2Y7SA

Structure of a designed meningococcal antigen (factor h binding protein, mutant g1) inducing broad protective immunity
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSPELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR H BINDING PROTEIN
publication title Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2y7sA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2y7sA01
1YS5A 4O4UA 3UAQA 3PQUA 4QQ1A 2Y7SA 2W81C 5EE2A 3V8UA 2KC0A 3VE1A 4O3ZA 2YPVA 4O3XB 3HOEA 5T5FA 2W80C 4O3WA 4AYEC 4U9CA 4AYMC 4O49A 4O4XA 2KDYA 3PQSA 3HOLA 4Z3TA 3KVDD 4AYNA 2LFUA 4AYID 4AYDC 4O3YA 3VE2A
chains in the Genus database with same CATH superfamily
4H1LB 3NACH 4F92B 2PTTB 2NXYC 4KMLB 4UINH 3H4HA 3LEVL 1J8RA 4Y5YC 5I82A 1RZFH 3NYKA 2K0LA 2TSAA 2HT3C 1JHLH 3MRJA 2WBXA 4P4KD 2WLMA 1U8MA 4P0DA 2EIDA 2YA0A 4W9ZA 3KJ6H 3BLKA 4I48A 2OZ4H 4KTEL 4X6BA 3ULUH 2AKRB 5CLYA 2IV8A 3NBNA 3LN4B 3L4YA 3EOBA 3HFML 3AU0A 1KEGL 2HP4A 3Q01A 3WHXB 1X5XA 5E6UB 5ALCL 1YMHA 4KBPA 4MLIA 5H2BA 4WEBH 4XN1A 5ADPL 2AZAA 1JV2B 4IGBD 1BVZA 3P77A 1SXSA 3BQUD 1ADQH 2XN1A 3EJSA 4L9DA 1E5YA 3IWUA 2BNQE 4G7VL 5F6HJ 2DLGA 3V4PL 1PL3A 4DUXA 1I31A 1AYOA 1OVZA 3MRCA 5KZCD 2HVKB 1S9YB 2EC9U 3ZKMC 3FYEB 2C7FA 5E5MB 3SOBH 1XGZA 2VDKL 4L8DA 1N4XL 3VFSB 2P8LB 5IOPB 4PJXE 2GI7A 3STLB 4PJ9C 1KLGA 2BNQA 2PKDA 3MUGA 1AQMA 4JL2A 4AITA 2W80C 1IC4H 2DLEA 3K6FA 1KFGA 1T1XA 3PWPE 1GHFL 2VDPH 3GTVA 4WI9A 1DL7H 2QQNL 5GZND 2AF2A 3KNBA 4X4ZA 2Q3AA 3NIFB 2MNJB 3U7WL 4MAUL 1XEDA 5HDWA 4F7MB 1XF2A 4PJXA 3DXAD 4ZOEA 4U33A 3ZE0E 5IR1A 3KLQA 5GRVL 1K72A 4WUUE 3N9GL 4LLVB 4K2UL 3SO3B 4OM1H 1T0PB 2XPZA 3DV6B 3I85A 1FL5A 1CU4H 2HVJA 2E5EA 1J9RA 4RSVA 2MKWA 1JZ8A 5KYNA 3PWPA 2VMCA 1D6VH 3L4VA 1I9JL 3VXPA 1EHLL 3IDMB 3KW8A 1MLCB 3CBJB 1A7BA 4G82A 4I1RA 5IBTL 2WGNB 3C5ZC 4W9CC 1KN2H 4H5SB 2YAOA 5IW6A 2BVTA 4MCMA 4FL4C 2OV0A 1EZVY 3CK0L 4B9CA 1FAIH 4UTAL 4HKXB 5JPMC 1LVEA 3LKPB 3LK2B 1U4FA 4FLQA 4N4YB 2P5WE 5CR1A 4JO1H 1EHXA 4WU5B 3AACA 3GXFA 4AEHL 5KTEH 3S96B 5J1AB 4WJG3 3REVA 4PCKA 2YS4A 3OKKA 4IBVA 2YC1A 5ESVA 2AV7A 5ADXK 2F7RA 3W9DA 1MDTA 4MJID 5ID1A 1ITCA 3I3DA 2PXYC 2XVBA 2N7AA 3QWOA 3T24A 5IB4A 2GAZA 1IT9H 2FTAA 3HBQA 4JHAH 2EYSA 4B9GA 4HLZG 2QMJA 1XEUA 5FECA 3IDIA 4XCEA 1OSEA 4BGDA 1MFNA 2ZCHH 1GA2A 2GI0A 4RGOL 2E6PA 4GMSL 4OLUL 4LFHG 1Z9SA 4JDZA 4LF3B 5DEGA 3SQBB 2F0CA 1NEUA 2GUOB 2AJ3A 4W9DC 4PEEA 4MD5A 3LDBC 2JB5L 4KQ3H 3DHJA 5EU6E 1OK0A 5J4MA 4G11A 4NJAH 1OTSD 1I7TB 4L4VD 4TVPL 5EG6C 3UBXG 1FE8H 1IB5A 4M1CD 2J6EH 4G43A 5KBNC 2YGOA 4DN4L 4GH7B 4XNZC 4YAQA 4U1HA 