB 3HG2A 3OTTA 5KUMA 5T3ZE 2JLLA 2DRUA 2BSRB 5D93C 1QBMH 4LSTL 4X5WB 1TFHA 3AWEA 4HIEB 3POQA 1IAIH 3ARXA 4AEHH 2QDWA 5FUZL 4HBCL 4U3SB 5IJVB 2Y69B 4NJ9H 1UH4A 1ADQH 4ALAC 1E90A 2CUMA 3HE6B 3TO4C 5D96B 4FFVC 3IDYB 4LCIH 2P8LB 1FL6A 4MLIA 2BIIA 5EN3A 3T2NL 3U83A 5FK9A 2CK2A 3BSZH 4ETQB 4YHPA 1RIUH 2X0UA 2V2WB 3A6BL 4DZ8B 5AZ2L 1NOLA 3V2AR 3FUDA 3MJ7B 4G80A 2CMRH 5GRXG 3AXLA 2XVBA 1M9WA 3BH8A 4Y4KC 5IB2B 3C5ZC 2CM5A 5DUJA 4J28A 3T1FA 4K7PX 1NGPL 1EJOH 1QSEB 4MTMA 1IGJB 4FRXA 2FBRA 1QEXA 4P9MH 4R4NC 5C0BD 1QJ8A 2WBJB 1E50A 3RIAF 5JPMC 2H41A 3AW5A 4G72B 5HI5D 3T0EC 4WHDA 2VWEE 1HSBB 4YEEA 3TEUA 3QO1A 1KB5A 3QUMA 3N0PB 4MDJB 4RAVA 3KZ8A 4PWIA 1ZXQA 4C4UA 2VR9A 3KH4A 1C12A 5JHLH 1EWHA 1UJTA 5KBKA 3CUPA 3ZKND 2O5XH 1U2CA 4NXSA 2VYRE 2XTSA 1H3TA 4YSTA 5BJTB 2X09A 4LPVA 2XNAB 3FRUB 3ZMNA 2B39A 2YN3A 3QUXD 4IOSA 1HXMA 1JGEA 4HP5A 4NHCL 3QO1B 3QUMB 1T80A 3PDOA 4KGJA 4PJEE 2QL1A 1GZHC 3TT3L 4I9WD 2GJ6B 4ODVH 2BXYA 4JUTA 1H8OA 2XPZA 4PYGA 4KXAA 1XSOA 1CFNB 3LZFL 3OPZH 2ZUWA 5B38A 5FFGA 1OB1A 1MJUH 2MHAA 4GUCA 3F2LA 1A7RL 3ML8A 15C8H 1YMMB 3MGTB 4FS0A 3OB8A 4H44C 1KTKE 2R69H 3E8VA 4DO6A 3ARQA 5CBAB 4GAYB 1A3RL 1MJ8H 5DD6A 2H26B 1XR8B 3ZE0F 1W2KT 1YJDL 4QIRA 2OMVA 3MV7B 3MMEA 4YOKA 4MQ7A 3O4LE 4ZDHB 3E2HB 3H54A 5I0XA 4U1IA 3DURB 3HG4A 1N64H 3ZXAC 2MNHA 3DGGA 1J0IA 1MH5B 1JI2A 4PJAA 3DROB 5MEQA 2EXSA 3JV6A 4HK3N 5LN8A 3EFFB 4XPBL 4HKJA 2E9BA 1AZVA 1OKEA 5BVPL 3R1GL 2FD6L 4MJIA 3SE3A 1E4XL 2QQNL 4Y16B 3CD4A 4FQ2H 2BOCA 3KYAA 1E43A 4HX1B 2FWLB 2UY7A 1IGIL 5CJ5A 1TETH 3ZHDA 2WXPA 3BAWA 3ZE1B 4M1GL 1U8OB 5ALBH 5DK2B 3K6SA 4UOJA 2Z7UA 3VO0A 1N6UA 4MB5A 1FHNA 4OM1L 2LFGA 5I1LB 2L0DA 3ZMEA 2KL6A 3QQNA 4U6XA 2ARJA 3T77B 1MFNA 1NEZG 1L7IH 4NQDE 5CR8A 2WLKA 5T1KB 3TM6A 4WV1A 1YMHA 5L8KB 2WINA 4LSVH 2VLKD 4E41E 2V3EA 5EE2A 5HYJB 3K6SB 1UWEH 4FHBD 5KAQF 2WQ8A 2C8NA 4G71B 5JMOC 1IBHA 3RPKA 3VI4A 1QWNA 4MMZA 4OZIA 5CJBA 1RZ7L 4JHBA 1D9KD 4ODWB 4GQZA 3PNRB 1JGUH 4GXUM 4DNLA 4JCHA 4TQIA 1URZA 2XE2A 3DTXA 4OM0H 4NPJA 1HZKA 2FWOB 4YSCA 4PJGE 4ZX5A 4AYFA 1KENL 3HCVA 2GCYA 2P48B 4QNPF 1GGBL 3VI3E 1WBYA 1QR1A 3F7YB 5FWRA 3FSOA 2XU9A 1OAUH 4NENB 5BRZB 4LIQE 3H3BC 2VLRB 1QJ9A 5FYJU 5BZZA 1KGJA 1T4KA 3P0YL 5IEKA 6PCYA 4Y7OC 2VLLA 5D7KE 1IGTB 5I1EL 5AWNH 4MWFB 4DEWA 1H3VA 5F1NB 3FQWA 3MNWB 4FHKA 4EZLA 5IHUH 5E2UL 3P2TA 1BZDA 2C9UA 4MFHA 1ZAGA 3U48A 4HVBA 2FSEB 3VM7A 2XE3A 1JXGA 3MNDA 3MREA 4U0RB 5CJOL 4DP9X 2ZJSL 1ETA1 3OX8A 4Z7QB 4MWFA 3O8XA 4JY5L 1VEPA 3LEXA 5SWZA 2YLKA 4P59L 5IB2A 4I13B 4PP1C 3NSCA 5AYUL 1A64A 3VA2C 2D31A 2UVEA 2A2QT 4U1GC 2AJSL 1E27A 4PS4L 4O3XB 4RAVB 1OM3H 1T1XA 4GSUA 2WYZA 3PJSA 4LL4A 5E56A 4JRYD 2VCOA 3P3YA 2FECL 2JFCA 2YUWA 3DXAB 2RCSH 2X05A 3SJVE 4KQ0A 2PP8A 5ICYB 4RDQG 2FJHA 1SXCA 2YD4A 1CDGA 3DK2A 1NFDF 1EJ8A 1K4CB 2B3IA 1KXQE 4CMMB 4OZFA 5CJ8A 2CO7B 4K3DL 4MAYA 3C60B 2R8SL 4ABWA 4FQ1H 1W72A 2YWYA 4NQTA 1F6AB 3ILEA 3NIDB 4YL9A 4Z7OB 4Y2OB 5JIHA 1WZ1H 2VO5A 1PPIA 1ZS8A 1KZQA 5IVXA 3VAEA 4OGYL 3RGVB 4O4UA 3MRMB 3H55A 3EOTH 4UUJB 5EN2A 5B3JF 1MF2L 5CILH 5KSAA 4OD1L 4DN3L 2ADYA 2NXYD 5BV7B 2OP4H 3STLB 5B1CA 3C9NB 2OR9H 3DX6B 1Z1WA 1CC3A 3OZ9L 4YSDA 2HWZL 4JNXA 4KJWD 2KMWA 3WLBA 1PLCA 4TNWF 5B1JA 3WTUA 1GTNA 2BJML 3CSBA 4GRLC 4H8WL 3CMOL 2CKBL 3CVCA 1NBVL 5KYNA 2IH3B 3DV6A 3KR3H 1HXKA 1J5OH 3PAUA 2DF3A 5E9AA 4XPAL 3L1OL 2R59A 2Y6SC 3V8CA 4Y88A 2BOCB 3TT1L 4K73A 5CFHA 1FF5A 2WUBH 1ZGLM 4JZJA 2O61A 4N0RA 3IDGB 5DMKA 4ZXBB 2XN0A 5G26A 2X9XA 3S37X 4J3TA 4HWUA 5GSVA 4KMQA 1W16A 1YEDA 3VWJB 1AYRA 2ZONA 2P47B 3FUIA 1NC4D 2GKIA 4LBEA 3AA0B 1F3JA 5JUEL 