2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Immune system
molecule keywords FACTOR H BINDING PROTEIN
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
1YS5A 3VE2A 4AYEC 2W81C 3KVDD 4AYNA 4O3XB 4O3WA 4AYDC 3HOLA 2W80C 2KDYA 2Y7SA 4AYMC 5T5FA 4Z3TA 2LFUA 4O4UA 4U9CA 4AYID 3PQSA 2KC0A 4O3ZA 3UAQA 4QQ1A 2YPVA 4O4XA 4O3YA 3V8UA 3VE1A 5EE2A 3HOEA 3PQUA 4O49A
chains in the Genus database with same CATH superfamily
1WBZA 4A6YH 2UV3A 5T3XE 1SXSA 2IH9A 5MHSE 2N7SA 2W0KA 1D6EA 4L4VA 5J5EA 2IBGA 3FQTB 4DAGL 4NWUL 3CSYB 4YBHA 3RGVD 2DDQL 1HESA 1OF0A 5HI3D 3GMPA 1B0IA 3D06A 1FO0H 1KENH 3X2QB 3RTQA 3F7RA 2GIMA 3MMEB 3GHPA 4MVBD 1BGXL 4FQCL 1KCVL 4KJYB 1U3HB 2XICA 3OX8B 1AR2A 3MLYH 4KJPC 2D0HA 3CSGA 1KIUB 4LRNL 1XF2B 2WXOA 4QYOA 1P84J 2CA4A 5D2NA 1XMEB 2VGLM 1SHSA 2MCPH 4DVBA 5FFGA 3EYUH 1FH5H 1JTTA 4FZEH 3RGVA 2VLJA 1K5NB 2XVGA 1AKJB 3Q0HA 5CGTA 3FFCA 5EZJB 3RY4A 1QSZA 3WMPA 3A6CL 4PVNA 1M6OB 4PRAB 1CXLA 4H8PA 4F92B 2ZUSA 1PQZA 1IC5H 1EFXD 2OQJA 1IV8A 4WU5A 4O51B 4NI6A 3P1VA 1DVQA 4IMLB 1SF3A 4HFWB 4UOW1 3NZ8B 2AI0L 3O0RH 2CIKA 3I3EA 4OFPA 4P3DA 1S9XB 2Y1AA 2K4WA 3LSOB 4LKCA 5K59F 2JI2A 3RG1C 3RIKA 1V54B 5E79O 2RTTA 2YEZA 5INCA 2A83A 3DGGA 4RWYH 4EIZC 1R19A 4N2IA 5TE6L 1BVNP 3APCA 4NKIL 2K8MA 2ZF8A 3L3DB 3LDBB 3OXRA 3OAYK 2AK4E 4AM0B 4IOIB 2X4SB 1U8LA 3NCWA 1NCAH 2QQLH 3SHSA 5BS0A 4EN3B 1A6ZA 2X44D 4JAMB 4XP9H 1IFHH 2DZEA 1MRDH 3VFNA 2V7HB 3OAZK 1KPUB 1S5IH 1VCBC 4MXQC 1QSFB 2BSTB 4ZO6A 5FKPB 1I1RA 3S4SG 1OE3A 4BZ2L 6FABL 3IGAB 3DPBB 3ZDXE 5EIVA 4YDKL 4QHMA 2X89A 1U8NA 3BAXA 5AKSA 1OM3H 4UOZA 1JWUB 2Y7SA 4PRPA 3CFUA 4L3ED 3C5ZD 4Q6IB 3SZKC 1JZGA 4U2ZA 4AG4H 4BKLB 1FYTE 4GAGL 4TTDD 2R59A 2NT0A 3VWJD 4EBQH 1T20B 8PRNA 4JKKA 4G6MH 3TBVA 3ALPA 1QABA 2AABH 4F2MA 5CN3A 1BYNA 4G42B 4MQTB 2NXZB 2XG5B 4JY5L 4UZUA 4UTAL 3JCUO 4HIEA 3QPQD 4PJFB 4WO4A 4OGAC 4ZFZB 4CRPA 1E9QB 1I4FB 1LL1A 3BP7A 1DQTA 5D1XD 1XGPB 1VFAA 2L0DA 5B1BB 3QH3B 4F15B 5HYSA 2XN0A 4DZ8A 3QUXA 3QULB 3P02A 1AXSB 2F1EA 3CDCA 4P48A 2C9RA 2QPEB 4UQIM 3POCA 3GRGA 1RERA 4L4VE 4XXDB 3AU1A 2XTRA 1L7TH 2UWEE 2XY1A 2ICEC 5I19L 5HDBE 5SWSB 4XNLA 4QTHB 3JXAA 4NC0B 2A6DA 2DQCL 3ME0B 4MA8L 2LVEA 1VENA 2UYLA 3U4EB 4XZUA 4O5LH 3I6GB 4A1RA 3ZO9A 1OSYA 1I8MB 2CPCA 3FT3B 3MXWL 4OZFA 2ADJA 4HBQA 1I1FA 5C07B 2CG9X 3DVGA 4I0PA 1OV8A 2NCMA 2J21A 4UNIA 2R29L 3F7YA 5HHOA 3TN0D 1PF3A 4IQHA 2RCSH 4IKJA 5IFAL 5TK4A 1COBA 2WM0A 3UGEA 2KC0A 4XP5H 3VNZA 5DD0L 5F9WB 5LQBH 1WEJH 1ZVHA 3C5JA 4JFEB 4MMXA 1UYWL 4NUJA 3ATDA 2W8CA 3WU2O 2Y0KA 1D6VL 2FDBP 3LNEA 1QFHA 1T1LA 2KXPB 4WHCA 4B53A 5K9OB 2G9HB 3MRPA 4FXGA 5IIEA 1FLRH 3WE6A 3C08L 4K5MA 3IETB 3D85A 1JYXA 1U8MA 2R4RL 3T2LA 2M26A 2Z3FA 1FDLL 1ZLVK 7PRNA 4ONFH 3V7MA 4LCCA 3Q8EA 4FQLL 4WV1A 1KBPA 2HVKA 1Q9LB 1TMQA 2DWYA 4JRYE 4EDWH 4YEFA 2LR4A 4K9EL 3LQAC 4FQIH 4O00A 4IIQB 5DHXB 3QC6X 4M1CD 3Q01A 4K9EC 3MACL 3HHRB 1INQB 4U1MB 3ZMRA 3GM0A 1ZHNA 5H4YA 4G8FB 4Z5RB 1OLZA 2P24B 2XXFA 4TUKL 5CSZB 4LB8A 2PYED 1QBML 1AVAA 2ENSA 3I3DA 1S3KL 4Y4FC 4ZS6D 1Q8MA 2WTRA 1NC2D 3QZPA 4OZFG 4W9HC 3HFFA 4AYFB 3QJQB 2CJSA 3B7TA 2GE4A 3KLHD 3L4UA 1P7BA 3O4LB 1CLOH 1QZNA 2BS8A 3UPRA 5E24E 3ILEA 4P59H 4QY8B 5EU6D 4EN2A 5IQ7H 3PGRA 4E9RA 4ABUA 3EIFA 3ZE2F 3D48R 4MMZB 5DJ2A 5AFUL 4X6FB 2B14A 2QT6A 2R4OA 3N55A 4MD5A 3CFCL 3M45A 4YXHH 4D7PA 3IJHA 4U31A 3DECA 3KDMB 2IF7A 1ADQL 3F7VA 5EULV 3LS4H 4WNQB 3W9DA 3B34A 1A4CA 1JCKA 4N6QA 1MNUL 2EEBA 4OZHA 2YA0A 3F05A 3KPLA 1QRKA 3MV8E 1HI6A 2ZP9A 3V4PB 3PL6C 3CLEH 2EH8H 43CAA 3HCVA 1XSIA 1BFSA 1FG9C 2Z4TA 4LVNC 1R5WB 1WCQA 3BI9X 4UDUB 1VB9A 4YBQC 5I1KH 4PJHB 4CGTA 3FCTA 1KN4L 1RURH 2C3XA 4JG9A 4PJXF 3SDXB 1OPGL 1U8IA 4Z7WA 43C9B 3J07A 2EDLA 2BNQD 3WUZA 3D50A 4QTIL 5DO2D 1BXXA 1HHIB 2VWEC 4NQSA 1XSKA 3NIFE 1YEDA 4L3FA 5EPMA 3PHOA 2ZSVB 4BFRA 5TDPA 5DEGB 4UOW0 2IFGA 3GMLA 1IE4A 3LKQB 4LLDB 1IAOB 1AQMA 1A4JA 4YHMH 1KB9J 1YPZE 1MQKH 3ZQ9A 3VVVA 3VRIB 4D0DA 2DRUA 2DL9A 3F6IA 1SZNA 4CC4A 2ZAIA 4PCKA 4NQVA 5IB4B 4OT1L 2BSRB 2QTEA 3BUTA 1MI5E 1C12A 2GUYA 2OP4H 1KJ2L 1KCVH 4G2AA 4EIUA 3IDJA 1FYHB 2IANB 2J57A 2VN7A 4HX1B 1BJMA 2HRHA 3KBFA 4XO9A 3WELA 5JA9A 4N59A 4BK5C 1YZZA 4BWTA 1LO0L 1NH6A 3VI4E 5HYJA 1N19A 5D71L 1CLCA 4EZJA 5GISH 3FYXA 1PYWA 2APVA 1IM3B 1NDMB 1PKQB 3RWJA 2DMCA 2OJZL 1U8KB 4U1LB 3VY9X 2X0UA 2DKUA 3OKMA 3SY0A 3ZTEA 3OF6D 3V2AR 4U6HB 3UX9B 1NTDA 3N42B 4WWKD 3VX1A 1RJYB 1KB5H 5IEHB 1NIBA 2BCKA 1BAFH 4DT2A 1S7RA 3O6LH 2ENPA 3DRQA 4DQOL 3FQXB 4K4KA 1YNTB 4DEUA 2J43A 1WZLA 1R9FA 3S34L 3V0DA 1DL7H 1M7IB 3Q43A 3SQOL 1HINL 1FFPA 1UVQA 5I16B 2CHDA 3DETC 1LK2B 3AS0A 2CO4A 1F00I 1IJ9A 5DA0B 3DX9A 3FMGH 1JZHA 5TPWL 3CQPA 1PJ9A 3U6XS 2W65B 1KCUL 3FT0A 2AXGA 2Y1VA 2XVKA 2AEQH 4F57L 1GYUA 4N9GA 3MYJB 1EMTH 2AGJH 2I7SA 2FJHB 1DJXA 2J5LC 2O6DA 4AM0A 4Q56A 4PSPA 1DQDH 3K72A 3ZTNL 1UM4L 2F5BH 3B9KA 3OXSA 4BH8B 1OZUA 4HPHA 3PWUA 2M1KA 1HQ4A 2CJUL 4JY6A 4ODVL 1FP5A 1M3IA 2FR4B 4PGDB 5LCVA 1REIA 4XVJL 3N3EA 4F80A 4Z7UE 3PHSA 1UFGA 4ONGH 5AALA 2DQJH 4ORZC 3GIZL 4WW2F 4MJID 1AYOA 4NBXB 1ZD6A 3LIZL 1CIUA 1WAPA 