4ZQKB 1A6VL 2G3MA 1RVFL 2XQBL 3CN3A 4C83A 5IB1A 3QWQB 1OAUH 3OC8A 1IEAB 3C09C 3JWNG 1S5HA 4OJFH 3WL9A 1BFSA 1NSNH 5EOCL 3TWCL 3WKPA 5I1LA 1DVSA 2X41A 1A6ZB 2BCKA 4LCIL 2B08A 3CD4A 4F2FA 1HEZB 5D4IA 4MJ2A 1GJUA 3G9AB 3KPRE 3JV6A 3IJYA 4ODHH 3V5HA 1BREA 3KGRA 3T71A 2HWZH 2NY0C 4MMYA 2R0LH 5DZVA 5D4HA 3VFTB 4YQXH 1FIGL 2L0DA 4XN9A 3SGDH 5FUZH 4ERSL 4ZTEA 2JMMA 5T1KD 4LSEA 3UYPB 4WU7A 4PJHA 1NCAH 3U0WH 4JGNA 2H32A 1QPKA 3KPRA 5AEAA 1UOKA 1UD2A 1NGPL 1OAYH 5HYJE 3WEBA 1GOFA 1ZTXH 4KC3B 1G6RL 1JVLA 1MAMH 4OJDH 5LN4A 4HHAA 5F9WC 2FUTA 4LSFA 4QRPA 2DD8H 3NCEB 1LO5A 4K9JA 4X6CF 4ZOAA 4AVHA 4XX1E 1ACZA 2FZ3A 1TU2B 3P4MB 4FTVB 5DVKA 5TQ0H 2VR8A 5JHDB 1BQHB 3STBA 3WJMB 3BP6A 4JKPH 1OWRM 5DS1A 4P3WA 1MCFA 2K0RA 3MRDA 5AWNL 4Z7WF 5HYJA 4QO1B 4G8GD 4RMTA 4LFHD 3DKHA 2CHZA 4O3YA 2PW1B 2NY4D 1NIBA 2ZKHL 1CZ8L 1CLOL 5C2UB 4KK8C 4MNQA 4N2KA 5M95B 5DR5L 5EUKB 4U0RB 4WI0A 3SDDB 2XG6A 4NBXB 5FLUA 3LQZB 5B21A 4F8LA 1FFNB 3LKSB 3A67L 1TVDA 2L7QA 2PR4H 3M45A 4UNVA 3ATBA 2IBZX 5E6RB 1FIEA 5CEYA 1XR8B 3NRFA 4TNEA 3HRPA 5BMFL 4UZSA 3OPZL 4WWKC 2XN9B 1A7NH 5IJVA 3FHQA 3L2LA 3U6XS 1NKRA 4K3JH 1G0DA 3S97C 4WDIA 3MRHA 1FYHB 2CD0A 1PZDA 4ANXA 3GHPA 3WMSA 1CDUA 1E9PA 3O3AB 3U36A 1KN4H 2YD6A 3B5GA 2EDOA 4LHJB 5I1KH 4HEPA 4PHZA 3SPVA 3BZ4B 4NWTH 3NCYP 4NC2B 1TOXA 3DOIA 1KWKA 3ATDA 4R84A 4M5YL 5CFHA 3T0WA 2NZ1A 1F90H 4O02L 4E9SA 2CGYA 5DUJA 1CD8A 4NUQA 5E1AB 2Y69B 1TJHL 3SKOB 3WJJA 5IWLC 2CDGA 1CBVL 1SLVA 1S3KH 4AMWA 3FQNA 2X3CA 4TTDD 5B1JA 2VDRL 5AB2A 3K1DA 3PWVA 4P2AA 3ECUA 2VL5A 1DZBA 3JTTA 2A9DA 3DYMA 2BXZA 4NOBA 2HKHL 1KEMH 3MLSH 5K39B 4JUSA 1CFVL 1MHPL 1KV3A 5C0GB 4MJ6B 2BC4A 2AK4D 4A7SA 5ECJE 4HUXA 3TPUB 2NNXA 4ZYKA 3LEVH 1MRCL 3SY0B 4EKJA 1EXGA 2E0PA 4RBPH 1GTNA 2N4IA 3NDYE 4ZW6A 4D0CA 1KF9B 1URLA 3QZOA 1VADB 2YAQA 1Y1DA 3OJDA 1EVTC 2N0KA 1CT8A 2PF6A 2NNFA 2RA1A 4Z77A 4P4RA 3V52L 5GS2D 4UQ3A 3FFCA 5JQ6H 4MXQC 2P8MB 5SWZD 2FECI 1BZOA 3QJUB 3MNVB 1MCDA 3QPKA 4N5ED 3HFMH 1KEGH 4XO5A 5FYLD 1YUHA 2BP0B 1OP4A 1KDIA 4KROD 1IZJA 1AMXA 3E8VA 5ALCH 4RGND 2A9CA 3WUWB 3D69B 3QWRA 4M1DL 4PRID 4LPCA 4C4KT 3WU1A 3AITA 4OKVB 3C5SB 3KAAA 4KUCF 2YFNA 4DW2L 3HNSL 4F8TA 3VE1A 4G7VH 3V4PH 3O9WB 1QLRA 2A73B 4UB0H 1X9UA 1RLBA 5FW7A 3VMNA 1ICTA 4KR8A 3KYMA 1WG3A 4HIHB 1N4XH 4XVTL 2BVEA 1P9MC 4G42A 3MCG1 3FSOA 4NN6B 2PLTA 4DZBB 4PRAA 1L0YA 2NDFA 2WCSA 3FB8B 1AGCA 2LGNA 3RRQA 4FYQA 1P2CA 1GHFH 4TRPL 3IDYB 2QQNH 2OX5B 5DZJA 4QI3A 5TDNB 3FONB 3N9GH 4DZ8A 4K2UH 5A2JH 4GBXC 1X5GA 3S3SA 2OMWA 4Z7UF 4Z76B 2F19L 4G8IB 1K3IA 1PX3A 1TPXC 5E8PA 3SDCC 1UJ3C 