2AGJL 2WBJD 4QNPE 2PPDA 3U7YH 2ITCA 4Z7VB 3V4PH 2VLME 2VN4A 1LD9A 4FTVE 1MCOL 5GGUB 2G3XA 2WTRB 4ZX4A 4MDJA 3WFEL 3ULVF 1JS4A 3U4BL 2J5LC 1JDAA 5D7IE 1ODUA 3EYOB 4WO4B 2GSMB 3EOTL 2XQYK 2VRQA 2WC7A 4S2SB 3UGEA 1FHGA 1F00I 1F4HA 3ZQXA 1ZMYA 1MI5B 2JCCB 4UOZA 3P30L 5EWIL 4UIMB 3BWUC 3HHRB 4E9QA 2DAVA 3CLEL 2YJLA 1OSZA 2CNZA 3FW6A 1CD0A 3ESOA 3PV6A 4PG2C 3BGAA 2DQDL 3U30B 5E1GA 3WEXB 5DJAA 1RJCA 1ZLSL 1KCBA 3A24A 1HJCA 4M29A 3A0BO 1H15B 3PWNB 2VLRE 3F3HA 3ZQ9A 1U8CA 2F7QA 4EUPG 3DSFH 2VDNH 4N2IA 4P2YA 2WXOA 3IKCA 3RGHA 4ONGL 5J4MA 1KBWA 2CG9X 2MCMA 1C1EH 5E4IA 1UGNA 5JOPE 4EUPA 4LDEB 1RL1A 3MJWA 4X6CA 3I84A 4M61A 3DUUA 2AK4E 4YXHH 4X6DB 2L3BA 5K59F 3GMOA 5I9QB 4F8OA 4F27A 2PXYD 1A6TB 4OIBA 5ISZE 1AGBA 1VRSA 1NAMA 4JO2L 3CXFA 2C7UA 3BMWA 1MQ8A 3O0RH 5J1SC 3IFPA 2FT8A 4WCYH 3MBWA 1E3FA 4L1LA 4K5LA 5SWZB 4JY5H 1CD1B 5ABDE 4MYPA 3BQVA 4GG8A 3T1FB 4Z3TA 1GGCL 5CZXD 4D7PA 2ZOLB 4ABUA 2G75B 1XSKA 4AYGA 1KGUA 2AJ3A 2WWOA 3KAAA 3ZHLA 3JUZA 1IEBB 1X44A 4B5EA 2NXYC 3HZMA 4MQXC 3VWJC 4CADB 1SM3H 2DL9A 2HZHA 5MERB 3KPSA 4RBPH 1F4XL 3L3DB 4RWHA 3RIAK 3BE1H 1O75A 5I8EB 1T03L 2P9RA 2BC4B 2GEEA 4HIEA 2A73A 2R2EB 2JWYA 1ML0A 4GKZB 4BEIA 2MIZA 4MNQD 1FL5B 4D8OA 4RJWA 4NCDA 1QFUH 5B5EO 1YEIL 1ET7A 5DYOB 2K78A 5ECGA 2F18A 4DEPB 2ZCHL 2VLKE 2QSTA 4H8HA 3GHBH 3MLZH 3PDGA 1SYVA 4LAQH 3KYMA 3RIFK 4GMSH 4TVUA 4MX7A 4RAUA 4XNYL 2O5YH 3Q5YA 4JFEB 5EOCJ 3V5DA 1T66C 4UM9D 3CDCA 3JZ7A 4JANA 4F9PC 1AACA 1YMMA 4AT6A 2O6DA 1BZEA 1CWVA 3EGXA 3H9HB 4NN5C 4YHKH 1NKGA 3FOLB 1DL7L 2IWKA 3RDTB 3BDYH 4FFWC 5JPNC 4MAZA 1MF2H 1RZIA 3MTRA 4Q52A 1GGIH 4LHQB 1XTMA 4DETA 3KLQA 4H8PA 4DKFH 5K9QI 3QRAA 4EE2A 1J10A 1Y18B 5KSBE 3ILQC 5JW4R 2AHIA 1HAWA 3ARFD 4WK4B 4XPTL 5INCA 3ARGB 1YAZA 4D64A 2J1NA 1PRNA 5E8NB 3FZUC 3QI9B 2B4CH 4PS3A 3SYAA 2F9BT 3UMTA 5DVMA 3V5KA 4RGMC 3QISA 4XVUC 3O6FA 1ZHLB 2F1CX 3D85D 1BJ1J 3ARRA 3SODB 1Y7VA 3GS0A 2WBWB 1Q9KA 1RUQH 4L8SB 1L5GA 2OI9C 1P4TA 1YEDB 5EOCL 2EUVA 6PAZA 1PD6A 2ERJB 3L3OC 4XMWA 3O9WD 1IKNA 2VRKA 4ZOCA 4FUVA 4KI5C 2BNQE 3DJ9A 1S6NA 5KSUA 3KLHD 2WXMA 3G6JA 2XV6B 2CHNA 12E8L 4KRPD 4G1MB 4J1UA 5F1IA 4ZFZA 5D6CA 2BY0A 2J1WA 3KXFD 1XEUA 2XG4B 4K2UL 4CUCA 1OANA 1SOSA 3O2DL 4LK4A 4N1EA 4PJIE 4UTCA 4XVJL 4JVUA 2D4DA 3MYJB 3RTQB 5KSBA 2EDJA 1SOKA 3D0LA 2Z92B 4Z3JA 4ES9A 2Z0BA 3QZBA 3L7EB 3L4TA 5EF3A 1RMFH 4QJ3B 4QXUL 5DD3L 3MVSA 1NM4A 2FLBT 4NBXB 2FYYB 4J3OD 3ML9A 1TKWA 3CDGA 4DO5A 2X70A 2EC9U 3GKZA 1W72H 3HS0A 4UB0L 5E23A 4BQBA 3K19A 3ZZ1A 2DYPB 4IDJH 3SB3A 1FG9C 3WFEH 1PG7H 2HKHL 1YY8A 4MJIB 2HUEA 5DHVB 4BWTA 5DJAB 3TEYA 4FQXC 3T0WA 4POYA 5I66A 3GZOA 1ACYH 5KVGH 1I4FB 1JF6A 2YA2A 4NENA 3EJQA 2IGLA 5C0IA 4BFIB 3AG1B 3KCPB 2KYIA 4OFDA 3QCTL 4PRNA 1M7UA 3WIHA 3WL9A 3G04A 5F1NA 2A6DB 2ZXCA 4LPTA 1KXTB 4A2HA 1TSRA 4AEFA 3MCYA 3HE7B 1BZ7A 4XVOA 5K33A 3ULUC 4B9PA 4YGVA 1MXDA 1IBDA 1T0OA 1W6LA 1ZVSA 3IMVA 2CHWA 1ZLSH 3TNNB 1BVKA 5L2KE 1SLWA 4FYTA 3EAKA 2OYKA 3N41B 4NEHB 2B5IC 5FB8A 3M8OL 4ZTOH 2VDMH 3FTXA 1TTGA 1UENA 1ZRUA 4IRSD 3P9LA 1SFHA 1E0OB 1A3RH 1ASOA 1NJ9B 2H1PL 4FEIA 4GQRA 3RWHB 3FU8A 2OQJA 4NRXA 1D9KC 2JJSC 4JR9H 1CLYL 1ZVSB 4KRAA 5DWUH 3Q1EA 4FSPA 1W15A 4QHMB 5GGTA 5GSVB 1S7SA 5KZCB 3ZUCA 1EMTH 1JTOA 3UX9B 5B4MD 3CK0H 1U8OA 4XNDA 2CK0L 2VDLL 3N41F 4RRPA 4D0BB 2VXTH 5I16B 3ECBA 4DAGL 1IIIA 4B50A 1L3WA 5JW4Q 2DQUH 3H53A 4GKLA 4UMSA 4E1SA 1AHKA 3NJFA 4Z7VE 1YQVH 1DUYB 5IV2A 2R9HD 3ZIYA 1B4RA 4LASL 3WLWD 4KK9D 1M4KA 2VLJE 2H32H 4BXSV 4LSVL 4JVPA 4NWTH 4C58B 5I24A 4IL6O 1WP6A 5ALBL 4GLRI 4PVMA 4J3BA 4N24A 1IJNA 2YO3A 3AXLB 1F45A 1ZPUA 3BH8B 5IV2B 