3MLVL 2AABL 2UXGA 3P4MB 4MJHA 2JJWA 3B56A 1XAKA 4CAGA 2IPKB 1CE1L 4TRPH 4DGYL 1MCPL 4K7PL 1U9KA 4XVSL 3VFTB 1IAIL 3H55A 2EXSA 2GVYA 4M7JH 5DT1L 1ITCA 3TBVB 3WNNA 2NY7H 3ROLB 3AMLA 3EH5B 4TQPA 5SWZB 1BCIA 3V0EA 3M6DA 2WAHA 3LXCA 4Z3TA 3DOIA 4LSPL 4X9FA 2QHRL 1DJGA 3QE5A 2E75C 4WW1B 5IQ9A 2OW7A 4EN3C 5KW9L 2DH3A 2G75A 3AC0A 2D0FA 4V11A 2IPTH 3OQRA 4R7NB 1RI8A 4ELKA 4WEBL 3MLUL 4U2YA 5C2BH 1FGVL 2E9GA 1NCDH 5B38G 4P49A 3QJSB 5FM5O 1W0YT 4PJBB 4QHNB 3QXVA 3RILA 1A6PA 3S8WA 4YHKH 3RWDB 3KYKL 2QQKH 1LJMA 2R1WB 3O4OC 5CJXC 5F96H 1FYTB 2OQJB 3ARPA 4ZK8A 5G26A 1EEUA 2EE3A 2IFFH 2VR4A 3NYKA 5D5DA 4J5VA 4Z7UF 1PEZA 2MWCA 3NZ8A 3ESVF 4OLVH 4P23A 2CAKA 2IQ9H 4BZ1H 2H2SD 2PCYA 4MMYB 2C5DC 5BRQA 2RCSL 3GSWA 1EUTA 1T04B 2KLRA 2C9SA 4PJIE 1A6WH 2R2EB 5DHDA 4NB7A 5EOCL 3KAAA 2GJPA 3P40A 4GQ9H 1CL7H 4JFDA 2LTQB 5DDHB 4XBMA 4XN2A 1KCRL 1J1OH 4HJUA 4GRLB 4AIZB 3RFRA 4R3SB 5C6WH 2P42B 4TUJA 1U3HA 1NBZB 3CFBA 3SGEI 4F1SA 3CC1A 1D5IH 1YPZB 3ZTCC 4AQ1B 3ARZA 2H8PA 4Y16C 2HLAB 2WNXA 3PF1A 1NIFA 2UXTA 5A2AA 4JAMA 3K6DA 1N5AB 1BXAA 1DZBA 3LIUA 5FCSH 3NIFB 4M5YH 3BZ4B 3MNVB 3IBEA 4MCYA 5DVMA 1ZANH 1FG2B 4LCWD 2IGFL 3PXLA 2LT9A 4LARL 1JUFA 1CTMA 4YK4B 1OOAA 1ZHLB 4KJWD 4L2LA 3WKNA 1QMUA 3CGTA 3KPQA 2RH0A 5ECGA 3WY2A 4PJGF 2Y6SD 1AIFA 3WEXA 1KV7A 4V1DB 3RL1B 1MCOH 2BVEA 1FZKB 2JXMA 5GRJL 1DR9A 3BP6A 3RB5A 5MENE 1DP0A 2ZX7A 4UQDA 1S9XA 3VQ2C 5B38A 3OR6A 4ZAKA 1AXIB 1EZLA 1G84A 1PL3A 3NA9H 1JRHH 2IH1B 5HVHC 5EBLA 3FU7A 2V37A 4JDTL 4KHTH 2H0JA 1KBGH 2IANE 1QRNA 2X05A 1TETL 4K55A 4JFDD 3L9BA 4LLQB 1AFVL 4U1KB 1RIVL 1UXLA 3ESNA 3ZN6A 1NWOA 1RD6A 5KSAB 4XHJC 2FGQX 1L5GA 4MAUH 4B9JA 2ITCB 3ARGB 1KB5A 4K94C 4NI3A 2RHEA 3MRBB 3NCXA 5TFSH 4HSAC 5JYMA 1T6WA 3S35X 3Q06A 1FL3B 5AOMA 5CP7B 3UTSE 4YHIA 1X44A 4YXKH 2I7OA 3GXPA 3GNMH 3C8KA 4BSWA 4UT7H 5CEZD 1EQWA 2YAOA 1O9VA 4Y1AB 4PS8A 3MOBH 1GW0A 3E8UH 2IPUG 3FT3A 3WTXA 2ZPKH 3RX9A 4EZKA 1OCZB 5IVOA 3GBML 4EVNB 1OD7A 1Y0LA 4RAUA 1QAWA 3KWWB 4B9GA 4CVXB 4Z6AT 3MZGB 4HJ0D 4PS4H 2B39A 5DD6A 1IZKA 1I8KB 2DQHH 32C2B 3K2KA 5HP5A 5BJTB 5D55A 2VDLH 3W9DB 3WD5L 1W6WA 5LWYL 4ECNA 4X2UA 1WRFA 4GP8B 4X6DA 3C5JB 1YNLL 4Z7VF 4TNVK 1JN6A 1UXSA 4K8RL 1JGDB 2IG2H 2J6WA 4LEEA 4G7RB 3QQDA 2F8OA 3CK0L 3EJPA 4HFUL 1V05A 5ICXA 3HZKA 1AXSA 1I7TB 3MFFA 3HE6D 3O3EB 3SO3C 4FJ6A 3QQ3B 2ZWLT 4UT6H 3NZSA 2IXQA 1CF1A 3UZQA 2H4EA 2X2UA 1B4JL 2OR9L 2NSXA 1RIUH 4IJ3C 4FYQA 2WIMA 4LEOA 1XXDC 2Z93B 4PJ6A 1SVBA 3G5XB 2IDCA 2VL5A 3QWQB 3RL2A 3UC0H 1RH8A 2CO3A 4AEHL 4LEXH 4WW2A 1MPAH 3ZDXF 1YRKA 2IADB 2ZTBA 1OP3K 1O6SA 1JHTA 2YKKA 1CDCA 4E9TA 5K39B 3NFSH 5E56A 3TVMA 4WEEA 5A16B 5T5FL 1KMGA 1GMIA 1FYTD 4HJGB 4JE4B 4ICXA 4X4MA 2BVPB 5HGAA 5TD4A 4ETQA 4KO9A 1UWXH 3EO9L 2EDWA 2WXPA 2ICWJ 5IW3A 1OAUH 3AREC 3C2AH 1KJ2B 5D1QB 4XHQA 4BIKA 3N44B 1J7VR 4RGNE 1LEIB 4AQEA 5DJ6A 2FWUA 3EYQC 5BO1L 1L3WA 3ASOB 4AYBA 3EGXB 3N91A 1MFCH 3SIKA 4JGUA 3FB7A 1RZJH 2CSPA 2G0KA 4ZX6A 5AVQB 3LN5A 2O26U 5F7DB 1BBJA 4DQOH 4X5PA 4GO6B 1IO4C 5KUKA 1D5RA 5CLTA 1RFDL 1O9ZA 1A14H 4UAOC 2NY4B 5L2KA 4B61A 2QR0B 4RAVA 2XRAH 1UWGL 4JO4H 4O2FB 4RX4D 5FK9B 5FV1L 1TEYA 3L5XL 4XXCC 2PMZA 5I5RA 5HDBB 1L7IL 1D5ZA 1HI6B 1SY6L 1CURA 5AAMA 3QEQD 3JVGC 4JKPL 3LRKA 4H5SA 4TOYL 4Z5RA 2F2HA 2DWDB 3BPLC 5F0LB 3VWKA 1AG0A 3ZQXA 4RDQF 4PS3A 1BH3A 3FHAA 1U8OA 3SPCA 4Y4FD 3HI6H 5FOJA 2XWRA 4NUGH 4U6XB 4YX2H 3U9WA 3IK2A 1HSBB 2ALWA 4ZFGL 2ZKHH 2AJSH 3B9EA 4H8VA 4A39A 3H9SD 3VZWX 3BRGC 5I1HL 4HK0B 4YPGA 1FWXA 2H0FA 5JHDD 2A6KB 2OSLA 2O5YL 3SODB 4UQCA 2AJVH 3ZLQC 5KWYC 1DUZB 2EYRB 3D9AH 3HRZA 3PFUA 5C0AD 1XF3A 3VM7A 3W2DL 5I73B 5IWLC 1RZIB 5K5YA 3Q2LA 2KLSA 2HFEB 3X14B 2CK2A 3R18A 5K69A 2JCCA 1T2XA 4JFZH 3WEAA 2QVKA 3MBEB 4IL6O 2N3JA 4NQCD 1NIEA 3T8MA 2CM5A 2YQ2A 3QS2A 3V0AC 3G5YA 5C0EA 3UJTL 5GGTL 1MAJA 2AXJA 2FX8H 3T4AC 2KMWA 1KG0B 1OY3B 3AM8C 3HHSB 4E0RA 3OAUL 1X6NA 4JK0D 3B5HA 5AZEH 4YSTA 2DLTA 2EP6A 2VNCA 4FLOA 1IARB 1SOQA 3KZ8A 3UMNA 3ZVVA 1BJ8A 1CFTA 2CD0A 3AY2A 1HK6A 1BYOA 2DIEA 4G6FD 5EBWA 5HYJB 4PJXA 4IRJA 3NJJA 3FCBA 1KGYE 5GSVB 1OARH 3P4NB 4PGBA 5HHNB 1NCDL 2Q6WB 1B0WA 3PWVB 4WI0A 4Z7WB 3D1MC 5C8JB 4Y4FA 4YN3A 3RP1A 2CNYA 1IM9A 3IEAA 4GCQA 1HHHA 3KBEA 3K71B 3U30C 7FABH 4JM2C 4OSUL 2R2HB 4GSUA 3FT9A 1JXGA 4OGYH 2ED6A 2AEPH 2VDKH 4M5ZL 3TXAA 3QUZB 2IQ9L 4APQB 4BZ1L 3SQBA 1ECYA 1L9MA 1QNZH 1D7BA 3RUGF 3SOBH 4GXFA 4FSPA 2FK9A 3DXAA 4JO2L 1OP3H 4S1QL 5DJYB 4J12A 2LOEA 2BOLA 4A37A 4GMTH 5DCCA 4K3DH 3VTTA 1U2YA 1CICD 3B3IB 4MMYA 1DEEB 3QI9A 1SGKA 1T04A 1Z32X 5DEFB 3WXWL 4D3CL 1KYAA 5IQMA 3KPRA 4F4BA 5IJVB 5DK0A 3G9AB 3JV6B 3SDAD 4QHUA 3W3BA 3KYNB 1O9WA 1BECA 2BY0A 5I1EL 3BAKA 1AZBA 3QUYB 5CINL 4W9IC 3SKOB 4WI5A 2E9BA 1T21A 1G9ML 1BZEA 5CD5C 3JWNH 1UGKA 4HDIA 4UM9A 2WVUA 1IM3A 3WFZA 1CE6B 4Y1SA 3MRQB 4HLEA 1XIWA 4PJGB 4RFNB 3AQYA 3WG7B 1YA5A 2YEVB 5I1DB 3EYVB 3AT8A 3KLAA 4MRCA 4NM8L 3P54A 4YR6B 4BCYA 3MJGX 1UZ6F 1GS8A 3WI5A 2FJGA 4NX0A 4X0NA 5I9QC 4MCYB 4OLZH 2EUZA 1MLBB 1PG7X 4H4NA 4LPXA 1DYZA 2XSKA 1CFVL 2VMCA 5B3JE 5IMLB 3DRTA 3FF8A 3RKPA 4QXGL 4U4IA 2YMXH 4N0YH 