1CG9B 3WXVL 2D2CC 3ARDC 3NJGA 3SOTA 2FWOB 2VDLB 3CFJA 5FVNA 2A83B 1I9JH 1EHLH 1TQCC 3K2KA 3FUIA 4IRSD 3VXOA 3LEXB 1MHHB 5IBTH 1QBBA 5FYJL 1BW8A 2JQMA 3G9VA 1UZ8A 1I7RB 4JPSA 4DGIL 4RDQG 1YY9D 4I88A 3RY5A 3DMMA 4JO2L 5CZVL 3CK0H 4OF7A 4KX9A 2AQ1A 1T04B 1J5HA 2KLRA 4CU6A 2FO4B 1MI5E 5T33L 3EUUA 2XXFA 2C4FT 4TTGA 2PP9A 4AEHH 1ASQA 2C1OB 1X44A 2VN6A 3GZKA 3K1KC 2Y0LA 4Z23A 1JG9A 4LLUB 2GC7C 1P69B 4X0NA 1MUJB 3LKQB 3C6LC 3RGVB 3LIZA 2ROXA 2EDKA 3IWVA 2YEVB 4ILDA 4JFTA 3WCYA 3LN9A 3HPLA 5MEOB 4MNGE 2YAMA 4NNPL 2YD8A 3K8KA 4OKDA 1MI5A 2R69L 4NO0B 3STZA 1MVFA 3TA4D 3ELAT 2JJSC 5T1LB 4M8QB 2FK9A 1L6XA 4LLWA 4WSJA 2MNUA 2ZUQB 3NIGF 3RVVC 1BM3L 1L9TA 2LTQC 4K94C 3CXFA 5JOPE 3ZTCC 1U8PB 5ICZA 1G7PA 5HY9A 2NUPB 4KO7A 1KXTA 3O45B 4OLXL 1CL7I 4M7LT 4EMZA 1KXHA 3KJ4C 4KY1L 4ANWA 4U3CA 4RGOH 3TEZA 2BMKB 4GMSH 2RJMA 2YJLA 4WFFE 2F53E 2JB5H 5LJYH 2J25A 3EH4B 4MWFA 1H6TA 1JZFA 1IM9B 2EXYC 3OLIA 4ADIA 2ZX9A 3UAQA 4OV6F 4TVPH 1PX4A 4NJ9L 4PJDE 1HC1A 4NM4L 5EZJA 2GY5A 2G5UA 4W4OA 3O8XC 4R5VA 4XR8C 3BJ91 5ADXL 2ESVD 5GS3A 4DN4H 5F1OB 4I5BA 2F53A 4PBXA 2VDOB 3GSWB 3MMEB 5EOCH 2B8OT 1NC2D 4BK5C 5B66O 3VY9X 3PUUA 1BIIB 3LHAA 4LCIH 2ZXWB 2R83A 3KPSA 2F18A 4X6DA 4L1DA 1TLMA 4BQBA 1GZHA 1KC5H 1PG7L 4G5AA 3K19A 5L4MA 3U9WA 1R3KB 4DWHA 3V0AC 1WZMA 2G30A 4WENB 5DZLA 3RBSA 3H9ZA 4E41B 5DRXA 1FIGH 3RVXC 3VZUX 5DJZB 5K9KA 2BY3A 1JF5A 2VN4A 2AXJA 3DVGA 3EYSL 4TLTA 5BZZA 4ERSH 3RWDA 2DWXA 5MP6L 4PJXF 1OP5K 2FDBP 5D7HA 1TQTA 3VXSE 3MBEC 1NGPH 2YGVA 2OZ4A 1F3JB 1G6RH 3AG4B 5G39A 4PRBB 3HG3A 2NX5B 2IBZY 4OJYA 3X2QB 2W9LA 1XL4A 3QUZD 4PV1C 4N59A 4HLZH 2XE1A 1ZMYA 2HA1A 3ZE0F 3AAEB 2KDGA 2VERN 3VXSA 4DQOL 3RWGB 3R06B 4J3VA 5AWNH 2JH2A 4IIQB 1E4KA 2EC9T 2QGCA 1J05B 1EO8H 2EIEA 4P49A 5ITBL 2OJZL 2B7DT 1ADQA 1WA1X 2EXWC 3EHBD 1XGPB 4JG9A 3UROR 4HGKC 5CLTA 1CZ8H 1CLOH 3US0A 3V4VB 2BFVL 3WGVB 4P23C 4CADB 1MY7A 5KAQG 2WWMD 5DR5H 4FXTA 1ZSHA 2D31A 4R7NB 2Q6WB 3AW5A 4QTFA 3U46A 2ED7A 3UP1A 2VLRA 3TJPA 1S6NA 3A67H 1YJDL 1RK0A 4RAUA 3D9AL 4U1MB 4DEWA 1ZANL 4Z7WB 1RL1A 5BMFH 1IAOB 3JWNH 4R7DA 3OPZH 2WNKA 2V5TA 2WWKT 2J8UA 1I7ZB 2PYEE 1NC4B 2IGFL 5JA9A 3QO0A 4AG4L 1Q0YL 4WEMB 4AUJA 5FA4B 4U49A 1SJHA 1YC8A 4L3FA 3BP7B 4W9GC 4A7TA 3BN9D 3DX6B 3CHSA 3SDAD 4JFOB 5IQ9A 1IC7L 1NCIA 2DQFA 3AB0C 2EEAA 4MKTA 4X7TA 5E6IC 4OZFG 4H8WL 3WKML 3B2UD 4FYTA 5HHVL 3MFFA 4RA3A 4M5YH 1CL7L 2R0WL 4RRPG 3FUMA 4GNKB 5DHYB 3EBAA 1L9OA 4O02H 2LU5A 3CNKA 5HHME 4N0YL 4RMUA 3MKKA 3H7BA 2WLHA 3UYRL 1XCTB 1KJVA 1TJHH 2X44D 4H8HA 1CBVH 4U7KA 5IROC 2K7PA 5IGXL 2FUQA 1Q9GA 3TEWA 2VDRH 