4PCTA 4WRLA 3VXPB 3V6OC 1PJ9A 2QGBA 3O2WL 1VERA 3G6AA 3P0VL 3JTSB 5CEYA 1THCA 1FNEA 3PHSA 2DWDA 4YPJA 1KSRA 2VDOH 2VN3A 2FHFA 3FT3A 4N2KA 5DGRA 3S35X 3BPOB 4RNRB 3MJ6A 1MDAA 3ULVL 2ENSA 3OKEA 1E8WA 5GHWH 4KKBC 3CN1A 2GJRA 2CGRH 3TIDA 3MRFA 1T5KA 5AOMA 1A3LH 4K55A 3LTVA 2WGXA 2C4XA 3Q3GB 1J88A 2FBJL 1GYAA 2L7QA 3X3GH 3T9WA 3WN5C 1QWHA 5B21A 4UT6A 4XTRD 3J8F7 1NFIA 2Y06L 2FT7A 4PJ6A 2OSLB 3UTTA 3IGLA 1A7OL 1DBAL 5B1AB 5IVNA 3VY9X 1A6TA 2XX0A 4DGYL 1F8TH 1WUZA 3QDMA 4JFED 4MKTA 2JCCA 4LPXA 2CR6A 2V9QA 3NZHL 2OCFD 1MELA 1KB5B 1NEZB 5I1EH 1T6VN 4F33B 3BI9X 1YS5A 2VXVL 1Z7JA 3OR6A 5C0DB 3ULUF 4KO5A 2K7QA 4JFZH 2WWKO 1QR4A 4YSAA 4FQXB 3C08L 5C7XH 5IBTH 2WVTA 1F0LA 3HI1B 1T0NA 4TPRH 2P24A 1TQTA 3OPUA 4L3ED 2WJQA 3GK8H 1AZUA 1J0ZA 1DUZA 4KDTA 3ZDZF 3CN0A 4K2UH 3CH8A 1ZLWH 2QGDA 4XO8A 1UKQA 5TE4L 1EERB 5C0EA 2ZSWB 4QDGA 3UACA 2IANB 3FSVA 4WZ9A 4Z3IA 2MCAA 3EJZD 4LLDB 1PY0A 2FGWL 3CDYA 4FZNA 4QHPA 2GY5A 4U9CA 3QIWC 3EH5B 3EMNX 1XF5A 3QJXA 1CLZH 4GAYA 5DD6B 3ZTNL 5I1JL 4L4VA 3S37L 2VTFA 5HY9A 1XGTB 3NSDA 4XN5A 5IVOA 2E56A 3HN5A 3KW8A 3NCJL 1D5MA 1OQOA 4WDIA 1S3RA 1PD0A 4AQEA 2H9GB 4P2OB 1NLDL 5CKAA 1K5WA 1ETB1 3QNZB 4FQIL 1KYAA 3AQXA 3EW3B 3QQXA 1YCSA 3IETB 1YY9D 1T1YA 2AP2A 5CF3A 5GPRA 4JFUA 1LEGB 5E5RB 4QRPB 1YECL 3QDJB 1E4KA 3QNYB 1ZLEA 4O49A 1TTAA 2YAQA 2C7UB 2X9ZA 4DP8X 4Z7WF 3AAEB 2BP0B 1FZOA 3IDNA 4NO5B 1RULH 2OQJB 2OMWB 1OP5K 2XWBA 5CINH 3L3KB 4F8QA 1G6VK 1BJMA 3RHWK 4TUJA 2AQSA 2GSIA 2GAZB 4TRPL 3WE6A 1YEEH 5F44A 4BKLA 4N1HB 1TTUA 3RDTC 1FZOB 3IDNB 2AXTO 2EYTA 1IC4H 3QDHA 4HPYH 4Z7QE 1DQQA 1KJMB 3NCXA 2BIMA 3KHOA 4W9JC 3D4GA 4DK6A 2FIRT 3MGAA 4LKCA 4I9XA 4JFSA 2NQDA 2VUKA 4LVNC 4KROC 3RILA 4F57H 3W11C 1WA2X 1VEOA 5CCGE 2ZUXA 2VDQB 2HJLA 4AM0B 5ANME 4PJIB 2IQ9L 4ZS7L 1KY7A 1T3FB 3GI8L 3HC3L 1NBQA 2GBUA 3QCVH 2VDLH 1PBYA 4GKSA 1IC1A 1E4WH 3LVEA 1CICD 1S9KC 3EH2A 1AHWA 3MJ9A 43CAB 1NCCH 4JFEA 3KYKL 5D70L 4DTGH 2W5PA 2ZWZA 1UHVA 3HS0B 4JFHE 1URLA 4KHXH 1LEKB 3NEEA 4N2LA 1T3FA 5ID0B 3GXNA 4FQCH 3CLEH 2AAAA 1PU0A 3MGOB 4O3YA 3EH3B 5TE6H 5FGCB 2X6BA 3PL6A 2H3KA 2AW2A 2NDFA 4L05A 5IQ7H 4AK2A 2CLRA 3ULAB 4L23A 3V9FA 2NT1A 5F9WB 2OTUB 4KTDL 2W9EH 3T0XA 5IF0A 4L4JA 1EHLL 3S9DB 1RULL 1HXMB 4XXWC 4X98B 4OV5A 3FCGA 5D6CB 5CUSH 4HS6B 1S9YA 1W8OA 4KJYA 4YHNA 5B7MA 5IJCC 1KG0B 2JTYA 3PP4H 3QAZC 5D4JA 4Z0BL 4MA7L 2PWGA 4XP5L 3FO2B 4YXHL 1KYOJ 3IKKA 4U6VH 5I2IA 3K6IA 1JCKA 4BJLA 4DERA 1JIBA 3C87A 4U1JA 2WJRA 5E94A 1KB3A 1S9YB 4KJYB 5ESQB 3BAYA 5I17B 4ONGH 1U3JA 5E2TH 1AKPA 4MBOA 3PJSB 4TS6A 2PABA 4XNKA 2H5UA 2PWDA 3PPSA 1KNOB 4JAMA 2Y5TB 4K9EL 4J6IA 5CEZD 5T5NF 1AH1A 4YHMH 4EMZA 4AKMA 4NZFA 2ZOWA 1TLMA 5GRJL 3EDEA 3IBOA 4BFIA 4DK5A 2YXFA 3N40P 4PYHA 1ZSDB 3RX8A 2J1KA 3EGXB 4N2EA 1OP5H 1FFPB 5GRVL 4K7FB 1QSFD 2YAOA 3QJOA 2BHUA 1EEZA 4LOUD 4F4BA 1KNOA 2CCLA 2J44A 1DVUA 1FPTL 1Q1JL 1SLUA 2GTZA 2Y2YA 3GI9L 4OJFH 5DWPA 1ZA6B 3N1QC 2ALWA 2XZQH 2XWJB 1SHXA 4F8NA 3SY0B 5HVHB 5L7XL 4BFJA 2FQDA 3MZGB 4TNVK 1R3JB 4PJEF 2UY7B 5F7WC 2QV4A 1RLWA 1FDLL 2FJSA 2J5LB 1XGRB 3Q48A 4G8EB 5B1KA 5F7BA 4H8QA 3HEIB 3S36L 1MKFA 4PU2A 3P77A 2V17L 4RAUB 2LV4A 1X7TA 5HGBB 3WTVA 2Y3AA 4YX2H 2J25A 4JQXC 3ARTA 4QWWD 3T77A 1NMAL 3MOBH 5FGBA 3GSXA 2F1TA 4PIBA 3AM8C 3G7TA 1T1WA 2F53E 2J1YA 1D5RA 3O8XD 4PWEA 5AVWB 5HJ3A 4G8IA 3TN0D 1HKFA 1DVSA 2NUPA 2ZX9A 3S8WA 3F6LA 5HJGA 1YUHA 3TO4A 3QUYA 4GKNB 4OB5L 4Y5XA 2AK4A 3OSKA 3D9AL 5J1AB 3NJXA 1E4KC 3QQDB 5DO2D 1ZT7A 1HFUA 3CC5B 1BFOB 3UTSB 1ZVHA 4DGWC 2JQMA 3IJYA 3MUZ1 1UYWH 3GPEA 4Z5RB 3TIEB 5CLYA 1KBPA 1D9KB 4OLVH 2MOQA 1FZMB 3FB7A 