1CDGA 3HE7A 1HC1A 3OC5A 2HLFD 5EU4A 3KG5A 2V2XB 3GM8A 5E6YA 4Z7OB 3ULUF 5EF2A 4JDEA 4GKSA 3VXMB 3WTUA 4XPTH 4YHML 3LV3B 4TPRL 3IPBA 1NUFA 4P46B 5MERB 4AFKA 5BUGA 5D2NC 3OR6B 3G6AB 4HCRH 3NTCH 4UANA 5HDQL 4YH6A 1OAXL 2QQQA 4AH2A 2AERT 1MJ7L 4I0PD 1BQLH 3PAVA 5J9PB 2ICWB 3CC5A 5LHDA 5DHMC 2V4LA 4F9LA 3SE3C 4ZAKC 1MFDH 3M8OL 2WXRA 4LU5H 1LHZA 2Y4SA 3MLRH 2OFQA 3VCLB 5A40E 2R9HD 1U8QB 5DRNB 3MN8A 3MRIA 5SX5K 3VVWA 2O4EA 3X3GH 5IB3A 4N90D 2BHZA 3MGAA 5G2NA 3RZCB 3WCYA 2YGOA 3C6SA 3DURB 2D7PA 1TJIL 1E50A 2X89D 4Y9EA 5GS2D 1J05B 1ETZA 3GBMH 4OGQC 1JDAA 1EPFA 5CSBA 5IBTH 4Z7IA 3FL7A 5J8OA 1NCBL 5DRXA 4HKJA 2NXZD 2A9ML 5DHVB 3ZKNC 1YC7A 4PY7B 1PKQE 3J8F7 2NX5A 4HQQL 2OJ1A 3PHAA 1F8TL 2V3DA 4P2OA 4I2XE 5ILTH 2AQSA 4Y16A 2QV2A 3P0VH 2IDQA 4J3TA 1JVLA 3CQFA 1P1ZB 4TUOA 2BVOA 3QA3B 2G5BB 3D85D 2AQ2A 3NCCB 4JRWA 4UINL 3WKQA 4MXVE 1VERA 5D7KD 2QDWA 3TN0C 2WNGA 1XGTB 2MCAA 5J6SA 1PJWA 3I75B 2HJFA 4AQ1C 4LLVA 3PWNB 4RLCA 3FTUA 2D7TL 4MMXC 3KL0A 1I7UB 3GZQA 4NJAH 2PW2B 4X8JA 1CZ8L 3O3EA 4O9HH 5ALCH 3K81A 3UIZA 3QJFB 4O2CB 1YEJL 2IXQB 4AEHH 1UJTA 3T1WA 2OS7A 1T1XA 1S7SB 2ZYHA 1RZQA 3QXAB 3NFSL 2V2TA 1UACL 2J44A 4N87A 4XODA 3WI4A 3FFCD 4DAGH 3QG7H 5I18L 2I24N 2VL5B 4WLCA 1E3XA 4FXKB 3O6FC 3O3BB 1HEHC 2O6EA 1WUZA 4X7SL 3T0BA 3EGDB 3CH1B 5AOZA 2VLKB 1NBCA 4PWHA 4ONGL 3VXTA 5AG9A 1IGCH 4RLBA 3GIZH 5GISL 2B1OA 3B8SA 1SUJA 3IGKA 2PW1A 3BQUA 3SDCB 3UTZA 5EEWA 2NYZA 2AJYH 3CVIH 1S7VB 1T7VA 2BXZA 4ZOAA 4KKCD 1SN5A 1CD0A 2GY7B 3OB0H 1MM5A 4FFYH 3UZEC 4A2LA 1G7JB 1MSPA 3T0ED 5DMKA 3BPCB 5DUPH 1FGNL 4ZSOB 3TEZA 5E9DD 3FHQA 2FL5A 3GS0A 5DD3H 5EO0B 1IGJA 2YBGA 3EJZD 4KMTH 4HJJH 4AM0Q 4IBUA 4FG6D 3FB7B 5KOVC 4ZFQA 1JD7A 4APQD 5KS9F 3JUYA 3SQOH 4RDQG 1ZT4B 1QTPA 3EOYG 1V55B 5AW3B 4K23L 3DTUB 5F7DA 5F89B 4XP6H 3OJVC 3D08A 1NWPA 5JOFA 2DICA 3CBJB 5FB8A 2VIRB 3TA3B 3VQ1C 3AJ7A 4I3RL 5F7UA 5B38B 3EUUA 4A6YB 1UH2A 3VGAB 1UB5B 2BZDA 1QFWI 4Y89A 2J1XA 2XY2A 4LSUH 3BWZA 4ODXA 4GBXC 4U1IA 4Z7VA 1FZJB 4XTRC 2RGSA 5EORL 3UAJD 2VQ1B 2MJWA 1HIML 3L48A 4YGVB 1MF2L 5KSAA 2P8LA 4K5NA 2WLIA 4NZRL 4YXLL 4E9SA 3SPJA 2CRYA 5K1JA 1U2HA 3PGSA 4O58H 4U6XA 5F7FA 3SGEH 2RFXA 2R2BB 1UGNA 2NR6C 5E6UB 5EB9A 1DUYA 1G7PB 5FDWA 3TCLB 2IAMC 2R0WH 4GQPH 4DK5A 2W38A 2LV4A 1PSKL 1II4E 3LRHA 4JGNA 1PG7W 1JGUL 3DX3A 5DT1H 4EBQL 3OMIB 5I66A 1RZJC 2VERA 3KYAA 2FBRA 3LEVH 4ELMA 12E8H 4KROC 1JK8B 1EFXB 5L9DL 5B1AB 5B8CB 1RJCA 1TTFA 4R96A 4RGNC 2AQRA 1LO4H 3TZVC 1BQSA 2FZ3A 4GNKB 4HEME 1EAPA 3OVUB 4FFVD 3VJ6A 4FULA 5K9KA 3ZHFA 1UOLA 4L3CA 2QVTA 3MLZL 3H7LA 2Q9OA 4WI3A 1XH2A 4BH7A 5KJRH 3N41B 5CIPH 5AKVA 2PF6A 5JDJA 1X7QA 1G9NL 1T0MB 2J8UB 2QQKL 4S2SA 1ED3A 1FSKB 4OM1L 1ETJA 1AOZA 4UOQA 3ULVD 2XZAL 2BSBA 4X80H 4L4JA 2GJZB 2YWYA 4PB9H 3SE4A 4DGIL 4I3SL 1PLGH 1CLYH 5FHBH 3AA0B 1FNGB 4A7QA 2IC2A 4N8VB 1AZNA 2Q7NA 1BQRA 5JIKA 3RGVB 4HW6A 4OZFH 1JMZA 3IN0A 1NFDB 2ZOWA 2DEWX 5EMYA 3POQA 1JGLH 1DVZA 4F5CA 3Q9PA 5HI4D 4KMLB 2XBZA 5BV7C 1QTYT 1DQKA 1QYGL 3EFOA 3LYRA 3QWOA 4S1RH 5E9DA 4IMLA 5B1JA 2I07A 1D5ZB 3WMQA 3K0YA 1H0DB 1AQKH 4WCYH 2OMNA 3B3IA 4PB0L 5HHMD 1T5XA 4P9HL 2Z4QB 3O2DA 3DV4A 4M5YL 3T4YB 3U6XA 1XD1A 5C7XH 1FFRA 4UTCA 5EOQL 1H6UA 2ZXDA 3KXFE 4HG4J 4B5ZA 1OAZH 2Z92B 5KVMC 1IAIM 1NOLA 3EHBB 4PCSA 3OLIA 3GHBL 2OK0H 2BWQA 4HK0A 2E8ZA 5F97E 3RTQD 3KHQA 4UM9B 1HXUA 1KY7A 3ULVE 1MI5D 4RMTA 1RPUA 4J27A 1KLUB 4QJ4B 2E27L 4MQSB 1J18A 4ODTL 5EZLB 4PVMA 3L81A 3ARBD 3S37X 5BVPH 4FQ2L 3V9EA 1QJ9A 3DO7B 4GINA 3OKDA 3LS5H 3IDXH 3ULVH 5H94B 2IWGA 1TQTA 4HPYH 4LVEA 5GIRA 2I9TB 3FTXA 5EOTA 5AZUA 5IK3A 1FIEA 1U3JA 1BEYH 1FZMB 3N1GC 3GSNA 2OAAA 3FQ1A 1CFTB 4D0BB 1UKSA 3KW7A 3T5WA 1T0NA 3X3FH 7TAAA 4EMZA 3VMPA 3CHQA 5ENWB 5BMFL 1WFUA 4KXZH 1KYOJ 1R34A 1Q38A 2AHIA 5IFJB 2NTFB 4Y4FB 2CKNA 1Q0XL 2YQ3A 3NIDE 1FORH 3HFML 3V4PH 5GGUB 3B9KD 5DRNA 1FQ9C 1MCHA 2VMEA 4LEBA 4AQ8C 2WCPA 3OKEB 1HWGB 2L8AA 1Z6JT 1OT2A 5JORB 4N2KA 4WJ5B 4P23C 3I9GH 4UYPA 2WXGA 1Z5LA 1CU4H 1UD3A 1YNLH 5CJOL 4XZ4A 4PLNC 3QVAA 3R7QA 5C0DA 3TEXA 5I8CB 2EIJB 3RHWF 2DKMA 4JFBA 3FN3A 2W94A 2ZYIA 2E6PA 1UWEL 2E4TA 1GRWA 3SDYH 2VZ1A 5KYUB 1QUPA 2XCMC 2F8XC 1X9UA 2XT1B 4HA1A 3Q2CA 4L8CB 4WUUD 1QLRB 3JBG7 4IBLT 1N3NB 4ANVA 1ILUA 2XBDA 5EU6A 3VDCA 3QZWB 2JKJA 4JG1H 1UH4A 4AGQA 4OCNC 4K5OA 1G7HA 1S7UB 4HKZA 2C9AA 1HWWA 4NRYB 4CUCA 2EINB 2CUMA 3KLAB 4XN8A 4ZX4A 4OKDA 3PJSA 3HNSL 1HCFX 1GA2A 1Y6KR 3WJMA 1CFSB 4ZYKB 1BOGB 4ELDA 2AV7A 3VW3H 5BUPA 5CMAB 2VAJA 4AVIA 1PQZB 1ZV5A 2X4RA 5I1HH 2ZXQA 4AGLA 1ZSDA 3IMWA 5G39A 3D52A 1A7RH 3KXFA 3TV8A 4NQEA 2QPUA 3SKMB 3RTQB 5DC4B 4FTVE 1Q9LA 1XCXA 2YPLE 1NGYA 1QBLH 1XV8A 3BVUA 2WIIA 2ORBL 3HG1D 3NRFA 4HBCH 4NQUA 5C09E 5T1KA 4YUEL 4Y0GA 1IAII 1HEZA 5DEFA 3MOQA 1T0OA 5BW7C 2CHZA 3CX5K 2EDDA 4QYOB 1ZTXL 3BZEA 1OALA 3X1GA 1U58A 4WVRA 3MJ9H 5BVJB 1MAKA 2KYIA 4MFHA 4KUZH 2E56A 4F15C 3HLKA 4KQ3H 2ESVA 5DQJB 5E1QA 4UTAH 1MEXH 5JIPA 1U8LB 2J4UP 3RBSA 2P7TB 3SZVA 2VABB 4LVNB 4AQAA 2HCZX 4HKBA 4H1LB 5A7BA 2EKJA 4HIIA 1MAML 4MA3B 4G59C 3NESA 1D5MB 4QRPE 3QGVA 3FFCE 2MHAA 1MREH 1YYML 2PP7A 