4MAYB 1GY2A 1CFTB 4LT7A 1CLZL 2WLNA 4AYDC 3K46A 5E4EC 4BDVA 2HKHH 4UQ2A 1CFVH 3QYCA 1IGIL 4AQ1C 5LN8A 2XYBA 4J2XA 4MA7L 1GGYA 1BT9A 4IBTA 4NRYB 5DK2A 5DFVD 4JFYA 1MRCH 2ZTBA 1PDKA 2Q86B 1MVUA 2FJFA 3QW9A 2B14A 2WHVA 3DIVA 2FEDD 3FAWA 4R5TA 4FNPA 4ONGL 4PJHF 2IVFC 3KDMB 5HDLA 4ANVA 1XZ0B 4RSYA 1YN6B 4KZ0A 5ECGA 3O2WL 3QJFA 3ETBF 3V52H 5FA3B 4P9ML 5C0FB 5GS2H 2CLRA 1IM3A 1E8XA 2JIXA 3I74A 5AVUB 1ZEAL 1JNHA 1KB3A 4LKXB 4JY6B 3ZZ1A 2NRDA 5DHXB 1II4E 4FA7B 5CN2A 4ODTL 4FG6D 1EXUB 2CR3A 5FYLH 1GYWA 4NO5B 4XHJD 4X4XA 5DVMA 2NNAB 4M1DH 1IAII 4QHLA 3BFOA 3FJTA 5FGSA 3VXMD 2EEFA 2IWGA 2EE9A 2C9QA 3II1A 4ODUA 4WW1B 1AQKL 4S10A 2SEBB 3LQAL 4DW2H 4J3OG 2WSDA 3BP5A 5I24A 3QUGA 1RK1B 2J6EA 3KWWA 1QSFA 3H0TA 4KITB 1HINL 5C0AE 2XBZA 2YPLB 4G9FA 1AZUA 2BHZA 3DRTA 4JY5L 1KOAA 3CSFA 5DJ0B 2O26U 1N2RA 4PY8I 1YS5A 4OVUA 3IPFA 3VFWB 3OL2A 4FEIA 3QIUC 2WKLA 4APQD 2YMXL 3LH8A 3TA3A 5I8CB 4KXZI 1PU0A 3J07A 2FRGP 1SF5A 1AP2A 1R4XA 3M7OA 4TRPH 2A74C 3QXWA 1M6OB 5TH2B 2Q8AL 1XGQA 1KBPA 3QHFH 4E9VA 2WXNA 2F54E 1YN7A 2GJZB 4G5ZL 4PN6A 5TDPB 3WFCL 5IKCB 3DO7B 2VM3A 4EJ1C 1O75A 3KYKH 4ZW3A 4PRPB 4HX1A 3E6HA 3KXFB 4GKSA 4QWWC 4RMVA 2KZBA 4FQ2L 4WTQA 1CLVA 2H26B 3RURA 3WXVH 5FO9B 4AIXA 2JJUA 2L4OA 2ZUXA 3QEQE 4YSPA 3A21A 3V0HA 2F54A 1QQDA 1T21B 2EILB 5FYJH 2PPDA 3HWBA 1MCCA 1U8NA 2Z34A 2OMYB 1QLFB 4DGIH 1W80A 4JO2H 5CZVH 5ANMB 5HYSB 5LQBL 4N1HB 4RA0C 1FFRA 1OIOA 3BZFB 2WD0A 4FEMA 4Z7UB 4QRRB 1AD9A 4PJ7A 4XTRC 1S7QA 1TMCB 5T33H 5AB0A 1YQVL 5HYQB 1T6WA 5MI0C 2RGSA 2VZVA 4H8VA 2F7PA 2FEEI 4YLCA 3CZGA 3VRIB 4DO5A 4I0CC 1ZHKA 2OYMA 3MTRA 5DQ9B 3VWKD 1FVEB 2WXOA 1G7HB 4ZOBA 5JHLL 1DO6A 1H3WM 1NCGA 4OQ1A 1A1MB 4NQEA 2H3NB 1N64L 1OGAE 4A2HA 1TLKA 3BGMA 2JJVA 2O72A 4J3OD 2OTWA 5CGTA 3FCBA 2DAVA 4CDHA 3QFJB 2N7BA 4NNPH 1INDL 2VR4A 2H3KA 1CGVA 1S7WA 2R69H 1EDYA 1HNFA 3HS8A 3IDGA 5GRXG 1MHCA 1CFMA 1YEEL 2Y72A 3HE7D 3UTOA 3ASOB 3QXDB 1L9NA 1LDSA 1VDGA 4ORGB 1M57B 2BIQA 2DKMA 3NCFB 4F80A 3ZBMA 1BM3H 4AGLA 1HIML 4UV4L 2VN7A 3W56A 3VGGA 1PNCA 3GXDA 5AW5B 4OLXH 1U3NA 4P2OB 3ESPA 3OGOE 3TJHC 2OCCB 4KY1H 1TZAA 4X9FA 5AD0A 3TVMA 2W0PA 3UEQA 5IB5B 5CZXC 3O2DL 3T6VA 4MS8D 3IMTA 3KBEA 3GBDA 1ASOA 2WBJD 4APXB 1UG9A 3GSUB 4A1RA 5EO9A 4YDKL 3H9HA 4N1EA 4HGWA 1Q1PA 1F00I 2PPCA 4U7SA 1SOKA 4NZTL 5EEUA 2IG2H 5D7KD 3MRJB 4NJ9H 3NIGB 3WNLA 2X1WL 3VGAC 1FJ1A 2YWYA 4NM4H 4OCYL 3FFOA 1MWAL 3RJDA 3C60C 4I48B 1UJ3B 3RPBA 2Q7NA 3DRQA 4PRHD 4X6BB 2BSEA 1RMFL 3OKMB 1U3HC 3KPOA 4WW2A 3EOBB 2IQ9L 4RISL 4K8RC 3NCJL 4X8GA 1IAIL 4NQDA 3T4AA 3N3EA 1NGWA 2ZX8A 2LHFA 2GSIA 