4QTIL 4HG4K 4CC4C 1E9PB 3FT4B 5D1ZC 2XCMC 2YMTA 2DYPA 3EBHA 1OWWA 4OLEA 2BMKA 4FLQA 2H2SC 2UXGA 3UMNA 3X2QB 5A3ID 1ZIBA 3ARGC 1F5WA 4M61B 2Y0SA 3MC0A 5DR5L 3O4OC 4FGMA 1HOCA 3KLHC 2P42B 4KRLB 2E3VA 3CGTA 1KULA 1A6VH 1O6SB 1JGLL 1WYJA 4NERA 3BN3B 3PABB 4JM0A 2YNKA 2OMFA 5BQ7B 4LP4A 4PJ7F 3VYNA 2XFGB 3ZU8A 1AR1B 2NCMA 1PG7X 1RZKC 4H7VA 4OF6A 2Z31B 4PR7A 3FN0H 1FBIL 2OCJA 1D6EA 3HG3A 1EO7A 5EU3A 1J0KA 2B4CC 1JHTB 5KOVC 3V4VL 3QIWA 1M56B 2X2IA 3HG5A 4FZ8H 4U1GB 4NQCE 3MRDA 1NANH 4HLZG 5I8EA 4CVUA 1KJ3H 3LRGA 3GLAA 3QO0A 5ADPL 1ACYL 5KVGL 5E9DA 4O9HH 1AQMA 4W4OA 3UO8B 1MLCB 1RU9L 2A73B 1XCQB 2VXQL 3ROLA 2AANA 4XZUB 2H4EA 2NX5B 1QFHA 3JVGC 4C83B 3F7VB 3R18A 4Z3GA 4XMUA 3TV3H 1K8DB 1PSKH 3WIHH 3PWVB 2YK1H 4B95C 4D0BA 3HMWL 3DWOX 3MBWB 4F9LC 3NRQA 4EDXA 1CD1A 2J6EA 3SDXE 4NC2B 1UTDA 4O02H 2UXVA 1CXIA 2UXTA 1D5ZA 4LRIA 4ZT1A 3S35H 1CCZA 5LGJB 5KTEL 4IS6B 1NBYB 2IANA 3VXOA 3TWCH 3P9LB 2J6WA 3B7YA 4HIJB 2FR4A 1Z9OA 1HL4A 3FOLA 4I48B 2J73A 1JXJA 2ITEA 3HUJA 3OJVC 4NQEE 3MNZA 1BF2A 4Y9FA 3EH1A 4U3HA 1IQDA 4PIRF 2Y1YA 3I9AA 3IXAA 3QUXB 3ABMB 2IDFA 4K3EH 2IFGA 4NZTH 3PWUB 1OAJA 1XXFC 3UPRB 1SHWA 3FQXB 4A2FA 1KPUA 2WQWA 4L8CA 3J27A 5CLZA 2VMCA 2CK0H 4LP5A 4HK0A 4WUKL 3QI9A 1T5WA 3FQ1A 4NQQA 4HOMA 3MAWA 2BNUB 4TTDC 4KRPB 5C86A 1W0WB 3L54A 1CL7H 3UTTE 3V5DB 1A25A 4OJFL 3O4OB 1DBMH 2YPLE 4JZNA 5I8KL 3V0VB 4TSBH 3AY2A 2HVBA 2OLDA 1FGNL 1CDBA 1N18A 4LGPB 1KIRB 4Z6AT 4NFBA 4YDVA 4MB3A 1N5YH 3L1EA 5DQ9A 3JBG7 1UC6A 1MCIA 5DRNB 2E27L 3EOBB 4QRRD 1PAMA 5EU5A 1LNUB 1GJUA 3RI5F 3ZDWA 1SPDA 2QPUA 3K8KA 5DA4A 1I53A 2GAZA 3WE6B 4AWJC 3RY6A 5EBMA 2FHBA 1A7BA 4PJEB 4NWTL 5GJSL 2OA9A 5EU6D 4DEPC 5KVFH 2K0RA 3W39B 1EA9C 4KITB 2WXQA 1J05B 3KPSE 3PRNA 5I82A 4JG9A 5KANI 1I7UA 1MY5A 4GQPH 2B14A 4ADGA 1HINL 1XF3A 3US0A 2BRQA 4AW4A 3S98A 1TQCB 3DOIA 2XV2A 3NFSH 5TDPB 1OK8A 2WO2B 4PN6A 3ELQA 2VM4A 1YJDH 4F7TB 5HYJA 4LL9A 4F2EA 5EU7C 1XL4A 3D9AH 5F3BB 2P5EE 1PX4A 3T3PE 1UXMA 3QJSB 2BIHA 5DFWH 1CG9A 2F7PA 3NN8A 2PWFA 5GZNA 1R5WA 5AAPA 1N10A 3BKCL 4ZRGA 3TFKD 4MJ2A 1H5BB 1MQKL 1OTSC 3TZVC 4QTIH 2WLJA 2PORA 1YYML 1YPZF 2LGNA 3MGOA 4Y5VC 1L6ZA 2JQAA 3IJSA 3VG9B 1GGCH 1I3RB 3F7YA 4AYEC 1BZ7B 2FAUA 4M5ZL 5L0QC 3IYLW 4JFZL 1QSED 2X53A 2VLRA 3IJEA 5DS1A 5D2NC 5EC2A 3NCBB 3K6OA 3U79A 1CI3M 3QEQB 2AQ3A 2GJJA 5BV7C 4GNKB 4BWUA 3LIUA 5CCHE 1XZ0B 4WJ5A 2JVUA 1AZBA 3D85B 4KK6C 1S7XB 1KLGB 5EEYA 1MIML 2XT1B 3FCUB 2HMID 2WXLA 1IEAB 2ZNWA 3CFTA 4DP1X 5KN5B 4PJ9C 1T83A 3RIKA 1ORMA 1X7SA 3N50A 4KQ3L 4KRNA 3K6DA 1BT9A 4P5KA 3REVB 3U30C 1Z32X 3Q05A 1PFOA 2J57A 3ZZLA 1AOHA 3NACH 1RJYB 3U36A 1CR9H 2D0FA 4KV5E 4KI1A 4ZUTA 2F8OA 3QC6X 4G76A 2HT2D 1PVHA 3FAXA 2O5XL 3CXHJ 5K39B 1KENH 2GG1A 3RDTD 5ADXL 4PS8A 1MCPH 3AXIA 2HT3C 3BDYL 3IAPA 4O2CA 4AL8H 5DUML 5D7KD 1B3IA 3DX7B 2ZP0T 3NJNA 2WJ7A 4UDTA 2YPVH 1F2XK 2B1OA 1S3KL 3L1GA 3VXNA 1AZRA 1O7SA 2QR0B 3QS3A 4HGKC 3PL6D 1S9XA 1U58B 5CLWA 3G9AB 5IM7A 1ZV9A 1KGXA 2CLVB 2EO9A 3PFQA 2AK4B 3QSKB 4R97C 4R2GD 3VA6A 4FA6A 4PV8A 4IOFC 4N2HA 1MSPA 1SOXA 4ZFOL 1QBAA 4JFDA 3UTOA 3LKRA 1KLFB 4DQOH 8PAZA 1TVDA 4PJHE 5CCKH 8CGTA 4NQDD 3O0EA 5BUAA 4JL2A 4XPHL 5I18L 5J3HD 4G6ML 4LSQH 1IC7L 5CP3H 5D93B 3GHEH 2C7FA 4GG6E 2XN9D 3A22A 3KPNA 3MI6A 3PHOB 5H94A 1AJ7H 3GMMB 1PMYA 1GRWA 4DOHB 2ZPKL 4N25A 1DVFB 1JSYA 3D39E 2WNWA 1MG2C 2ZWKA 4TLSA 2HN7A 2A9NH 1GCYA 3QG7L 4MCNA 1XB6A 4YHPB 2NY3B 4IBYA 3R1GH 4GW1B 4ZW6A 1BXWA 2BO0A 1LLAA 1F41A 5F70A 1LE9A 2F53D 4NDMA 4FA8A 1KIRA 1DQDH 2ZXDA 5DLLA 1AR2A 2ADJB 3RY6C 4AKPA 5KYWB 5SX4H 4F33A 1NIFA 2X40A 2I32A 3TL5A 1BQUA 1N9PA 5EU5B 