2KZWA 4X7CC 3OHXB 1NANI 2EKSB 3UDWA 5F89A 3RWEA 4U1HA 4I18A 2XE3A 4NYLB 3ARUA 3QC5X 3VH8B 3VFRB 3WY3A 5AFUK 3KPPB 4FZ8L 5E8NA 5TF0A 3CFIC 4YX2L 1ZXKA 2HFFB 5LJYH 3CSTA 2XXGA 3UYRL 2QQLL 2I27N 4FTVD 1P1ZA 1MY7A 1SLXA 4OIIL 4RNRB 4FXGC 1WHPA 3APMA 4HIXH 2AXHA 2CU9A 4AKMA 1H19A 3S3DB 3VFNB 2W07A 3BE1L 4IRSC 4OZHF 3TWCL 4E5XB 1IMHC 4UB6O 1SN2A 2NY0B 1T16A 1UT2A 2QKSA 3QUXD 2DYRB 5CJQL 1T22B 3GRWH 5DQDL 2BLFA 3FT2B 5HVHB 5HSFA 5E00A 2V3FA 4FQQA 4JQXC 3GMRB 4NPYB 5SWSA 2XFXA 4MB4A 1A9VA 5F1KC 1J0ZA 4X6DF 3QXAA 5EPMB 2A6DB 2V2TB 2OJEA 3OAUH 4W9GC 5F0MB 4KKNA 1T20A 4M56A 3IDIA 3GMLB 2BSED 5A43C 3ISWA 4OLYL 4UBDC 2R4RH 1B4LA 4MZIA 1JFQL 1LWJA 3BH4A 3EOAA 3L1EA 1YSOA 4PJFA 1IBFA 2WO4A 3QUZC 2VSCA 3D7PA 1YNKH 3SE6A 4KZCA 1SYSB 4FQLH 1F4WH 1XGPA 4W9ZA 5BPPA 5HYSB 3MDJA 3QR0A 2ZCZA 5HHPB 2J4WH 1OAJA 2F54E 2K6YA 3S96B 3SDXE 3U1QA 1YS5A 3WFBL 2WGNB 3JV0A 3QIUA 4XMKH 4N1EA 4HX1A 1RUAH 3O2WH 3PS6A 4WWKB 3GBNL 4I9XA 3QG6B 1HNYA 4HAGA 2X38A 1U3HC 1YVLA 4DWHA 3L3IA 2X0VA 2V8MA 5F88B 1K4DA 2Y2YA 2VH5H 3QHTC 4UT9H 1S3KH 4TL5A 5L2KD 5L8KB 5IY5B 2DY2A 2G60L 1I1AC 2UWEA 4X42A 1H3PH 3LN4A 4LU5L 2J3SA 5DMGC 1IQWL 1MCDA 4PVBA 2IWWA 2FWOA 1Z3GH 2NLJA 2VB5A 4LSQL 1MNNA 4LMQE 2QKIC 5JHDA 3A0HO 3LZFH 3NIGF 4KRNA 4R0LB 1F2QA 1YHPA 2C3VB 3MTXA 2BH0A 1X5JA 4XPBL 1PY4A 3BX7C 5AW9B 3UP6A 1Z9OA 3VXPA 1E6JH 3IU4H 2WQUA 2NNXA 4X7DC 4Z7VB 3GJEB 3HAEH 1SY6A 1BFOB 3WLWC 3NCYP 2BINA 2A99A 2EYTB 4O4YL 4IOFC 5EUOA 5KEZA 1CTNA 3HEIB 3RY6C 2I5YH 2D03H 3TBWA 3ZDWA 5F1IA 5DWUH 2X6BA 4FG6C 2RFXB 4JFQB 5I15L 1R3JA 2C8NA 3MO1B 2ED7A 2OZ4A 15C8L 1QACA 3HMXH 4PJ9D 1FC2D 1RHFA 3F62A 1CGUA 1P4BH 1ZAGA 1L6ZA 4RH4A 3WTSA 3MLWL 1UM5H 3V7AG 1A7PH 1ILSA 1N8ZA 1NMBL 2XPZA 1JYVA 2R56L 3D69B 4X6FA 4IW4C 5EZIL 2WWOA 1CZ8H 1DDTA 1MCFA 4XNYH 4AE0A 2A1WH 1NCWL 4XT1C 2JKXA 5E94B 2KQMA 3AG3B 3CHSA 3RVXC 2X2JA 3TH3T 1TQVA 3L5HA 3LMJL 1S78D 1Y18A 2P46B 2Y5QA 4G7VH 1T66C 2I9TA 1AFVH 2J6EL 4RCAA 1MFDL 1FVCB 1NCHA 3M8OH 1VJSA 4GIPD 4MAYB 3UOAB 5CZVH 2R51A 4H26B 3N44F 2ZWKA 4OJFL 2P43B 4A2HA 4ENED 1HL5A 3UPRB 2MCG1 5TFSL 4GG6A 5ESQA 3IJSB 1C16B 4Z9KB 3U0PB 4AVHA 1P4LA 4LSVL 1I3RB 3HBPA 5D72H 4JFPA 2UY6A 1T5WA 4LCWA 4AIEA 4NSKA 1JNNH 4BFIB 3FYIB 3M1OA 1BVKB 1NCBH 5IQNA 2JQMA 2MQCA 5H35B 1C5DB 5E9AA 4R7XA 5HI5D 5C07E 3B6SA 4HVBA 4IEFA 3ASNB 3BRFA 3PGDA 3E6HA 3T2NH 1A6VL 4W9FC 2DQUL 2QKIB 1MNUH 4I1RA 1MHHB 4QLRA 2JB5L 2CBQA 1E43A 3NQIA 3QDJE 3OJDA 2YJQA 4OM0H 3ZHKA 5C0FA 8FABA 5EN3A 3AU0A 1E4KA 4BUQA 2ITDA 1TDQA 1AMYA 1I1AB 2OMBA 3DX2A 4U3CA 4D64A 1LP9E 1X4YA 4GXVH 1NC4B 3QXUA 4FG4A 5AFAA 1HN1A 1TYEB 5C1MB 3BP4B 3ZYIA 4IJ3B 1JTOA 5JPMB 3NPZB 4NJAL 4K71B 1BFVL 3ELAT 1YJDL 4OZHE 4X99A 5F9DC 4ANKA 3X12B 4EPSA 3ULVC 2Q5BA 5IM7A 1E4WL 1CT8B 1KJ3H 4FQJL 1SHMA 4QMEA 5JHDE 3ZJAA 5ID0B 4XX1E 3D07A 2B9AA 3B2VH 4YJZL 3VW3L 2AQPA 3R7RA 4G8EA 1KCSH 3RFZC 3FU8A 2WYHA 1XZ0A 5IESH 3E3QC 3Q2VA 3QJRB 4D9LL 5HI4C 4XNUL 4DN3L 4OF5A 3L7FB 1RJYA 1ECZA 3PAUA 5G3AA 1RUQL 4WENB 5IJKA 1A6UL 3T3PE 3TGXA 1CD8A 4YZFF 3ZPDA 4TVPE 4Q74A 4FFYL 1R17A 4BUMX 3EO9H 4EEEA 1OAQH 3WY1A 4Q9BA 2WMPA 4U0QB 5D4JA 1E5YA 5DMIH 3A24A 1FZMA 3BP6B 1FGNH 4JFOB 2ZJSH 3QRGL 4JQIL 4PRHA 4OZIF 2ICCA 4HGWB 4PJ9B 4KI5F 1QFUL 4NS0A 4Z0XA 1HEZB 1T5XB 2XZQL 4DO6A 2P3YA 4QT5A 5EDXA 1NCJA 4GT7A 5I6KA 5EBLB 2QGCA 1SJMA 1Q9OA 4B7IA 2IGTA 2W9LA 2ZWYA 1JMXA 1AGFA 4EOWL 3LAFA 3MLZH 3M1CA 1ORQA 3ZX1A 4BM7A 1I53A 3NJHA 3PPEA 3MU3A 3MRJB 3RDTC 2OXHB 1H6FA 3BXNA 2JELL 3PIQB 4I3RH 2XIIA 4XTRD 1FJ1B 1RFDH 1YEIH 2H9GA 4NC1E 5EU7C 3PWJA 4HLZG 2WN2A 1JNHA 4UF7C 2IPTL 4WUUB 3RAJH 4NNXB 2Q2LA 3KCWA 3LHPH 1LE9B 1SEQL 4E41B 4AOFA 3IPFA 1E9PA 1NGPH 3OKDB 1CQYA 4FX5A 1XD0A 2AXWA 3X1BA 3VFWB 1UA6L 4IGBA 2IPKA 1Y0LB 4RAUB 2ZP8A 4JFFA 4FCHA 2EH7H 2ERJC 3MRNB 4FG0A 3HI6L 4G9FB 3HKFA 1N0XL 4I48A 5BJTA 4RGOH 1UM4H 1T0PB 2VDML 2VISA 3OM3B 4J4PC 4Q14A 4KC3B 3OPUA 4XP5L 1AKPA 4UDTA 1AQKL 2DF3A 4G1MB 1KCRH 4NKIH 3QPXH 1OCCB 1PZCA 5E6ID 4Z77B 3K2IA 3VE0A 5DSCB 3BZFB 3NABH 1NKGA 2WTPA 5GZOD 2A38A 4PJAF 2CLRB 3KNBA 1JSYA 4ZS7H 4FQQB 2NYYC 1E2WA 8CGTA 1WYJA 3T8XB 1PD1A 3S98A 3CFQA 1IT9L 3A4DA 5DVPA 5EZOH 1NCGA 1IAMA 1KBBA 3O8XB 3EYOA 2XACC 2AC0A 1EJ6A 4YAQA 1TJMA 2EO7A 4MD4B 2A6JA 1XHHA 1PZ2A 3OLGA 5FYJE 4P2QA 5HJ3B 5KSBA 2XA8L 3HOEA 3E2HB 4JPWL 6CGTA 2YK1H 4P9HC 4DH2A 2BNUA 2HT3D 3D2UD 1LP9F 1HJCA 1CDJA 1TZIA 4HJGA 4ETQB 1MCOL 4AV0A 1U8HA 4OFDA 2ID5A 5JIMA 1D3CA 3WKMH 1IKFH 4IBYA 3HBZA 4NHUA 3CHOA 4JY5H 1IEAB 1Q1JL 2O6CA 3A6BH 2NYKA 2Q87A 4JPVL 5JDSB 3TESA 2BSEA 5IKCA 4WEUD 3JUZA 3RDTD 2H2SC 1MFAL 1G9EA 3S5LB 3NEEA 5F88A 3WNPA 1IC4L 3QIBA 2F74A 4RSVA 1NAKL 3FZUD 4TQEL 5DO8A 5F6HI 5LN8A 3BGAA 1A7QL 2B2XH 4OQTH 1I9RL 1GHFL 1HOCA 3BSGA 1IAKB 5TK2A 4GMTL 5ITBL 1K3ZA 1HHJA 3IAQA 1O6TA 1UG9A 1VACB 2VKXA 3M17B 3MLSL 3VFMA 1HH6A 2QSTA 2OZNA 3U9PL 3V55A 5PCYA 1A1NB 1ZRUA 1MFNA 1KWGA 1TYRA 1E5UI 3SY9A 4ODSH 4LCIL 2VMDA 5B39G 3UO1L 4MJ5A 2JKNA 4BA0A 1OD9A 1WCBA 2HLAA 1A9BA 3HC0B 4ZODA 4OQ1A 3AA1B 2CO6A 1OCWH 2HN7B 3FOMB 1A0QH 2AQQA 4M7ZB 3BIKB 2HP4A 2P5PA 1CL7I 