3UOAB 1IQWL 1YMHB 2GJ6E 4YBLB 4WO0A 4DGVL 3FBQA 3HMXL 5GGUA 2WNWA 3L5WA 3US9A 5A3ID 4WVRA 4XO3A 1USZA 3ML9A 4QKXB 2AXTO 3TBBA 4F9LA 5EC1A 1P4BL 1JTTA 3UX9B 3P1VA 1S9KC 3O3UN 3AXIA 4Y4KC 3DDFA 4BM7A 1JZIA 1CF8L 3RWFA 2ODHA 2GK0A 5FGBA 2GJ6A 1PJ9A 2AJSL 2VCOA 4L8DB 3MA9L 4P4KA 3VD5A 5C71A 3WO4C 2DJUA 2B39A 5FB8A 2X38A 1L5GA 3BAXA 3U1SL 5I66A 3WMPA 2XG5A 1U8IA 2BNQB 2XTQA 3PABA 3MUGB 2Q2EB 1ROCA 1T7XA 4LCCA 1HL8A 1S7XA 3VTMA 2QVMA 3FH7A 4IDLA 3I75B 3TPKA 4HIXL 3KNBB 3VGDA 1GGCH 3AGVA 5KUKA 5I76A 2I5YL 1T7WA 4M6NL 1A4KA 3MJWA 4JO3L 1XF2B 3VXNA 4DQOH 2FIRT 3L3HA 4NO2B 4PJXB 4IOFC 4BFOA 3EDDA 5IMKB 2AAVA 1KGCD 5IR1B 2YARA 4DP7X 5BQ7A 4JMXA 2L7EA 2OJZH 1FL5B 2HVJB 2EIMB 3PPSA 5BO0D 1JDDA 3P9MA 3VYOA 1P6AB 3PWPB 5FUCE 3V4PA 2BFVH 4A2GA 4YFLI 4JX0A 2GT9A 3IGAB 5FCSH 3IGKA 3NSJA 1RZIA 4HIIA 4UZGA 1ZKAA 2ZXGA 3W39A 5H4ZA 1HN1A 2Z92B 4NKOB 5IW6B 4WUUB 5CLXA 3M1BB 3MODL 4JQXA 3DXAE 4G9DB 3D9AH 1BDYA 1ZANH 1IKNA 1W16A 4U05A 3VW3L 2NCEA 3QR2A 4MNHA 4NZDA 3ZSSA 2CE6A 5E8NA 4TM9A 3A23A 2JI3A 1OAQH 2A4ZA 4HHWA 5CHNA 43CAA 4HP5A 1HSBB 5GGVL 5GZNA 3REVB 3Q05A 2IGFH 1W8NA 2ED8A 3S2CA 4AG4H 5KVFL 1Q0YH 2OP4H 3OKKB 2BP8A 2ZUYA 5GGRA 3QORB 3DXAA 3UZEA 3IMRA 2AV7B 3W9DB 5ID1B 1KNOA 3RTQC 4CNIB 5KSBE 1IC7H 4E42B 2P5WB 5IB4B 5EBGA 4WHTA 3WEXA 3MJGX 3WKMH 5IVXE 4OZGE 5HGHA 3DURA 2DYRB 1RK7A 5HHVH 1IKOP 4G6FB 5M7QA 2EYSB 2WJ7A 1CL7H 3MSPA 2R0WH 4CU7A 3IDIB 3L3DB 4XCEB 3BPOC 1S8DA 2WUBL 3WLBA 4YSSA 2HVBA 4M93C 1IX2A 3LXUX 3UYRH 1MELA 3E6FA 4J8RB 3ZTNL 4GUCA 3T4YB 1FFPB 5IGXH 1Z9SB 4JDZB 2ZG1A 4QAWA 4UTAA 5IREA 2AJ3B 1CLZH 2ZOWA 5DMKB 4PJDF 4ZOCA 4ZQTA 5E9AA 3BHBA 4J8QA 4X5PA 2C1PA 1IGIH 1E5ZA 3JYBA 1SFDA 4MA7H 3MRFA 3GEWB 3SYOA 4LCVA 3D50A 1L7IL 4MJIA 5D6DC 1IE4A 2XKNB 3CFKB 4YAQB 2ZQKA 3BXNA 4G8AC 4QY8A 4C83B 5IB1B 2L7UA 4GEJA 4XC3L 5D5MA 5C0IA 1S5HB 5J1SC 4KO9A 3JV5A 2HLFC 4KPHL 4ONGH 5EU6B 5GQBA 5I1LB 3O2WH 5DJXA 1QFUL 4ZO7A 4P9MH 3TCLB 1BECA 2EADA 4TVPE 3BKMH 1AJ7L 1MZYA 3JV6B 1EQWA 3V5HB 3CDZA 3HIZA 4ODTH 3AM8A 3O3BA 1BQRA 4MMYB 3PHOA 4JFEE 4ETQB 4GRLD 4RJXA 1RQ5A 5IVNA 3QCVH 5BW7A 1IMHC 1I53A 3JSSA 2CSPA 3QDME 3X1GA 5SV3A 1AQKH 4PJHB 4WU7B 5A43C 3NEEA 2YN5A 1TVBA 3RG1C 3LQAH 5EDSA 4JHBA 4JPVL 3KPRB 3D1MC 2XTSA 3CVDA 2X10A 3QGVA 1HINH 1J9CT 5BS0E 2Z31C 1G1OA 4OZFH 1V3LA 4JY5H 2Y0KA 4HHAB 1LEKB 4QRPB 3AG1B 4OGYL 1TSHA 4ACTA 3QDMA 5DWPA 4L9LB 3L9RA 4EDWL 5E94B 3HE6D 2EE6A 4NERA 2IPUK 2DQTL 3BP6B 2APSA 3S34L 3IE9A 2YMXH 3MRDB 1G5GA 5HYJB 1P5UA 3WFHA 3ZE2E 1HL9A 3G5ZA 2Y07H 1GMIA 4EZLA 4IKNA 4IKJA 2Q8AH 2CA3A 4ALAL 3NZ8A 1FG2B 