3RVTD 4XB8A 5C0DA 3QEHA 2ISDA 4FFTA 3V52L 3N1GC 5MI0B 5K9JL 3OQRA 4E9SA 1K2DA 2QQNH 5JQ6L 1J12A 2VAJA 1MCCA 4K7PL 4K3DH 5I28A 4KO7A 2R8SH 3LZPA 2VDNB 1HCYA 2IANE 4AK1A 3Q1SH 4ZW5A 2APVA 4HGMA 3OD3A 3EGSB 4NKIL 4QRUA 2Y5TA 4P23C 2HRLA 3QORC 1SRDA 2FEDD 3BO8A 4HDIB 4C4BA 1TVHB 1QLRB 1HILB 2FYYA 4Y9EA 4LHUD 3WMSA 3AFLA 2HA1A 2ZYHA 3KS0J 4FKEA 4LLDA 4TYUA 1E40A 4U3XA 3MXWL 1MREH 2K0LA 1I9JL 4TUKL 5BQ7A 1CN4A 2UWEB 4NO0D 1SUJA 4XAWH 3WS6A 2BJMH 2DQTL 1CXKA 4Q56A 1HI6A 5FO8A 3GJFK 3VRIA 5C2BH 2BP5M 2H6PB 1JHKL 5T5FH 2AEIT 2P24B 4NKDB 3AUVA 2C26A 1UXLA 1OGAD 4NWUL 1DFBL 4UNTA 1DE4A 3QIWB 4WSKA 4C47A 3EJJX 5SWSA 2O5NA 5FLVA 1ZE3H 3VRIB 2X6UA 3DURA 3L8QA 3QHZL 4N8VG 1IL1A 2PO6A 3A6CL 2BNQB 1QASA 5EO1B 4A2MA 1GFPA 3PPEA 1AGEA 1HWGB 1Q9LA 2QPEB 5DJ6A 4MCYA 1SXNA 2HVKB 3AACA 1LO2L 5K9JH 4Q74A 1HSAA 2WZPD 1ERNA 2G2RB 5CLXA 2LU5A 2FL5A 4ZQKB 4AMKH 4YHML 2NUPB 1D5ZB 3QPQC 2AV1B 4LPYA 1LK2A 1CU4H 2WLZA 5DZOA 2L4OA 2X9WA 5BQDA 3QDME 3BCDA 1NCBL 3M1BB 4JQVA 3ZDYF 1MJ7H 1GJWA 4ZUTB 4FJYA 4AYSA 1HE8A 4BQ9A 4LEOB 2ARJB 3RG1C 2XMXA 2XVLA 2DMBA 2Q6WA 3FO9A 5AL8A 1EV2E 1JPST 1AXIB 4WU7B 2W0KA 1FJ1A 1PEZA 1ZHKB 1TMQA 1U92B 3K5RA 2QQLL 4U7KA 1VCAA 3GLZA 4S1SH 1G0XA 4KKPA 4NZDA 4OIFA 3WAJA 3CN2A 1XT5A 2WQAA 1P7KB 4LNVA 4AIZA 3H9ZA 4O3ZA 3QXAA 5F7EL 1V7NL 2VZTA 4X5PA 5BRQA 4HIXH 4DUWA 4ZMPA 4IJ3C 1WFMA 5F8RC 1J9QA 3TBVB 2V2WA 4JGJA 3EO9H 2P44B 5EUOE 1IC5L 1FNEB 3IE9A 1N59B 4UQCA 2EYTB 1T2QH 4KV5F 4EDWL 4MXQC 2JSFA 3UO1L 1H0DA 4AKRB 3UAJC 5I26A 1GTFA 1P5UC 4JANB 5E70A 1M7DB 1MHCA 4F37F 4LESA 3QDGE 2ZSVB 1KPUB 4U1HB 1IGTA 4BK4A 4IK7A 4NJ9L 2R29L 2OTWA 2WO4A 4ZS6D 5TDNA 3ZL4H 5IIEB 3CFUA 3FU7A 3OJMB 4EPSA 5KW9L 2DJMA 2P7TA 4M6AA 5B1JC 1JVOA 3D08A 2ATKA 4HKXA 4EI0A 4N2FA 4FEMA 4MAYC 3ZKXC 4FLSA 1I8LC 2Z93A 1S9VA 1TZOA 3FQUB 1AD0B 1JP5A 1T1ZA 3DX9B 4K0OA 1UKTA 2Y2WA 4PRIB 2X4OB 4CSPA 4I88A 2BVQA 4I0CC 3OWRA 2C1PB 1VGKB 1ZLVK 2R4SL 2PYEE 1DVXA 1ZCRA 4XZ4A 8PRNA 2Q7YB 3V6FA 2EKJA 3UAQA 3W82A 5KN5A 4JO3L 4FI8A 2FRGP 5TFSL 4W9KC 5JUEH 2EILB 3PUUA 4P5KB 5F1KC 4OZFG 2AGJH 2J88H 3SCMB 1MI5D 1E27B 1W8EA 2F8IA 1GXEA 3OKNB 3CVBA 4I4WB 4JY6A 5JW3H 3VFOB 4BE5A 3QEUA 2CCWA 1I1AC 2ADGA 2EE9A 4YDLC 1JMXA 3SE9L 2ZKXA 1IRAY 2UYLA 2XWJA 1OTSD 4HCFA 3TZVD 3DI3B 3VXQB 5DU7A 3QFJB 1SY6L 4UYPA 4L9LC 5FA4A 1V8HA 3MLUL 3FQXA 4FFWD 3IMTA 2Q5BA 2WB7A 5F7HA 3TV3L 5T3XD 4F7CA 3QEQA 4Y19E 1ZD6A 2KZWA 5KVGE 2VDPL 3MA7B 3SJVA 3JWNG 5ICZA 2NLJA 2YQGA 3T4YB 4UNUA 4KOCA 2CLVA 4OCYL 1B4JH 2R0WL 2DWEB 1B9KA 2DDQL 4HCRH 1AXTL 5GRZA 5I6PA 5IGXL 1KLFA 2N2LA 1CF1A 4GBXC 3EUUA 4P5RA 1DSFL 3SJVB 3B2UC 1IKFL 1R1CA 3QUZB 5LG6A 1ZANH 5INDB 2CNYA 4L4VE 1VADA 3LSOB 2P5WD 4RISL 4HZ1A 3WTWA 5HHPA 3HFFA 4EN3D 1YG9A 3L95B 1XQ4A 1DBKL 2OZ4L 3KYOA 4HJ1A 1VA9A 3W39A 3FO1B 1L7TL 1U6AL 2DM4A 1TJIH 2ENYA 12E8H 3VI3F 4JPWL 5HGBA 4APXA 3VI4B 4ATTA 4PV9A 3UTQB 3UYRH 2BVEA 1Q0XH 3HJ0A 3HUJE 4P48A 4ZMOA 2CJUH 5HYQB 1KIPA 1AQKL 4HCIA 4RVBA 1UCBL 4W9GC 4NDMB 2N7SA 4ZUWB 4J7RA 4V1DA 3B1TA 2LHAA 1A9EB 3FTSA 2L7EA 3K71A 3SGJA 3BUPA 5DRNA 2BMKB 3MRNB 3OQ3B 4UQEA 5I1LA 5HJ3B 1UD3A 1X6LA 3ECVA 1JJUA 3IT8D 3CIAA 1FAKT 1KGCE 3P4OB 3CH1A 4H2CA 4PB0H 4RGMB 2H0PA 2AV7B 1U8KB 5J89A 4RETB 1OGTA 5DK3A 4PJIA 3ES6A 2LE9A 5JORA 3RBHA 1IZNA 1P9MA 2DI9A 4NN6C 4P9HH 4LKXB 3DMMA 2Y23A 3HG0A 3RL2B 1MJ7L 1C9SA 4TVPL 1AD9A 4NQUA 1WT5C 3N06B 2DS4A 3TO4D 3ME0A 1OAXH 4MZ3A 3VGAC 3II3A 1XCXA 2UUDK 4JQIA 4EEEA 1HHHA 1LE9B 3FFDB 5AAWC 3BZ4B 4S1SL 3S3JA 4NN5B 1H6TA 3KPPB 3L4YA 2GT9A 1ASPA 1MN4A 4JEGB 1JZ4A 3CCHB 3NP3A 5EORL 4Q97A 6FABH 2Z31C 2VISB 