1CFMA 1DCEA 4XPGH 2VDLL 5AOKA 4HETA 4GW4A 3IYLW 3ZYOA 3VFOB 3G5VA 3VTMA 1J1PL 3BKML 3VFVA 3KPQB 1U0QA 4O4UA 3KWTA 1ZVYA 2IG2L 3GMRA 3V9FA 2W0PA 1WVZA 2ENYA 3BYYA 3KM2A 4QRRA 3UYPB 2Y5EA 5JW3L 1JTPA 1I75A 1KXQA 4WGVB 3QUKB 2QADD 4JZNA 4G9FD 3DOSA 4G5AA 1TPXC 3V0WH 3FCSA 1URZA 2VZTA 5ACMA 1QWHA 4G7VL 4W6WB 4LKXA 3QRFM 1VA9A 3IFLL 3EOAB 3N40F 5I1CH 1QRNB 1GC1H 4NBYB 5CZVL 3PWLB 3DXAD 3X17A 1E28B 3ZSTA 1W91A 3U7YL 1X5HA 3ECQA 3L9EA 4D0CB 3ZSSA 4E41D 3B9KC 4GMSH 2F53D 5AVRB 3RFZB 3QQ9D 2EVGA 1NL0H 2AK4D 1AOHA 2HJLA 4KDVA 3T3MF 3QFDB 4YDVB 1HCVA 3QEQA 2GITA 2VC2H 4L4TE 4YSRA 2A7BA 3MBXH 5EIIB 4P2CG 2H26A 4JY4A 1IGTA 4XO8A 2BFVL 5D7LD 2WXJA 2F58L 4AYSA 3LPOA 5JXAL 1BQHG 4U7MA 3GMOA 1N5YH 5EU3A 5CJOH 2Q8AL 2JQYA 2XKNB 1UC6A 3FT1A 2H6PB 1D5BA 3TPUA 5TE4H 2HUEA 1EWHA 4CDGC 1DCLA 3E6HB 5HHVL 2VLRA 4LSRL 2YGNA 4HJIA 4PD4J 5T3ZE 4DKDC 3GTNA 1MOEA 3PV6A 4Q97A 3BKYH 2MRYA 3CJJA 2GBTA 3ML8A 3O2DH 3BWAB 5E9NA 1F4HA 2AQTA 4JKLA 5KVDH 1KIRB 3TEYA 3HZYB 2RALA 3CFCH 4K94H 5K39A 5EEZA 2WTOA 1DZ0A 4P3DB 1NBQA 4LPUA 3TYFA 1ZGLP 1I7ZB 2BRRH 3GLAA 2XRAL 1F58L 5GRYA 2X4OB 2NY5L 3GB7B 3MV9B 2BWDA 4DO5A 1P4UA 3BAWA 4XNMA 2EDHA 2K4TA 4AZUA 3GSQA 1XFPA 3OKNA 3S5LG 4LEOB 3SKOA 4V1DE 2X40A 4HISA 1PD0A 5L4IA 1INDH 2B4CC 3KD4A 4KTEL 1DN2A 4WDIB 2F1AA 4KK6D 4M7KL 2CKBH 5FGCE 3ZR6A 1BBDH 5GGQH 1E6OL 2PRNA 1HOEA 1F11B 2F7QA 4WWID 5JHAA 4E42A 1X5MA 3BVWA 3LN5B 5GGSA 3MV8B 2WBJD 2VCOA 1A2YB 5FWQA 5HPOA 3L7FA 4HEPG 4XVJH 1TQWA 3SKJL 3SEPA 4EKJA 5CFAA 3CVHH 3GJFK 3ARBB 3DX7A 3INUL 3EKCA 3RVWD 3LIZH 2AK1H 4IK7A 1AANA 1WIOA 4RMSA 3V6ZB 4YBLB 4N9OB 2TAAA 3LRMA 5E7BA 3C5SB 4EXPX 1DVFC 4NKMA 5H8DA 4F3FA 2BIQA 3N41F 4JDEB 1WG3A 2X0WA 5INDA 4UIKL 4HHGA 5L9DH 2OXGA 1KXQE 2EC9T 2BDNH 4HGWA 4ODHH 1H8LA 3G5ZB 3BSZH 1L0QA 3H42L 3TO2A 2DTSA 1ZPLA 4QT5B 3HE6B 1H8SA 3K5RA 4X6BB 4PJ9C 4F2FA 2HKFH 3O3DB 3D0VB 1DBKH 1LO0H 4KNQA 4CN6A 2ICWA 2DWSA 2PYFB 3FOLB 5DQ9B 2PLTA 1R5VA 4EIBA 4MHHI 4QRAA 3PHQB 2QBWA 2UZPA 4UNTA 5IHUL 3QPQC 3LKPB 2XTQA 1CG9A 1FE8L 2P5EE 4YSDA 2K6ZA 2GC7C 1F1DA 4F9PC 8FABB 5GHWL 3UYRH 4QTHA 5KJ4A 1MCQA 3UGUA 1UA6H 2JCCB 1J0KA 4DKTA 1MCWW 1M2OA 1YECL 3WNMA 4H8QA 5F3BA 3REVA 5F6IB 4RGOL 1SVZA 4LRIC 3BUYA 3KPSA 4ORGA 2PWEA 2G2RA 1P7HL 3LZFL 4ANUA 4JGMA 4Y16B 1KFAH 1GZHA 1AMXA 3VD2A 3F7LA 4HEPA 4ZFOB 2ZKWA 2VLMD 4D65A 4O2EA 2VISB 4GH7B 2NSMA 2O61B 3VGFA 5F7MC 3IDNA 3AAEA 4HIPA 5E4EC 4JRLA 4IIQC 3A67L 1KCUH 5I1EH 5IEKB 4WU7B 3SYCA 2DB8A 1E5AA 3S88L 3LQAL 5I5IA 2AQNA 5HJBA 3L3OC 5IMOB 2PTTA 3RWFB 1NBYB 2DTML 1TTUA 2CRZA 3KYMA 3OKKB 1MRCH 3D85B 1E4XI 1HILB 3NJLA 3NFPA 3PNWA 2VW6A 4QWWC 3RVWC 4AKQA 2BSSA 3ECBA 4M02A 3QCUL 5TGBB 4A2DA 3UBHA 3B83A 4YAQB 2ZUUA 4WGWB 2R56H 4MQXC 1UFUA 1YY9D 3VFPB 5ACLA 5HJ3A 5I17A 4XNKA 5JUEH 2VDKB 4AMWA 4C4VA 2M2DA 1G0XA 3MLXL 2GHZA 3GTVA 3GZOA 3TBBA 5EO1A 1TQBB 4MNGE 1BV8A 1FCGA 2F18A 3CFKB 3T0WA 2J20A 2NTSP 2XPGA 4OD3L 3EF7A 2VUKA 1BHGA 3H54A 3T4AB 3HLAB 5C0NC 5E0FA 3OMNB 1QNZL 4GAJL 3ALWA 1U41A 4XXWA 4OLUH 1VSCA 3TVMC 2VXTL 3T04D 1PW3A 3ZDYB 2PPDA 4NERA 4C54A 1WO2A 1JZEA 4AEIH 3FB5A 2I9LA 1XB8A 2QVIA 4HH9A 5DHEA 1L9NA 1YEFL 2AKRA 1NIDA 4ZMNA 5CBAB 2ENQA 3PL6B 1KIQA 1NMAL 2DJ4A 2FL5B 2B15A 5C7ZA 1K85A 2FEJA 1JNNL 3RGBA 2VDPB 4U1SB 4HUMB 1QJPA 4HUXB 4O4YH 2BJML 4QRQA 1GGIH 3BDBA 3ML9A 3WUWB 2DQTH 3OWEA 1MIEH 3UBXG 4JM2F 4X5WA 3MJ6A 5I6OA 1SXAA 2D31B 3G7GA 5GGSY 4KZEH 5C7XL 4GKSB 1QSEE 3WIIH 1T21B 2EIBA 2WKGA 2Y6SC 4Z76B 2A4EA 5SV4A 5FGCB 4NQXB 3TO4D 4N0FB 3ES6B 1AS8A 4NZTH 3WD5H 3NSGA 1MFBL 4LDOB 4DEPC 3UG5A 3BW9B 1CDYA 4WI6A 1YUHB 1J1OL 4DW2L 6TAAA 3SE9L 3IFPB 3VD4A 5D2LF 2BVUA 2H5UA 5C9KA 3EBIA 2R4NA 1BD2E 5T1LB 4L1TA 1KTKE 3BKCL 1GKOA 4KDWA 1UXMA 3WO4C 4ABVA 1DSWA 3SDXA 1VPOL 1JWUA 5FYJD 5C09D 1C5BH 3DWTA 3VFVB 2CBMA 4YO0B 4LP8A 3L2MA 5CZKA 5E6IB 4PGCA 1E4XL 3BPOC 2NY2C 3GUFA 2MCMA 5IOPA 4NM4H 4XR8C 4MRBA 1MIML 2VDNB 1Z9SA 3KPSD 3APNA 1THCA 2FLRT 5FO9B 4GCPA 4PR5A 1DQLL 3MRCB 3GSVA 2X1WL 4YZFE 5B1CA 1RUQH 4BQ9A 5C0CD 4ZOCA 4MDJB 4N24A 3P30L 4ELMF 5JPNB 4L23A 3NN8B 4WI8A 3V6OE 2I85A 2IWVA 2YGQA 3GSXB 2AXFA 4MQXD 1HL8A 1OP5K 3NA9L 2A9NH 4W1TA 3BN9D 3AU1B 4XVTH 4Y4KD 4K15A 4AV4A 4LMQI 3GMMA 3QFDA 3QWRA 3EBHA 4J4PD 5D2NE 3UTQB 4LOVA 4AIOA 4L48A 4GKOA 3HB3C 3QS3A 5IBTL 4ALAL 3KPNB 2FSEA 5JW5B 5T5FA 1KIPA 2JKRM 3V4UH 1BMZA 4HT1H 4FZLA 2KXPA 2PUQT 1KYDA 3B7UX 3QIBB 4DPAX 4H0LC 3CZEA 1MVUB 4PBXA 4O2CA 1TNNA 1OGAB 4FQXD 1XF5A 4U6YB 1IKOP 3LZQA 3VGBA 1AD9A 4FFWD 4P4KC 2CE6A 4EI6B 1B6DA 1F3DH 3IXAB 3EYOB 3KHOA 3ARVA 2NDGA 1JF5A 3K6NA 4FXKA 4NAJA 5EUKA 4OZ4B 4LLYA 5JIIA 1P84K 2BXYA 2A6JB 1XGRB 2BP3A 2JK5A 2W91A 4P2QB 1XGTA 1KIUA 3ROOB 4BUGA 3UAAA 1SDAB 3EFOB 4PJGE 5KANG 4L3EE 4Y16D 1IZNB 5GZNA 3BS0A 1KXTA 3HG1A 3BIKA 3X1FA 4NKOA 4NHUB 3X1NA 1E9OA 2W88A 3EXJA 5GS2H 5KVFH 1T1ZB 4G1EB 4C56D 1KF9B 4KXZI 5E4IA 4G8IA 3REWB 1UQSA 4FABL 3S8FB 4G9DA 2IWKA 1OAQL 2KQNA 5HBBA 1FFQA 4P46D 4AG4L 4GG6E 4JANB 2F1TA 2VR7A 2NZ9D 4NKQB 4AW7A 1C7SA 2F19L 2FO4B 2XKUA 3K6OA 1TJGL 2J72A 3LSOA 3MLTB 2RQ8A 3QI9D 4PTTA 4AV5A 2AK1L 