3B37A 4YHIA 3UPCA 3WFCH 2MPVA 4DCQA 5EEZA 4XMKL 5JOFB 5T1KA 5CKGA 3FT3A 1KJ3L 1UCBL 3I84A 4FQ2H 3FKUS 4C8XA 3K6OA 2WVUA 3IJSA 1NMCC 5KBKA 3GJEA 2HG5B 5DC0A 4ODXB 5BOPA 2VDNL 1G6RA 4NHUA 5IJVB 1JAEA 1KZYA 2VC2B 4WDIB 3MRHB 1OTTD 3KLHD 3CAFA 4FN0A 2Z7UA 4FFZL 4YX2L 3UG5A 2OJEA 1E9PB 5EB9A 4ZAKA 1YQVH 5ABZA 2J5WA 4G8GA 1XAKA 4U7MA 3U36B 2YMTA 4MXWL 1H5BA 2X7LA 4MVBC 1FBIL 2QJDA 2HX7A 4XBMA 4IIZA 1DANT 4WV1C 3SPVB 5JHLH 4U6HA 1U95B 3M07A 1MF2L 4I3GA 4S1DD 4IHBA 1N64H 1EZUA 1XF1A 2YK1H 2EO7A 4J3OH 4LEEA 5KBMA 4M9OA 1WWWX 3MRRA 3UBXA 4EI0A 3IVKA 1INDH 3CSBA 4XO4A 4PJGA 3DTDA 1QD0A 1SLWA 1YEEH 4A55A 3W81A 2X70A 5J06A 2CDGB 3HUJE 1MFVA 2QPEB 5B3NA 4PJFE 1HIMH 4UV4H 3L16A 3FT0A 3DUHA 3PWVB 3T0AA 3QEHA 3JTTB 3U1PA 1F41A 2WXRA 1OP9A 2Y36H 3QULA 3O2DH 3CSYA 3OB0K 2BC4B 5KUMA 3ZPDA 2HKFL 3OR7A 4LVHC 4HUXB 5A6MA 4YDKH 4P48A 1GSMA 2UZXB 5D5DA 5J3HD 2DLHA 2CJ3A 3UO1L 2BS71 4NZTH 4D0CB 4Y19D 3VX1A 1TO4A 3PNWA 2EP6A 5HPOA 4FFTA 5I71B 3U4EB 1CT8B 5F8QC 2V8LA 3FQRA 5KBPA 4Z77B 4P4RB 4OCYH 4U3SA 1MWAH 5FHBL 4UQ3B 3B8SA 4IEFB 4O02A 4OJCA 4RWHA 1RMFH 3DX0A 4OGQC 4OI9A 3FUDA 4NI3A 2ZICA 5C0BE 2AK4E 4GO6B 4R97C 2IQ9H 3EJZC 4LPUA 4RISH 3NCJH 1YUHB 5BRZD 5KJ4A 1IAIH 3UDWA 2H0JA 2V2WB 4XWOC 1YEGL 2E74C 2ZWSA 4UWQB 4F4BA 4WUKL 1IQWH 3Q44A 3F84A 4DGVH 3S9DB 1UB6A 3HMXH 4NZJA 4GG6E 1LDPL 4Y8AA 1KLUA 2NTFA 4PS8A 3P2TA 5MI0B 3RFRA 5EC2A 4FQXD 2AK4A 1QLRB 1P4BH 3W82A 2WQRA 4F91B 1I7UA 5DEFB 1E6OH 2DW5A 5AOIA 4NIYE 5JOEA 1QWNA 3AA6A 2DDQL 1CF8H 2P48B 2F58H 3KYMB 3PE9A 4LSHA 2ADJA 5LAXB 5TQ2H 2OTPA 3MA9H 1H6UA 3L4UA 1G7MA 1T03L 4GG6A 3A4AA 2AHIA 4HIJB 4KXZH 4G42B 5J89A 3U1SH 1U8JA 4PVLA 2Z8VC 1UACL 1CYGA 5SWZA 4AVJA 2YUVA 1AGCB 4BWUA 1YMME 2F6AA 5C07D 2YPVH 4FLRA 4LHQB 4HIXH 1JZ3A 4HIPA 1JE6A 2I5YH 5C9KA 4JO3H 1DVZA 5J56B 3WJLC 2J55A 4YVNA 4DZ8B 4RMRA 2FCBA 1AZRA 2OMWB 4K3HA 4JMNA 5E8PB 4AX3A 3RWCA 3MGAA 1GVIA 3WXWL 3KVDD 1JZEA 1XZWA 5G4NA 4P57A 5B1KA 1P84K 5FX3A 2BSRA 3IFPB 1K6QL 4HVBA 2NR6C 4BFNA 1OP5H 1UZ8B 4DUWA 3MODH 4XO9A 5DTFB 4TSCL 3N44F 2EDEA 2FSEA 1NAML 4Y16D 4QYOA 3DX7A 2X4PA 3VW3H 2KMWA 3MOAL 2ZSVA 4LASH 4ZG1A 2CLZA 2LV4A 2W9DL 3HG1D 5KBDA 5EF2A 5JMOC 1J8HE 3ZMEA 1WFIA 1YQ2A 2QZ5A 3P11L 5GGVH 1BVKB 5KVFH 4I0PD 1IFRA 5A2IH 2CJTA 1V10A 4F8NA 1UVQB 5FYJE 4CVXA 1EAPB 1J0YA 1U93A 3KD4A 3L54A 3VNZA 4XN7A 3HPLB 3CX5J 4UF7C 2OXGB 4LB8A 4B9KC 4J3TA 2X1XR 2Z9TA 1MI5B 4H0HB 4K3GA 3IDXL 4M8RA 2OYKA 3VFOA 4LLWB 2IH1B 2MTAA 4IRSA 2WLJA 4BSWA 2WXJA 5ICZB 1G7PB 2FQDA 5HY9B 2WUBH 4LCUB 4A2EA 3NESA 2NQDA 3MYZA 2Y1ZA 3A6BL 2E75C 4RLBA 