5BUPA 5E8EB 3HC4H 5F6IB 2VIRA 5KVDE 1LK3L 3SGEI 1J1PL 3WXWL 3T3PB 3QP3A 2OZ4A 2HLAB 4BFRA 2G3MA 3WD5H 3KJ4C 3UERA 2OPCA 1NCUA 1W9XA 3X1EA 2CJUL 4KMTH 4X6DE 4Y9CA 2N3JA 1DSWA 2X5PA 4OJEH 3BUTA 2P8MB 3C8KB 3ZZQA 2R4PA 1G5AA 2OMTB 3FFCB 4G6FD 1QMUA 4KK9C 2FJHB 1QLRA 4NN6B 2FNWA 3RVUC 3TP4A 2FGRA 2DMCA 2IPTL 2JELH 2XVGA 2WLYA 3MACH 5F9AC 3VGBA 4M43H 1JPEA 3A0OA 3I6LE 3L5WB 3FFCA 2ZOLA 1QG3A 3CX5J 1X5MA 2WWMD 4NQED 4Y2DD 5TQ2H 2HMIC 3LQZB 3LRMA 4MLSA 1RUKL 4EZJA 2DQHL 3C8HA 1JPGA 4ORGA 1G9MC 2F68X 1S7VA 3FB5B 2OI9B 5CJQL 5PCYA 3O2WH 4ZODA 5I6LA 3FMGL 1BHGA 5FYJH 2VDKL 1NMCB 2ZZUT 3I9IA 4A6YB 3QYCA 3U25A 4UOQA 5EZLB 5DSCA 3GUTA 1RZJL 4JFPB 4IIQA 4JY4B 4ZG1A 1RSYA 1CYWA 5D4IA 2F8XC 3OMAB 3QXTA 2CDGB 1RHHB 2VXSL 5MEPA 4DW2L 1H6S1 1BOGA 4ZFQA 2G2PA 4JN1L 2CBQA 3UAJD 3VE2A 3EYFA 4MD0B 4R3SB 3MPCA 1I7TA 3D48R 5GS2H 1X9RA 3MO1B 3KCWA 2ROXA 3DGCR 2CD0A 3B5TA 5G55A 2V9TA 2ZICA 5BZWB 4M7JL 3WS6C 3JTSA 4PVBA 2FCBA 4Y4HB 3VFRA 3TJPA 2H3NB 4A2EA 3I02A 4NX0A 4Z23A 5HPOA 3QQDA 4EO5A 1IUZA 2Z91B 1PAZA 3M7FB 5TQ2L 3UZQA 4N68A 1IFGA 1RUKH 4N75A 2IDSA 4LSQL 4MYWB 4QKTA 4NP9A 3ETBF 3DARA 2QDVA 3EJRA 5E9DD 2VJ8A 3H42L 2KC0A 1YAIA 3IMUA 2G30A 4FRTA 3FO0L 3HOGA 1QBLH 3CMOH 4W70A 4P05A 3K1DA 2W0LA 4GW5A 1JZDC 1R6VA 1TTFA 3DX3A 4BFEA 3OAUL 2ZUQC 3CWGA 3D25B 4P9ML 1BX2B 3UZVA 3CFKB 4AIEA 1J5DA 1EFXA 3VDCA 2ESVA 1WIPA 2ICEB 5DCCA 3RVTC 3X14B 3EDDA 4X5XB 4XN4A 3MFFA 4UDUA 1MHPL 3O45A 2YBRB 2OMZB 3TVMD 2ADIA 2ILLA 3VU1A 1IM3B 5E4EC 5JA9A 4P4KA 2ZP8A 2VW4A 4GYBA 3ZPDA 2ALAA 2K4WA 4UTAA 3GDBA 2BVTA 2VWEC 4O02B 3TA3B 2IWFA 3GP6A 3EHBD 2R4LA 1QACA 2KDGA 2O4VA 3K91A 1NOFA 1MCDA 3TT3H 2JMMA 5KANG 1Y6MR 3ILDA 4XRCA 1CE6B 2ZCLL 2R1XB 4LAJH 1Y1UA 1RZPA 2OYMA 4JFFD 2ZWNA 4CNIB 1XAUA 4R8WH 4JM2B 5HGHA 3FB8B 1E9OB 3IS0X 1QUNB 1S78C 1TMCB 4IGBD 1EZVY 4MB1A 5B3SB 3DSFL 1UOWA 3NH7L 1MXGA 3L3IB 4L1HA 1X5HA 1XGTA 3B37A 1HCFX 1S7QA 3MU3A 1TU2A 4UDTB 3GXIA 3HG1A 4KROB 3SD5A 2GW5A 3U0TB 3WFDL 1MRFL 2AK4D 3QRLA 1P2CA 3PP3K 3KYOB 1AD0A 1ZHYA 1T1ZB 2VR5A 3DX9A 3T1WA 1N12A 5IK3B 1UA7A 2AQTA 1YHPA 3OMZA 3S5LG 1JZ7A 2PO6C 1QFPA 3VXUE 1RJYA 1WEJL 3F04A 3MNMA 3VI4E 1KF9B 2AS5M 2XTRA 1TQVA 5CMAA 1ZHZA 2MQGA 4NO3A 4Q8BA 1JZ8A 4OD1H 4AQ1C 2WMPA 3DJSA 2HRGA 2YRBA 5CGYC 1OPFA 1EJFA 5E1QA 1SM3L 4WNQB 3II2A 3KYNB 1XF1A 4AEHL 5BPPA 4S1QL 3I3EA 3LIZL 4LMQI 3ZYOA 4GQ9L 5H8DA 3H1ZA 5C0GA 4AGPA 3CDZB 3GYRA 2BOBA 1SNRA 1QRNA 4UTAL 3X11B 4UV4L 3QFJA 4DCQB 5GZND 4P8QA 3OXRA 3T8XB 3C6LD 3HRPA 3TPUB 4M7KH 5IT2L 5HGDB 4PJBE 3K8LA 4HLJA 4UOW0 1HYRC 1SVZA 4HAFA 4KTDH 5IROD 4E1TA 4YLQT 3JWOL 1UA6L 1AIFA 1O5DT 3IGUA 1WC7B 1CO1A 3KVDD 4A2GA 3INUH 1RK7A 3C5JB 3EDKA 3RUGE 3LHPH 4GMTH 3GMPB 3SHSA 2XQBL 3WFDH 2NYYD 3QYNA 2ZXQA 3GTNA 4LIQL 5E00B 4BH7A 4J39A 4EIBA 1FNSH 3G5XA 1A6UH 4DKFL 4PJFE 3UO1H 5C08E 3TJEL 3RWDB 5KYYB 4HISA 1CF8L 4FZ8L 2COQA 1KTLB 3TVMA 3NIDE 3Q3GA 4Z7OE 5KEZA 2Y22A 2IO5A 5CAYB 1XMEB 5E8NA 3AY4C 1YYMH 2YZ1A 2FYVA 1ZOXA 5CBEA 1I1AD 5TD4A 3RA7H 4FYQA 3MLVL 1BQ5A 5G4NA 2D7OA 1C5DA 5EC1A 3TF7C 2YMXH 4G8IB 3ZN6A 1NGWB 3HZ3A 1W0YT 4F2MB 4FYSA 3VG0L 2BS9A 1INQB 1GHFL 1LP9E 1E30A 1JPFA 4YBHA 4MJJA 4N6QA 1EK3A 2WY3B 4IRJA 4F9PA 1ED3B 2FEJA 2A1WL 1BYPA 4UV4H 5HDWA 3PGDB 4K9JA 5SWSB 1BYNA 5AUMB 1QLEL 1O9WA 1E5ZA 1I1YA 4MNHA 1N67A 2DTMH 2GBTA 2AQ2A 2IDQA 2JIXB 1I9IH 3D4CA 3NSXA 2E6QA 5KAQG 1F4WL 2HLAA 3BT2L 4G7VL 5T1MA 3F58L 2YHGA 1TPXB 3B2MA 4YUEL 1D5XA 1TQBC 3QR0A 4I2XB 3NAAH 5E08H 5DL6A 2A74C 1KJ2H 4P2QD 2FLMA 4ZMYA 3VFWA 3GMNA 1I1RA 4PGBB 4AZ8B 1IGMH 5B39A 1IGYB 2P28B 5L4FA 4A7QA 3SY0A 4GJTB 4KR8A 3L9RA 