5C0BB 1OGTA 1QBLL 4JRXE 2QQNH 2R0WL 2IMNA 3NSJA 3QORB 3CLFH 1T03L 3SSGA 1HZKA 1BZ8A 4ZO7A 3VD7A 2VAAB 1JPSH 3HS8A 2V9UA 3O11B 3UYOD 3L3DA 3OXRB 4P4KB 2XZCL 3S37H 4H2CA 4ATTA 1W8OA 4KY1H 4JQVA 3UZVB 5MENA 2D7QA 3W11C 3QO1A 1YEEL 3G04B 1G1KA 4M3KB 4ODXB 1ZLUK 4G7YH 4NFBA 4D0BA 1KPUA 5FKPA 4I1PA 3MRKB 3WNOA 2WB7A 3FCTB 3N85L 3NJKA 4KV5E 4Y19D 3WKYA 1UZGA 4X6BA 5HDRA 4LHQB 4LQFL 1SEQH 2E47A 2JI1A 3NCYS 4O5LL 1B9ZA 1IKFL 3L4TA 2K1MA 5F7EL 4JUSA 1DUYB 4FI7A 4PJ8A 4Q7DA 3D3VD 4XCEA 5T8IA 3KWUA 1FNHA 3TCLA 4HUWA 1A4AA 5GGUA 3T3PF 1RZJL 4POZC 5LGYA 3DOSB 4BGLA 3CFEA 4DSYA 1IM3D 3CZNA 4WNQA 7FABL 4E2OA 5DC2A 4C83B 2F7IA 2WQXA 3V0HA 4GF4A 2F8IA 5GSRB 3VFSA 1OSMA 5GS3A 5E4OA 1NA8A 3L8QA 3ZKXC 3CQQA 2BSDA 5KSVB 2J1KA 3VDBA 1T1YB 4HIXL 3CFJA 4KDTA 1UYWH 4QAMB 4UIMA 3M1BB 5GZOC 5TF1L 1XL4A 2RQEA 5ANMB 1DSFL 5K9KB 4XH2A 5CJQH 1AR1D 1AS7A 3VXRB 2IO5A 3ZW3A 4L8CA 5EOCJ 3M7FB 2DKSA 2LU5A 2FIKA 4NO0B 5LNGA 3AREB 5E08L 4BKTC 3T77A 5I76A 2LGNA 4GUPA 1J8HA 3VWJB 1J5IA 1NDGA 5D7LB 2JFCA 3LKNA 4PJ5D 5CKAA 3H2QA 1NDMA 1TITA 2Z0BA 1R3LA 5EUOF 5AVXB 3QJTB 2ZKHL 1EXUB 5CZXC 4NQED 1XCWA 4ZMPA 2YK1L 4L0PB 3OZ9L 1NBYA 1W80A 1B4TA 2ZXGA 1QSFD 4AUYA 2AJVL 4JL1A 3D9AL 5FYLH 5KW9H 4NJ9L 3AXHA 1M1XA 3WKML 2XJKA 2VDRH 1F41A 1SDDB 3WHXA 3T2OA 1B3JA 4K07A 4D9QD 4ODTH 5CCKH 2WQSA 3RUGE 2R0LL 1QEWA 3BN3B 1AKJD 1V3MA 3RPKA 1JVOA 4P5KB 1W0VA 5L0QB 5FECB 2MPAH 3MRPB 5I1GH 3EYQD 4FE9A 4ZAKB 4G5ZL 5D1QD 3WE6B 4XNAA 4L8DB 4WO4D 2QELA 4X9HA 1NAKH 4Z7NF 3P2DA 4WEMB 1U4FA 1U58B 3RX7A 3QXTA 3DHJA 1NUDA 2EE9A 1BQLL 1JV5A 5AW4B 2WLLB 1H3PL 2J1ZA 2ZG3A 1NFDA 4YBLC 1J48A 2J73A 4P46C 4Y1TA 3GGWB 1IEHA 1S7RB 2PWFA 5GXBB 4YXHL 3FCUB 1NCNA 1DVXA 4L3EB 2ZCLL 1XQ4A 2EIKB 5E8EB 5DLLA 4ZMAT 2C9PA 5AAWC 4AQAB 3EO1A 1FVDA 1S7WB 4GI8A 2CMRL 1F1AA 4LF3A 3JWNC 3EJUA 35C8H 1MLCA 4LHUB 5AWNH 5AAMC 2PO6A 5ITFB 5LXVA 5FAAA 4NEHB 3QJUB 4Q9RL 1FNFA 5E6RB 1YY8A 3CE1A 3FFDA 1YDPB 4F5CE 1KELL 1WJ3A 1O7DC 4Z7NE 3FB8B 3IAGC 1ACZA 2FGZA 3BUYB 4ORGB 3RWEB 4ERSH 2HWZL 1MHEB 4NENB 2C1PA 4GAYB 4X8XA 5MI0B 3LPFA 1F8TH 3KPPA 1Q90A 1YG9A 2V5MA 5ILTL 3FUMA 4ZMTA 2HYMA 2X70B 4NC2B 3OKOB 5JW4R 3QR1A 2OMVA 1CWVA 4NQDD 4D3CH 4LFHG 4P5MA 1B0GA 5DJ2B 1DTUA 4JKMA 1UZ6E 2QTVA 5LXGL 4C58B 2YAMA 2BRRL 3P77B 3WN6A 2X2HA 1OB0A 2WVPA 1MQKL 4QRUB 4UUJA 3ISRA 1HS6A 1U91B 3N1MC 1AZZC 3TT1L 1U33A 1WWCA 1LQSR 4XPAL 5DFTA 3WFDH 4KRPC 5KBLA 2QZQA 4PJBA 3QDMA 3TL5A 3S2CA 5KVEH 3RWDA 4JFVA 3MRFB 2LFGA 5BXFB 1N2RB 1ACYL 1EERB 1JDDA 3CD4A 3NFNB 5L4MA 5DK2B 1QI4A 3SGJA 1MY5A 3WJLC 5CIPA 3U46B 1M53A 5HYQB 4WKZB 5GS1C 3RL2B 3DTDA 1J8HE 2B3IA 5BMFH 1H6EA 3TCXA 1MI5A 4P23B 5CJXA 4WFFE 2IADA 1RVFH 3ARYA 4PJ5B 4YSEA 4RFOH 4KRPB 5F0PB 3AY4C 1SYSA 2VDQB 4IU3A 3E7JA 4XPTL 4HS8H 5KN5B 3GDBA 3AXLB 2N7AA 5DS2A 3WIFA 1MUJA 3H9SE 4ZZKA 1DLFH 1TVBB 2EADA 2GSMB 3E38A 1QSVA 5IUCA 5HDOA 4XVOA 1Q0YL 1BAFL 4OCWL 3BSZL 3CZFB 2MNWA 1AD0B 2NQCA 1R6VA 4MA7H 1Z5LB 3HG3A 3D39B 5TISO 1LO3H 1ZT1B 2HUHA 1A47A 1K4DB 4K94L 4Z0BH 4JM2D 4X83A 3X3GL 3U1PA 4AMKH 4EJ1C 1GOFA 4JZOB 4YDIL 1OGAA 5DS1A 4AWJC 3P0YH 3D0AA 4QO1B 4X4XB 4YIQA 1MAMH 1N67A 2IH3A 1UEMA 1HHKB 3KXFB 4XMUA 5TPWH 4ZQTA 1QUNB 1NFDE 3EG9A 5D7LE 1KEMH 1S5HB 3QDGD 3V4VL 4ZNEE 3I6KB 3LB6C 1W0WB 4J7RA 3BOVA 5ESVA 4F57H 1YNTF 3IDUA 3G6DL 1UKQA 4ZW7A 3EBAA 1JF1B 4X7EC 4ZPVB 1VFBB 25C8L 3JT2A 4BHUA 3DMMD 3SY6A 2CJUH 2ZX8A 1SMDA 5DJDB 1R0AH 4QDGA 5J1SC 4Y2DC 5FWRA 2BCKB 3O6ML 1E9OB 3OMAB 1A7OL 2C9VA 2BPBA 3U1SL 3ZE0F 4G1EA 4JG5A 2MSPA 4LGSB 4M03A 3TWCH 3F64A 3LX9A 1GGCL 4PREB 4NQEB 2NY1D 3CHRA 4PGCB 5DJZA 3VMOA 4IOSD 3E0GA 3UAEA 4DP2X 4QCIA 4Z7OF 1M71B 1YEJH 1ZTXH 4A7TA 4OZGF 5I16A 4F7EA 3S35L 2XETA 2BDNL 2FEDD 3DMMC 2NY7L 3H42H 3JTBA 2BC4B 4CMMB 2CDEB 3GMNB 5FO2A 3OLDA 4I18B 4R2GC 3BQUD 4AVKA 4I85A 4PUBH 3NT0A 5E94A 3VH8A 1AQDA 2YSSB 1W16A 2OTUB 4RAHA 2AQ1A 3ERXA 4XO5A 3BIAX 1M7DB 4LQ1A 4ZAKD 5DJXB 3STZB 5IW6B 4PJBE 1ZE3H 2WXQA 3SDDB 1OSPL 1NCUA 2WZ0A 1NGWA 1SXCA 2JV6A 2YGPA 5DGQA 4H1LA 3UPCA 4TLUA 4E5XA 2JELH 3F01A 5TJWK 2JKIS 1WT5A 1QATA 4ZPTA 3SE8L 2C3HA 2ESVE 2VJXA 3TNMA 5FS5A 1OK8A 4OD3H 3CXHJ 1WFMA 3SQRA 4W70A 4NPYA 3A23A 4IEFB 3VFRA 3AITA 3NP3A 3VX0A 2OJEB 1O7DE 5DD6B 3RZWA 3PWPB 4IOSA 1A21A 1OCRB 4PJAE 3CFEB 1WFJA 3M07A 2YLHA 1G7IA 2GJJA 4JHBA 3K3QA 1D6VH 1J9RA 4WSGA 3UABA 1SHXA 1GY2A 4W4NA 5CFHA 2HVBA 2CR6A 4LSQH 4N2EA 1I82A 2X3CA 5C0CB 3AA7B 3L6FB 2BJMH 4HGMA 2V2WA 1GW6A 3HW9A 1XGUA 5B3NA 4ELKB 2LFUA 1N68A 4B9FA 1D9KD 1PIGA 4HWZA 1MCJA 2YWZA 1EAOA 1PAMA 5EORH 4L18A 1PZAA 4GW1A 3T77B 3HC3L 3NZHL 4R4BB 1KYFA 1NDGB 5D7LA 1YPZF 4ZO8A 2GAZA 2ZCKL 4FHJA 2D03L 5D4IA 2Y2TA 5ADPL 3MRQA 1QJ8A 4NJ9H 4NGHL 3EYVA 3WDHA 1F4WL 3DMMB 3I2CH 4ODWA 4IHOA 2YC1A 3OMZA 3MUUA 4L5FL 2YPVL 3AG4B 4JPWH 5T1DH 3RIFF 1NMCC 2BNRE 2Y0SA 5AUMA 1HL9A 2XWJB 4KNSA 5C0AE 4R0LA 3D5OF 2B0SH 1E8WA 1AGCA 2P5EA 5J12B 2Q1EA 2JKWA 1RIVH 1RUPH 3SDAA 1NM4A 1OGPA 3PXJA 2QL1A 4PJFE 2A1WL 2OCJA 1ODAA 4PJEF 1QP1A 4U3XA 3L3IB 4AEIL 5F7AA 3KDPB 5MERA 4PJ9A 4Z0XB 1WFIA 4NRXA 1FL5A 3L16A 4I88A 4YSOA 3HI1A 3P9LA 