2XDHA 4MNGB 3ZTNH 1PD0A 1GOGA 2DQCL 4B53A 4AYFA 5AZEL 2NZIA 1RUAL 3QUYD 4Q7DA 5ESQA 2BP3A 1Q9KA 3VI4E 1F6AA 4FQLL 5JTWA 4MWFB 3BT0A 3UTSD 3B7RL 4Q97A 3NJHA 3LRGA 1G7QA 2ZCLL 4K5OA 5FM5O 3K91A 5CGYD 3F62A 5EZJB 2KXPA 1FZJB 2VR3A 4ELMA 3ARWA 3NJIA 3LS5L 3CQQA 4JRXE 2R69A 1U91A 2F53B 2DQ6A 4I5BB 4XC3H 5FUCC 3VI4A 4UBDD 1AQHA 3COOA 1X5HA 3D4YA 4WFED 1MJ7L 1O7VA 4ZODA 5E56A 5FUOL 1QFUH 4PJDB 3BRYA 3RAJH 3KPSB 2HTLC 1UXWA 4LDOB 5F3HB 1ZHNB 3AA0A 1AJ7H 2DLTA 1OARL 1P84J 3U0TA 2OMNA 3NN8A 1JVKA 3O4OC 4XMXA 4MDRA 4RDBA 5CLWA 2B9AA 4JRXA 4TS6A 2ZG2A 3TFBA 5DRXB 2PW2A 1I8LC 1TQWA 1NBVL 3DVGB 1QOKA 2DMCA 3WNKA 3B6SA 2J71A 4M7KL 3NJJA 4KVPA 3SE4A 4MCZA 1D9KD 2LQRA 1MAJA 3CH1A 1VJSA 2Y25A 4GB9A 3G6JE 1BZ7A 4RAVB 1DQML 2YMOA 5MHSD 2C8NA 2MNHA 5E9DE 5I23A 2WP3O 2ZYSA 4XWGL 3OWRA 3SN6N 4B96A 3GP6A 1CDYA 4MQ7A 1SOXA 4OW6A 4XMUA 3T0SA 4XPFL 5HDBE 3PJSA 4EDWH 3V0VA 1DBBL 4RWYL 4CC4C 4K7PL 2DQTH 1K8IB 1ODAA 3VXSB 3G6JA 1M2OA 2ZUTA 4GKOA 1TCMA 4GIOA 2XQYK 1NL0L 3NP4A 4NZRL 4BXVA 3M7FB 2WOYA 2J21A 2EDDA 4B3VA 3VUAA 4ALAH 1MZZA 4BFBD 4XMKH 1BIHA 2XXCB 2A3TA 3MRKA 4PJ8C 4FNSA 3CU7A 2D31B 5JNYB 3EO9L 4GRMB 3QRAA 1KJ3H 2WM0A 1UCBH 2QADC 2AJVL 2NY6D 1KJMA 2KLSA 2VLRB 4QCIA 3U46B 3CSTA 2FO1A 3SPHA 1RK0B 3X1EA 1PQZA 1YAZA 1TETL 4XI5D 3MV11 3UG3A 2NTSP 3BSHA 1J11A 2JELH 3ECQA 4U1NA 1EHAA 4O3WA 4AUIA 1H8SA 1JCKA 1BAWA 2VDNH 4R7DB 1GGBL 1XD1A 2VYRE 2R1XA 1UGNA 3MU3A 1AHWA 3QUZA 5FKPA 4DVBB 2J8UB 1WS7A 2VDPB 3BEWA 3U2JA 4IM8A 3QO0B 4WHCA 5GGSB 5IHWA 3L5IA 1OCOB 4FFZH 4YX2H 1C08A 4YSEA 1SJHB 5DZOA 4C56D 4AYBA 1MM4A 3VO0A 1FBIH 1OHZA 5IQ9B 4OZGF 1ZT1B 2XWEA 4X7TB 2CO7A 3VD2A 2ZKYA 4OM0H 1MF2H 2PYEB 1AO7D 3A0OA 3LVTA 3MFFB 3I6GA 3JUYA 1F13A 3M6DA 3CXHK 4IRJB 1RZKL 1A47A 3H7BB 5CLZA 2Z31B 3QRLA 1KJVB 2WKOA 2C9UA 1PZ2A 4XBPA 4LAQL 5D5MF 3HI1A 1TT6A 2YQ2A 3ESVF 1T16A 3NFPB 4HJGA 4J4PD 2NT0A 4XPAH 3OD3A 1SBBA 5E7FA 3T77A 3HNTH 5D6CA 3Q48A 1IC1A 2NZ9C 5DK2B 4JFYB 1PDKB 3QJOA 4LGRB 4Q6IC 3SKJH 4HCGA 3UO1H 1MVUB 2FJFB 2VT0A 2ICWI 3P54A 1Z66A 2VUKA 3EBIA 1CICC 3EBGA 5A7EA 1AC6A 3QJFB 4YDIL 4JKNA 1B6DA 5FHBH 2G5RA 2ZIDA 1IM3B 2JIXB 3MOQA 3O0LA 1N59A 3S5LB 2R4LA 2DQEL 4EUPG 2XCMC 1Q9WA 1DCEA 5AZ2L 1CJYA 3L17A 1HXYB 1OPGL 5KOVC 1YEGH 2XZCL 4X4XB 4WUKH 4MQSB 2QTVA 1TEYA 3OVUB 2R0ZL 4QHLB 5EIIG 3UTQA 1IZKA 3RDJA 3CLWA 4ODUB 5ADOL 3QA3A 4FF9A 1LDPH 2XIIA 3K4ZA 4YHYC 2X09A 2Z0BA 5KYXA 1M7XA 2XNAA 3BP5B 4Z3TA 4MJ5A 3WKQA 3KWWB 1M6UA 3O6FD 1OTUC 4AZUA 5AQ0A 4G9FB 3DTUB 1AIFA 2DDQH 4LBAA 1TZ8A 5J13C 3OR6B 1N2RB 1T03H 3P73A 5D93C 5EO1A 5C0ND 5DFAA 4KKLD 