4JGNA 4LSRH 1X6NA 5CFAA 3H8NA 3EOAA 3QRGL 3U1PA 3S88L 5B39B 1T03H 5IUCA 1SGKA 2HKAA 4UB0H 1GOFA 1B9ZA 1IQWH 2DQFA 2AABH 4N9OB 1A0QL 3BEWB 3QDAA 1B90A 4IOIA 3HG1B 5DD0H 3RKDD 3CAFA 4ZQKA 3MLXL 3RWCB 2OMTA 5D1XC 3S96B 4HOXA 1MAKA 4Z0BH 3O2VH 3T65B 4Y19D 5CIPB 1QO3B 3DYMA 3VFTB 1N8OE 3DRTA 4H25B 4A6YA 4C4KO 3VY8X 1HL9A 3M8OH 4ZTOL 3GBML 1N8ZB 2VDPB 4G9DB 2WUCH 3R4DA 3RL2A 3JWDL 2WBJC 5FYJE 3EO0B 3G5VB 3FUHA 1AZNA 4EQ3A 2NX5D 4TF4A 3BRYA 3A3YB 4OBRA 1UWGH 4TOYH 5H94B 4HIQA 4U1SA 1DHKA 1JD9A 4P2AA 3S34H 1ZJBA 3S6CA 3KYNA 4W9ZA 2KBGA 3BKCH 5TDNB 5IIEA 1F1DA 2BSRA 4ELKB 2BOBB 2FATH 5PAZA 4W9IC 2JKTM 4Q9QL 1G9NC 1T20B 3CVIH 1UACH 4QHUB 4EIZC 1V54B 4YFEA 3GIVA 1T89C 2DI8A 3ES6B 1MUJA 2F19H 4NYLA 4OZGE 3A4FA 2NXZC 2GUOA 2WZ5A 3HFML 4Y9GA 4A7UA 1QEWB 1AR1D 4D0CA 4QRAA 4ZMWA 5EUOB 5CD5C 3ELAT 2B8OT 5J6HA 43CAA 4JS7A 3BW9A 2IH1A 3VUAA 4MJ4A 2G5BA 1DQVA 1K2DB 2A9CA 4O2FA 3V0FA 4EUPH 4AE0A 2HLFC 4F1SA 1MREL 4RSVA 3INUL 2KQMA 5AOJA 1SJHB 4I4WA 4JY6B 2VMFA 2XIDA 1YNTA 1SXAA 2GI0A 3BWAA 4L0YA 4TVPH 3OXSB 5HGHB 2FVNA 2H3NA 3EFDH 4OU3A 1KB5L 3SKMB 1WHOA 5JHDA 3CHPA 3Q8CA 2C1PA 2VLJD 4ZD3H 1H3GA 3KJ6H 2PKDA 3GS7A 4XBPA 3RY4A 2J8UB 3FO2A 2N01B 5EA0L 3KPMB 2YRLA 2AJZB 2Z4QB 2ZUSA 3TGXA 3LQAC 2Y06H 4RRPG 1FNSL 1NDMB 3BVUA 4N22A 3WFHA 4I3SL 1ITCA 1CK0L 5CWSB 2YQBA 4JPVL 5D1QD 3QH3B 1V3LA 2DICA 3TCTA 2ICCA 3LX9A 3RVUD 1E67A 5C0NC 3EJCA 4G6JL 4OZIF 2YQ3A 3GO1H 3LRKA 5BW7A 3RIFF 4CVWA 1FZKB 4UT7L 4X0KB 3U7WL 3SGKA 2XFXA 1EFXB 3QJVB 5E0QA 4NKMB 3HFMH 5H37H 4P5TA 1H5BA 4N26A 5EIIB 4N0CC 4MA1C 4QRPD 3BUDA 2GYSA 3RTLA 2ADIB 3LB6D 3ZR6A 2CA3A 2GI7A 5D1XD 3GJFB 1Q94B 3CZJA 4O58L 1QFWI 3ZSSA 2PETA 3LOWA 1AZCA 4DUVA 1JRHH 2XE1A 4YPGB 5E4EB 1E9QA 4WF7A 3U0TA 3DGGB 1J1OH 3UC0H 3RWEA 1E4XI 1U21A 1UJ3C 4PY8J 3U9UA 3HE6C 4PG9A 3TO4B 2ZYRA 1LO5A 5FCSH 1YO4A 3UYPA 3MCLL 4MRBA 4F7MB 4DZBA 5EOQH 4NC1E 1QWUA 4AZUA 2YOAA 5INDA 3LN5A 4J6RL 3ZE2B 1XD1A 3T2LA 4UB8O 2LT9A 1EDYA 1HH6A 3EGDB 2VXTL 2JF1A 3L3GB 1HNYA 5JYMA 3SYQA 3UTSD 2NW2A 4F7MA 4ZSOE 2B5IB 2BS8A 4WFEE 3VFMA 2HPOA 3EDJA 4UBDC 3T0VA 5A6LA 3D06A 4PRPD 4LHUA 3C5SB 3M17B 3TFKC 3T0EE 1GOHA 1VGEH 3WBDA 3OHXC 1RI8A 1Z5YD 4XPGH 5CP7B 1RJLA 1BAFH 3O45B 2OMZA 1QPPA 2FBOJ 3PWLA 3ZZSA 3DIDA 3JT0A 3HW9A 2HFGH 3DECA 1UD4A 2XA8L 4K94C 2IWVA 1MCQA 4B3EA 2XICA 1U3HA 2XJKA 4HHAB 1BBDH 4WI4A 3O4LB 4ILDA 4AKRA 1MFAH 2XZAL 4JPQA 1F4AA 3G7GA 4UT9A 2ED7A 1MCWW 2WMPB 3QNFA 2DBJA 4G2AA 4Q9CA 5C0AD 1WFNA 2ZSVA 1VFAB 15C8L 5BOJA 2AF2A 1IZNB 1LJMA 1UWXH 5D2LB 2OCCB 3BRGC 2QGCA 4ODSL 1JWMA 1KTRL 3BH9B 3M1CA 4B5ZA 2WUCL 3OAUH 1T7VA 3J7HA 4UOW1 3MLPA 2YUZA 3I2CH 3OWEA 5GS0D 1A6AA 3DGDA 2WV3A 1FLRH 3FQUA 3CX5K 3SDDD 5DK0B 1QBLL 1J7VR 4HUVA 1MHPH 1P4LA 4ZTPH 4B9JA 4NAQA 1CVRA 4A1RA 1NUDA 1DBAH 2X4RB 3TH2T 1RMFL 4QXUH 5DD3H 4M48H 4R90H 5KBPA 4WCYL 4OM1H 4IBSA 3UXFA 2COVD 4YDJB 5FW7A 5T3ZH 4EI5C 2NTFB 3QFJD 4I77L 1TUPA 1UACL 2C3VA 2MMXA 5DA0B 2XY1A 1SJHA 3S3BB 3T6VA 5KSAC 3CZKA 4OI9A 1U8JA 1L9MA 3RDJA 2HH0L 3QO0B 4KK6D 5ICXB 1FH5H 5IQ7L 3DLQR 5EEWA 5J12B 4L0ZA 1YNKH 4PGEB 5CHNB 1OARL 3ARUA 5CCKL 1MCKA 4R84A 4DPAX 1L9RA 4J8RA 2H47C 4PGCB 5EZLA 2B1AL 3AG2B 5CUSL 3U36B 4ES8A 4G7RB 1EDHA 1F02I 4MNQE 3D1MC 3HRZA 4OJAA 4UANA 4LLWA 1PTZA 3X3FH 5I5MA 2Y6TE 3LVTA 4YHYB 2HT2C 4NNYA 3GJFH 4OW6A 3EYSL 4N58A 2ZWLT 5BRZE 3BZEB 3VXRA 1MPAL 1YYCA 5KZCD 4HC1L 4XOEA 4NZ8A 5F9OH 2R2BA 3D87B 4OM0L 3Q7JA 5GRWA 4C59B 3OG6B 4LLWB 2HKFL 5L0QB 3NSJA 3IMWA 1JUFB 3NEOA 2E7MA 5FO8B 2YD3A 4X0KA 1LE5B 4QLRA 1QZ1A 2AQ1A 3GPSA 1BQLH 2OMYB 4NUMA 3I6GA 1BZQK 1T7XA 4J3OC 4PJXA 