4KVCH 1FN4A 4XPFL 3TYGL 3WTYA 2WUBL 2WWMD 1OAYH 5D1XC 3LD8C 2W59A 2GJ6A 3BHBB 2ATKB 3POUA 2GT9B 4PG9A 2FWOB 3Q5TA 1MW1A 1AACA 1R3JB 1BX2B 1KTDA 3HAEB 4F7TA 4AITA 1ORQB 4NWTL 3VCLA 4H8HA 1EHKB 3V52H 4PB9L 3RHWK 1V27A 1WFNA 4JPSA 3SPVB 1RIHH 1SJHB 4N1HB 5IJDC 1E3FA 1YAZA 3JWDC 1FJ1A 4HJSA 3RU8H 4UAOB 3IJ7A 3MR9A 3VXPB 5BZDB 1A6TA 3PQYB 3FU7B 2C34A 4NNXA 4XBPA 3UL4A 4DW2H 3WL9A 2E7BA 1NIAA 4P2RA 3S36L 5HJDA 4PWKA 4HWEH 2Z8VC 5E6ZA 2ZIDA 4P4KA 2EDBA 3UPGA 2ZLDA 4I9WD 4JFYB 1L5GB 2CH8A 1T2QH 4YDMA 4R26L 2R7EA 2CRIA 1BAGA 1FNSL 4XPGL 3HHSA 4GAYA 1U30A 4Q58C 2HRPH 1ZLWK 2CHNA 1KLGA 4YL4A 4XI5C 2X4TA 3B7RL 4M9PA 5GJSH 2BY2A 3IDGB 4F8TA 3OKOA 5F3HB 3KCPB 4TUOB 5GRUH 1IGML 1NMBH 1U95A 4X5LA 2HT4C 3UJIL 1LEKA 3RWIB 3CXDH 5E2WL 1XF3B 2JIXB 4WI0B 1VDGA 5JXEC 3OZLA 1OAZL 4QXTA 3A22A 4G6JL 2ZOLB 4DPBX 2C4FT 4HUVB 2CRMA 3VQMA 3STLB 2TRYA 3W0WB 1F18A 1KTRL 4OV6F 4BV1A 3IFLH 3HG4A 4M6MH 5F7KC 3K71A 4JO5A 3BUDA 4GW5A 4R84A 4P9ML 3ARED 4UQ2B 4RRPM 2R2HA 3GRBA 1CVRA 4K3BA 2FATL 3SQBB 4YSUA 2ICWI 3GF8A 4G3YH 2B1AL 3D2UA 4RLDA 3BT2H 4L1DA 4L2YA 4WU5B 2NOYA 3RE0A 1IIIA 3MXVH 5MP6L 5HVFB 1QEWB 2ZP0T 5JQ6H 2DYPB 4KMQA 1WC7A 5DMJB 4UIMB 3ULVL 1MHPL 4PGBB 2XOTA 3GRWA 3KM1A 1C1EL 1VEPA 3D34A 2G3ZA 2BX5A 4X99B 2XA3A 5CD5D 5KVGE 4FXTA 1A6VH 2FHFA 3JTTA 5DI8B 4FFWC 2FIKB 2YFOA 1MW2A 2G2NA 2SEBA 4NO0A 2R39A 5AW2B 5I0XA 1C5CH 4FJYA 2HLEB 3SPIA 1O0VA 5HGBB 5C0AA 1SDYA 4DVRL 4CKQA 4BFFA 4MZ3A 3EOBA 3BC9A 4KV5F 1FC1A 4X0KA 4E9YA 4KKAD 4Z95L 3FSZA 4ZBJA 4LT7A 4O51A 4EO5A 4RMWA 4QRRD 3S5LA 1BYPA 4XBEL 3EJTA 1JV2A 3EYFA 3MREB 5FGBA 2V6HA 4BCZA 5LN4A 1NFAA 5I8EA 4HU8A 2G5RA 4ZMLA 2BSCA 2GJ6E 2A83B 4P3CH 4ZO9A 3W56A 1CT8A 1J9CT 3LHPL 4N2GA 1G6RH 3APFA 4AK1A 3QJVB 4H1LH 4AW4A 1J8HD 1RUKL 4XNQA 1LE5A 2A9AA 5T3ZD 1O5DT 2F5BL 4FSOA 5EV7A 4ZOEA 1WISA 2CR0A 5A2LH 3DLQR 4HP5A 4LCYB 4HZAA 1D9KB 2DBLH 2V9QA 3TO4C 4BHUI 4NFCA 4B9IA 1CYXA 4AT6B 1GGCH 4PH8A 1I85C 3GBEA 1YEGL 4YGVA 3QH3A 1KZYA 4MWFB 1H3GA 1TMCB 1V7NL 3TFKD 4DOHB 3ARBC 1MFMA 3QDJD 4QXUH 4X8CA 5T5NF 3DRTB 2R69L 1HWHB 2CLZA 4RAVB 3SYSA 4YHLH 4Q2ZA 4K8RD 5EEVA 1I9IL 4LIQL 4UV4L 3S6CA 1PDKA 2A73B 5C86A 2NW2B 5AD0B 3LEYL 4PRHB 4QXVA 4WKZA 2ICEA 3FQRB 1YDPA 4OLYH 1UWYA 2GQHA 3K5SA 4ODHL 1NFKA 3N85H 1AP2A 1BW8A 1IT9H 1CUOA 1FFNA 4IGBB 1KJMB 5IMMB 1AGFB 4R96B 3CWGA 3L1OL 3L7EA 4BA8A 5IWLA 5DJ8B 5CNHA 1G6VK 4IMKC 4YHKL 5DJXA 3STZA 2GTWB 5C0RL 4XP1L 5IW6A 1KEGL 3OR7B 3DIDA 4PAZA 2APXA 1IBBA 2EEXA 2WBXA 3RPIB 1TG8A 3PWJB 4MMXB 4G11A 4CGUB 4FMVA 5BV7B 3CZFA 5CAYB 5EIIA 1CF8L 3C5XA 5FGBC 2QPFA 3U4EA 1FRGL 4PD4K 4PR7A 1Q1JH 1S9VA 4MNQA 1MEXL 4QF1B 1VHPA 4Z7WF 3U7AA 1I8UA 4D94A 2XN9B 3ZUNC 3IETA 5C0JA 2MOQA 4A7SA 4PJDB 3ILPA 4YSSA 4HF5L 2R8SL 3RVTD 1G1CA 1K8DA 1M1SA 2R29H 1S46A 3FYEB 3QUMH 4ELME 1N0XH 1IVLA 3DVGB 3K91A 4I0PB 3B2PA 1X9LA 2WXLA 4JM2B 5HHOB 1PX4A 5IQOA 1PZSA 1MI5B 4H44C 1NOAA 3TO4A 4NKDA 1HZHL 1H6TA 3GXNA 5HHNA 4C56A 4JFHD 3DZMA 4LSEA 2HH0L 4YE4L 3B5GA 2EDKA 4JRXA 2VKWA 4OKVB 4NUJB 1INQA 3U79A 1WTLA 5LO7A 5I28A 2VXVL 5EDSA 2EEDA 1JF1A 4AQZA 3IMRA 3ZTJG 3FU6A 3I6LD 3N9GL 4X8JB 1A3QA 4FLQA 3DK0A 3QYNA 4FXGB 3SJVE 1OPFA 4CTDA 3FUKA 4U05A 2B20A 2Z1KA 4OLZL 3ARXA 3V4VB 1CYWA 2WPGA 1E8YA 4AYFA 1G9NC 2AVGA 1U8JA 3I2CL 3HC4H 1GZQB 1HXMA 4FTVB 4GQZA 1D5XB 5IQLA 2CBPA 1JRHL 1QFWH 4MLIA 3TFKC 3IJEB 1HVXA 3SPHA 3ULUC 1KLUA 5FUZH 1KFGA 1F11A 4PMFA 2CWRA 4PJEB 3MV8A 3QJOA 4P57B 1CR9H 3NSDA 4G75A 1HH6B 2QMJA 1VZGA 2W92A 1HHGA 2XWTB 3WLBB 2ARWA 1KPRB 2VT0A 2VDOB 3NRPA 4PJ5E 5FYJL 3RWCA 3WS6C 2HLFC 3QARA 3EDJA 1XF4B 5DR5L 4ONOA 4P59L 4ZMVA 1TTRA 4WKXA 1NSNH 2X4NA 4KK8D 1OKEA 3G3LA 5LLIC 1OK0A 1P2CA 3GPSA 3VNYA 1DHKA 1KENL 4N2CA 1IE5A 4RL9A 4TSCH 3MOBL 5D5ME 3DJTA 4DNLA 1G7LB 5DJDA 4PP2A 2GUOB 3FSVA 1GTNA 4PY8J 2ZUYA 1HAUA 1RZFH 2OMTB 3DBXA 3V8UA 3I50L 1WUNT 4X9GA 5DEZA 3FOLA 2LAGB 3O9WB 1K4CB 2OSWA 1CTOA 3VXOB 1HL4A 1KTCA 2GSIB 3O8XD 3S3SA 4UQ9A 4NXKA 1RZ8A 3UO1H 1M71A 5J6GB 3OKEA 5AQ0A 5G55A 5IB5A 3WIIL 2ZXBA 1W72A 4JRXD 3ZHLA 2EEAA 4G7SB 3EYSH 3OSVA 1A6AB 5D93B 3S5ZA 43CAB 2FO1A 3NRQA 3C60C 3BP7B 4GXVL 3CVCA 1PEWA 4PJHA 3CCHA 1TQSA 3OJMB 4IM8A 3NCBB 1WE5A 4MNQE 3SDDD 3BKMH 1IGMH 3CIQA 1XIWC 3COOA 1SBBA 3UJIH 2N2MA 2UXFA 5ISZA 2KL6A 4IBWA 3IDJB 3Q9QA 4L3CB 5IF0A 3EADA 4DQAA 2FGWH 3VXSB 3QEQB 1HXYA 1MZYA 4RWYL 1KBKA 2D4DA 3AWGA 4XOBA 3UCRA 5CD3B 4O2EB 4JJOA 1JI1A 1R4XA 2D3VA 2OSYA 3OD3A 2D73A 3QUKA 4JZNB 2AJUL 1WA0X 2K3HA 3SN6N 1TZHB 1IGFL 2Y2WA 3MCLL 2ZAGA 1UB6B 3KBHE 3HBGA 1ZV9A 3HPLB 3D51A 2CBTA 4QKTA 4C56E 4B3EA 1G5AA 1Y1DA 5G4MA 3SB3A 4CL7A 1UJ3C 2DPKA 2R1YA 1XB3A 4UMGA 5JHMA 1QPKA 1G6RB 1FO0L 2AAAA 2FE0A 3S48A 1IGCL 3Q5OA 4OCYL 3L4CA 4G82A 4D0CA 5SV3A 2FZ3B 1YYCA 3IDMB 2XLLA 4P04A 2OYPA 3ZRSA 5ETUB 5K59E 1A7PL 4FEMA 2IVFC 4LNVA 1E6OH 3DJ9A 5AG8A 3R4RA 3EMNX 3US9A 1G7IB 4H0IA 4Y5VB 3SDAB 2BSSB 3ECBB 3DSFH 3AB0C 1P5UC 1V10A 3WNIA 2HB0A 3FQXA 4FKEA 2Y7QB 1XH3B 3SKJH 3SO3B 1BF2A 2KPWA 4NOBA 2IAMB 1DJHA 3D87B 3L6FA 3VFPA 1TTCA 2XV3A 4WFGE 2NY0C 1A4KA 1HYSC 2XN9E 2Z4QA 3SOTA 4L4VD 