4X8GA 4UAHA 4AQAB 2VKXA 3QNXA 4IRZA 4M48L 2WQSA 3OHXA 5HJDA 3UDWA 3FS9A 2MSPA 4HLZH 4X6FA 4F1ZA 3CBRA 5DJYB 4J3OG 3N3EA 3FBQA 3LIZH 4LASH 2AFNA 5AKRA 3DVIA 4WFGD 2HX9A 4Q6IA 4O58H 1HQ4A 5E2UH 4KK8D 2CKBA 4F24A 4NM8L 2OK0L 4AKQA 2D2CC 5KS9E 3QUYB 2OMXA 1A4JA 1J1OL 1AYOA 4ONOA 3OHXB 4V1DB 5DQ9B 3SDAC 4A63A 4LMQE 4HPOH 2FX7H 1YPZB 1R3KB 2AAVA 3CFCL 1SQMA 3GXTA 3IDGA 4ZXBA 1MW2A 2A77L 4H20L 1KB9K 4Y4KA 2ENQA 1S7RB 2ERJC 4OI7A 3WI4A 1AO7D 4N3UA 4R4FH 1OL0A 3ASOB 1OCCB 2UZXA 2B3RA 4JRXD 4BFKA 1OE1A 1J05A 2AJSH 3G5YB 2OX5B 1XGUA 4ICWA 5HDBE 1PGRB 3O6LL 4RESB 3QDJD 4P3CL 4XGZA 3FQTB 4XBEL 2DQEH 2X9YA 5J12C 3MUJA 4D9RE 1WDAA 3JYBA 3BXNB 5JDSA 4Y2DA 4LF3A 3D52A 3HC3H 1RZFL 3WD5L 1H3WM 4F3FA 4JDTL 2Y0LA 4XC3H 3WNOA 3K0YA 3KVQA 5B4MC 2W59A 3QHZH 2FJGB 4U6HB 3BD4A 1MJJA 3SYSA 1OM9A 1BBDL 1T4KB 5GV0A 3SQOH 3FT4A 3AITA 1D5IH 3MLRH 4K5MA 2W1NA 2X4UA 3CN4A 2Z65C 3GIZH 4YQXH 3UFIA 1M9SA 1BA9A 2A9NL 3AWGA 2NZIA 1T4WA 5B22A 2V5SA 1DLHB 3O41A 1P9MC 2WANA 3HS9A 4U6YB 5FAAA 1OZTG 4C57C 4YSPA 2P5PA 3QUKB 2PR9A 1NCGA 1OCRB 4QRSB 2JNZA 5J7CC 4QPEA 2E47A 5IB4A 1JFHA 1R24B 5F7FA 3S96A 3WS3B 4OLXL 2D31B 3O3EA 2H2PC 3RWEB 2ZWYA 3MRQA 4B9GA 1NAML 4CU6A 3WNKA 5LGJA 2VW6A 4A7GA 4ZOEA 3E6HA 1GY1A 1NAMB 2PYEA 4LQFL 3QUKA 4WW2F 1WZKA 1JNNL 1T1XB 2WLHA 3VH8B 3L3IA 1HSAB 1BEYL 1MWAB 1DQIA 2FL5B 1AQKH 1PZDA 1CICC 4PBWD 2JJSA 2VXSH 5BRPA 3CPLB 3SO3C 3N1FC 3NPZB 3KG5A 4BELD 3NSFA 4JKPL 4P5TB 4N8CL 5FHBH 4C8XA 3PYCA 4GHBA 4NHCH 5IB5A 1QTSA 3UBXG 4MCZA 4TQPA 4XBGB 4K3GA 3QDJE 5HVHC 3WTTA 2A83A 3FHAA 3UG3A 4O02L 2UX7A 3BWZA 1ZS8B 1ZDSA 2XPYA 4XAWL 1D7BA 3BZFB 1MFUA 4RFEB 5AG8A 3VXUB 4DESA 4U49A 5HVFB 1MCHA 1RIVH 4MVBD 4UWQB 3QDGB 1P7KA 4BBWA 4CN6A 5KJRH 2R2BB 5DJDA 3C12A 3WOVA 2AEPL 2WN3A 4S11A 2E9GA 1BMZA 2A83B 5CR1A 5IWLC 1C16A 2VLJA 1OF2A 4XB3A 2K3HA 4KY1L 1LE5A 2X44D 3H9SA 4OGXL 4Y4FC 4NQCD 2X6MA 3FT2B 3STZA 1R5VB 3PUCA 4O2EB 4B9CA 3VD0A 1ZHBB 3N55A 4HK0B 3CFEB 1A5FH 3SEPA 4I3RL 4JFWA 1VKXA 3IN0A 3M46A 4MA1B 3RURA 4WWOA 2IOMA 2WXHA 2HTLC 2ZOTA 5GSRB 1XF3B 2HXAA 1I7RA 1NGWA 4WO4C 1OD7A 3CQFA 4ZMZA 4KMTL 2E5EA 3GXFA 4ZS7H 1A4JB 2LW3A 3IN2A 2QGEA 4P5SA 2C3HA 5ICUA 2WLMA 4P0DA 1G94A 4X7TA 1TQSA 2ATKB 4HKXB 2BSDA 1GSMA 2ITCB 4Z7VA 2E27H 5I74C 2IGFL 5BW7C 2FUQA 3F65A 1CL7L 1BX2A 2IPTH 2JELL 3FTWA 2XC8A 1Q9KB 3OV6A 3IGAB 4L8SA 3FTGA 4QY8A 3S5ZA 1DLFL 4M62H 2EUZA 2XWCA 3LPOA 3WN5A 4E42B 3P4NA 2EYRB 2VM3A 3HLAB 4KNUA 1CVSC 1XGUB 2FGQX 5IREA 4JM2D 5FUCC 2N0KA 1IFHH 2YD9A 2G3NA 2Z8SA 4CTDA 2DQCH 3C6SA 5LAXB 1J8HD 3NH7H 3TC9A 2V2XB 4B60A 4HUVB 2IJ0C 2VDKH 4BRJA 3T0EB 2FIKA 1U8QB 5CU9A 4PCSA 4XCFL 2D03H 4WUUE 2QPFA 4JBSA 3UROR 1V7NH 4WENB 1CURA 1XGQB 3PHQA 4WI7A 3IKCB 5C0RH 5E5LA 4JPVH 3T6QC 5E2TL 4FNRA 4MJID 1ODAA 2Y1AA 3NFPB 4PWGA 4CC0A 1HHJB 1YLBB 2QZQA 2Y5QA 5GRYA 3V7MA 1DJXA 3VFVB 5ICXA 1GZPB 1J0HA 2V8MA 3MLYL 4K23L 5K39A 3WIHL 2GSGB 3D2UB 4RX4D 4NZRL 3AY4A 1MHHB 3DUHA 4BZ1A 1Q9LB 1M7IB 2EDYA 2IOOA 2Q7AA 4W9FC 5ACZA 3LNGA 5IESL 4JJHA 4KK8C 2TAAA 4PM1A 3S3PA 3EADA 4OJDH 4Z95L 3VFVA 3LDBB 3HNVL 3LEYH 3K2UL 3M17A 4JPIA 3TNNA 1HTYA 2UWEF 4S1DC 5FO7A 4H88L 4ZFOA 3TEXA 2RACA 2NTFA 4HF5H 5C0CB 4GI8A 3S36H 3H0TB 2JCCF 2AJYL 4U0QB 2GB2A 1SXZA 1GA2A 4HWEL 5LVEA 3KEDA 2WTPA 1WBZA 4I18C 5LCVL 2EH7L 3VW3L 3NT0A 3RZCA 4UV7L 3GZKA 3QIBD 3LEVL 4N8PA 2ZUUA 1U8HA 2VSKB 1I8IB 4QGYA 1QSFE 3TPUA 4HETA 3WHXB 1T21A 4MCZB 2IADA 4XBGA 4HFUL 5FKPB 1GVIA 2OYLA 2EYSB 3E2HC 4FQ2L 4JRYB 2WPGA 4XPFH 4G75A 2EEXA 3WKNA 4QO1A 3SE9H 3LPPA 1HQ4B 2K8MA 3HR6A 4B96A 2NSQA 2G9HB 5G3AA 1BVLA 1GSKA 1U3HB 1UT1A 3MLSH<