3ALXA 1CFQB 4KI5E 1E4HA 1YQVL 3QJFA 4OLEA 5G5DB 2L4OA 1KB5L 2G0LA 2GFBA 4B97A 4PGEB 2EACA 2X6AA 2AXGB 3TV3L 5BQDA 3OAZH 1UWGH 4JO4L 2D8KA 4BZ1A 2FJHA 2H2PC 5T33L 4QEGA 4JS7A 4X0KB 1FV1A 1ULVA 4Z3FA 1M2VA 3SDXF 2EEFA 4FQ1H 3PWUB 1FH5L 4FZEL 5JLZA 4JX0A 1CICC 3G7TA 4PGDA 1KIQB 1U8CB 3F84A 4L4TD 5AVVB 1XR8A 1A02N 2XNAA 4F33A 1H8OA 3G6DH 4XO3A 2RMNA 4W68A 5KS9B 3SKNA 2Z7YA 1GOGA 2FB4L 3IRPX 5H94A 3TBSB 1N7ML 4AIXA 3P9WB 4CSZA 5IK3B 4PJBF 4MMZC 1PY0A 2N0KA 4XCNB 1XIWD 5IVXE 1E67A 3ZL4H 2HVJB 4YSAA 4N8CH 5INDB 2W1NA 3C60D 3EH3B 1CGVA 2CKBL 3GIVB 3KCPA 4PM1A 2OCFD 3DROA 3U4BH 3BFWA 4UOJA 4JO3L 3GZKA 5SWZE 4Z7AA 5K9QI 2J71A 4HS3B 4RNRA 1RK1A 1VZHA 4O4XA 3K8MA 2JIXA 1YUHA 4KUCD 4Y5YC 1OF2A 5AOLA 3RURA 1ANUA 2BP0B 2IJ0C 3L5WA 1DVSA 5TE6H 4NP4H 4AJ0A 2GEEA 1BVLA 3HE7D 4L9LA 4MX7B 3U9UB 1JJUA 4HXBH 3IMVA 3LEVL 1XH1A 3PAZA 4MSWA 4B27A 4R90L 2QQNL 1NCAL 3KJ4C 2O5NA 4HHAA 1PLCA 2KZ7A 3VXSD 2GY5A 1IAIH 1KXHA 2B59A 4PJIA 4Y4HC 5FM5M 3ZYJA 3KPLB 3EJZC 4ZMXA 4APXA 4ATWA 1FHNA 2OXGB 4GEIA 2HKHH 1L4IA 3DA3A 3IXTB 2WWKT 2BERA 4UDUA 4G80B 5FW7A 4KRLB 2KBGA 4WWPA 2YSTA 2F54B 3PFQA 5FUOL 2OYLA 4K9EH 2RBLA 3O3DA 3IDYB 2G2RB 4NN5C 3OG4B 1A3RH 4QRBA 3ARSA 2QV4A 3BZDA 4HUUA 4YE0A 2DQCH 1HDMA 2PYEE 5FHBL 5AVYB 4HZLA 4XN7A 3QJHB 4OAWB 2XTSA 5DJ8A 2VQTA 1A25A 3VXQB 1OXYA 4R3SA 4HV8B 3LNFA 3VG9C 3L3GB 4H2AA 5D1ZB 1S9KC 2EDTA 3WIAA 3BLPX 3QIWD 2NW3B 4EUPG 2FSEB 2DBJA 5JDPA 1S8DA 1U92B 1MFAH 2ADFL 3QUML 4LSTH 3QHFL 1CLOL 4MJIA 2FBJH 5GGVL 1QYGH 4BQCA 4TKWA 3CAFA 3NGBB 3D3VE 3WJMB 1EAPB 1CXFA 1Q9WA 1UWFA 5C0JB 5LQBL 2FYYA 5KG9B 5KYUA 3GI9H 3IWUA 1ROWA 3MI6A 3RAJL 3I9AA 1YEFH 3SD5A 2WZPD 1B90A 3FH7A 4MA8H 2D9QB 2VW7A 4M93B 4JN1L 2FECL 4HIQA 4PYHA 2WP3O 4BSJA 4IKNA 2WIIB 2WNWA 1G9HA 5T3ZH 4Y19A 5HGHA 4Y9BA 5CUSL 3QQXA 3LQAH 3HRZC 7CGTA 4HWEL 4R97C 5TQ0L 4KZEL 1LWHA 2MIZA 3WDIA 1KXTB 3PJSB 1L0PA 2JMRA 4NKOB 1I3UA 3D39E 5LAPA 2YIHA 1ADWA 3HUJA 3QRBA 2HMIC 4ZYKA 3QUHA 2RAMA 4PCTA 2IDFA 2WXIA 4FKKA 1OE1A 3V4VA 4FQXC 5HHXH 5D8JL 3OZ9H 4YHOH 3HWBA 5JW4Q 5GRJH 2AQ3A 4TPRH 4KK9C 4HH9B 1Z1WA 3REWA 5IBLC 2VZVA 5CBAA 1E42A 2VDRL 4FF9A 4TTDC 1SJEB 2FT8A 1A7NH 3NPSB 3GBDA 3HUJF 3IJEA 1EBPA 4ZS7L 3ZZSA 2ESVD 4ADGA 1JZIA 3NSYA 3C8DA 3EGSA 3OHXA 1IIKA 3ZDZE 5A3ID 5EO1B 3W39A 2XJLA 3EH2A 1GC1L 1PGRB 2Y06H 5DR5H 4IBVA 4MQ7A 3US1A 1KPRA 4YWGL 1OSZA 1M9WA 1VIWA 2J8OA 4PJAA 3SE4C 2LW3A 3HR5A 4F27A 2VDOL 4KZDL 4J6IA 4PUXA 5AW8B 4IGBD 3MRBA 1M56B 1DE4B 3QO1B 5D1ZD 4KI5D 4NLHA 1OW0C 3POHA 4GSDL 2FR4A 3R19A 3QYMA 5E5LA 1U3NA 1BLIA 5LKNA 4LBEA 3FUFA 4AYNA 4PP2B 4DN4L 4WTQA 2W9EL 3IM1A 4C00A 4FXKC 3F65A 3UJJH 5JPMC 1ZHKA 3VI3E 2OMXA 1CQKA 4U1HB 4DGWC 4XMLH 5E6IA 3FBKA 4S1SH 3QNZA 4KH9A 3BD5A 3QQ9C 1ZT7A 5IOPB 3GSNB 3JWOL 4HCIA 3T6XA 2JCWA 2HFFA 2NT1A 3PABA 2ODIA 3CFNA 2H3XC 4HC1L 2FECI 2C7FA 4QGTA 4AEFA 5ENWA 2Q8BL 4UTBA 1HXKA 4X5XB 4O49A 2EE0A 1U2CA 5AW0B 4Z3EA 3BKCH 3O4LE 4JJ5B 7PCYA 2EJ1A 4Y2DA 2E86A 2H6UA 2AXTO 1TU2B 4JVPA 4PLJD 5L2JB 4WI9A 2BNRA 5LXGH 1Q9KB 1RQ5A 3D3VA 5ADXK 3SYQA 2GTWA 2C1OA 3C5ZB 3HNSH 3GMMB 3CSFA 2P80D 3TT1H 2MQGA 3TJPA 4L05A 1A0QL 4P05A 5IROA 3RPIA 4MVBC 3UTQA 3ZE0B 4C8XA 1PCSA 2XX1A 1P4IH 1FYTA 3D30A 3KPNA 3UTPE 3AREA 5CJ5A 5I76B 4PFEA 4G3YL 2XWXA 3FSAA 4FXLA 2BMKA 3QCVH 3A5VA 1TZHA 1V3KA 4PY8I 4WV1C 5CGMA 4PJ7B 5H37A 3ZKQD 2OTWB 3DTXA 4F1ZA 3MCG1 5AB2A 4FL4B 4PJDA 1ONQA 5KVFL 3X13B 1MKFA 1BAWA 2FNBA 4MDJA 3NCFB 1LLAA 5IJKC 1U6AH 1TPXB 3R4DA 3DHMA 4UILL 5DURD 3VXUA 2B1HH 3ARFC 3HUJE 5DUPL 2F19H 5C3LD 5C09A 5B5EO 3G6JA 5GS0H 1QI5A 3LD8B 3INUH 1AC6A 1MELA 3MGTB 3KVPA 1WZMA 1I7RA 2PTVA 3VACA 1G7HB 1S7UA 5CJBA 3WHXB 4ZXBA 3PYCA 3TC9A 1M05A 4Z18A 1E7UA 1N5AA 4H5SB 4MGXA 3V6OA 2UX7A 5CJ8A 3C2SA 2WLZA 1USQA 2FBOJ 2QZ5A 3NDYE 3VSQA 1U42A 4Y1AD 1SN0A 3PV7A 5F0JB 4DESA 4AJWA 2GK0A 3HI5H 3L3KA 4B5EA 1EDYA 1TOXA 3DGDA 1BBJB 4TNEA 1SVCP 4Z7QE 3K1DA 2YFNA 2C4FU 1GVIA 5DLML 3LKOA 2EDNA 3O9WA 3LEXA 4N2FA 4TV3A 4CVZB 3IGUA 3ATFA 2R8AA 3IJYA 4QRPA 5AVSB 4ZMOA 3HHMA 4LE8A 3ARGD 3A6CH 1QBAA 3BXNB 2FJFB 1FE8H 2VSDA 5IFHL 5GGRY 4ZW6A 3WGVB 1SJVA 3BH8B 3RB7A 3QORA 5C08B 4EAEA 3EJYC 4U6VH 4IBTA 5DJAA 1LE9A 3VYOA 3O6FB 4G8GB 2LFEA 2PO6B 2EYTA 4HF5H 2H41A 2QLVB 5F7YC 4XHJD 4O58L 3K2MC 5J1TC 2AP2A 5H37G 1NGXA 2BFGA 4Y4KB 2E7MA 4HWBH 2DI7A 2ESVB 3IFNH 3NACH 4HXAH 1T66D 2ARJB 1TXKA 1HE8A 1R0AL 4AXWB 4EQ3A 3G04A 1CL7L 1FO0A 3VH8G 5CR1A 1ES0A 4G9DB 5H2FO 3S36X 4I48B 3G9VA 3TN0A 5TH2B 3SJVB 4M3JA 4XN4A 3CZJA 1TO5A 2PR9A 3MLVH 1KC5L 2WJRA 4HS3A 1KPVA 2MHLA 5ANME 5CILH 5ABDE 4MNHB 3EJSA 2O6FA 4U49A 3IMUA 4PJ8B 4UUJB 3KGRA 1UJ3B 4P07A 3X11A 1Z5HA 5GGQL 3UAQA 32C2A 2KZ7B 5IHBA 2XE1A 2EXYC 1S7XA 3L3OB 3QDGA 4HMCA 4AYGA 3PNRB 3Q48A 3UZVA 4HKXA 4RISH 4X6DB 3PP3H 3FUJA 1SLUA 4KGLA 4PBDA 1JN6B 3T3MB 2EDYA 1JGDA 4IK6A 2IH8A 5DJYA 3W81A 5HYQA 3PRZA 4OF8A 2FNWA 4PS7A 1RUAL 3O2WL 1RK7A 4JB9L 4LQFH 3MNWB 5D1XA 5D7SL 1SM3H 5EO9A 3RVVC 5GZNC 5KSBB 1A4BA 5E1AA 4CSTA 1C08A 4M1DL 4TSBH 3NJFA 4XMPL 4BFIA 2X53A 2LTQC 5HYIA 4O02A 3FTYA 5KJ7E 4J3BA 2GFBB 4NC1C 5EU7E 2R8SH<