5TPWH 4ZS7H 3TC9A 5F0JB 3RVWD 3RX9A 5BZWA 2AJXL 1AP2B 4MJ4A 5C0AB 2ERJC 3HRZA 3H9SD 5D1XE 4Z0XB 1HZKA 4G6KH 3UPRA 1XGQB 1SMDA 5JLZA 1VLXA 4AM0Q 3QDAA 2E9JA 3VRLE 2R2CA 1J5IA 5IF0A 5FK9A 3VXMA 3X13B 5IBLD 1HYSC 2PPAA 1H3TA 4HX1B 3E6HB 1UYWL 1WJ3A 3QIWD 2KT6A 2VZTA 3F6IA 4LVHB 3P3SA 2RCSL 5FYKE 3FYXA 35C8L 3CCHA 4K23L 3UO8B 2YBRA 4QXGL 4JFHE 2R2BA 3MLUH 4OZFA 3PPEA 1MOEA 3KDPB 4CSSA 2F54B 1K6QH 2J1NA 1QQDB 1QWUA 4MMXA 5SV4A 1AXSB 1CWVA 3PHQA 5FKAB 2BHUA 3QZMA 4RRPA 4TSCH 1NAMH 1EEZA 2PO6D 2VAJA 4APQA 2V17L 1BX2A 5EBWA 1VCBC 3RLSA 3SCMD 5CEZL 1QKZL 1Z9MA 3MOAH 1WIPA 1AD9B 3D30A 1NDGA 1PIFA 2W9DH 2EH7H 4UB6O 4XPBL 4LOVA 4ZMVA 3P11H 3L3OC 5C8JA 3WFEH 4S2SA 3ZO0A 5FDWA 1KBBA 1SOSA 2P42B 2Y0HA 2OMFA 5KSUB 3BGMB 2X89D 3ZMRA 2OTWB 3N44B 3G08B 1S7WB 3IDGB 3HUJF 1MHCB 4Q2ZA 4PJFF 1F4WL 2CM5A 2X12A 2OR8A 3IDXH 3KGUA 2DQIL 3ZQXA 3PGUA 1BG9A 1EPFA 2YUWA 5DO2C 1NJ9A 3GI8L 3A6BH 3FCUB 3Q13A 2EZ0D 3MRGB 4HMEA 3TVMB 3ARFD 3BT2L 3ZDZE 3B7SA 1O7SA 4GS7C 1KCSH 3NFSL 5AZEH 4DQAA 3POHA 3F05A 1DR9A 1RUAH 4OV5A 1BFVL 3MZTA 4HGWB 4FQLH 3C8HA 2XJKA 1KTRL 4NSKA 1P5VA 5DL6A 3VWKA 5EZOH 5JHLA 1NM4A 3TASA 1FJ1B 4BE5A 4ZUTA 4BZ1L 1LE5A 3AREC 3OXSA 5I6XC 3G5YB 2IANE 4MX7A 3LS5H 3DRQB 1JYXA 3GSOA 2JKSA 1S7VB 4MZRA 3KPOB 4FNUA 1B88A 1QR1A 3E1F1 1TO5A 1HX0A 3HE7A 3E38A 5JYLA 5FUOH 4R2GC 1MJ7H 4NQDB 3T4AB 3PYCA 2GSIB 5EN2A 1I8IA 4GG6F 5IUCA 3FHAA 3TEYA 1NTDA 4ZMLA 1OARH 5DZPA 2J1YA 1BMZA 1J0ZA 3L5WB 5GGUB 2W65A 4JM2C 3NPZB 3BAEL 3BAYA 2WY3B 2AQRA 3O2DA 1OM9A 1QFWI 2XQYG 4I3SL 4LGSB 1HSAA 2BDNL 2WBJA 1NBVH 3T3ME 3MV7E 3BUTA 1MAKA 2VKXA 3RWFB 1SLUA 1ZD6A 1USQA 2GJ6B 4L5FE 3B9KA 4P4KB 4P2RD 2HJFB 3QRFM 2H7WA 1KXQA 5FB8B 4FQPA 3MQIA 3SODB 5FW6A 3NABL 1NLDL 5I66B 1F11B 1MWAA 2XG5B 4KRPC 4XWGH 1VZHA 2AW2A 4PVBA 1QG3A 1ZE3H 4PRHA 5D55A 4LCCB 1S7XB 2F08A 5D2LE 3UP6A 1UT1A 1GW0A 4CKQA 3VZWX 4XPFH 3BW9B 5C3LD 5I76B 2DTSA 5EIQA 1A4KB 2WWNA 1MCPL 4K7PH 3QH3A 1F58L 3L3HB 1YEFL 4UQDA 3SY7A 3C5JA 3JV4B 4MA1B 4UOQA 2A6IA 1XL6A 3HMXA 4MZIA 1I8MA 1NL0H 5BQ7B 4NZRH 4Q9RL 1IGCL 2ARJQ 4ONFL 3MGOA 3VVVA 4F7KA 3DBXA 3H3PL 4HXAL 1A0QL 3VG0L 3PP4L 5FHAL 3GT6A 2AXHA 3S88L 2B4CL 5ITFA 1RZIB 4HIIB 3VG9C 3EO9H 4DIXA 4IU3A 1BWWA 2AJVH 3SE9L 2VDKB 3ZUNC 2GHWB 1X5JA 3K71A 1TETH 1ZA6A 1KGYE 3ZYIA 3ISYA 3WEMA 1NEZB 5IEKA 4MNHB 2J8OA 5DRWA 1JK9B 2DB8A 1GGBH 1WH0A 3DETC 3LNHA 1BXUA 4UDTB 5E8NB 2TRHA 5CHNB 1CGSL 4GW4B 2F1VA 1QATA 3MGTA 4IMKC 3SPIA 3VXUE 5C08E 2ZWLT 3A4DA 4I8DA 3OX8B 4N20A 5I74C 1BZDA 3IMVA 1FL6A 2BP8B 1DQQA 3H2WA 4FZ8L 5IJDC 1Y6MR 3O4OB 3DXAB 1IILE 1F1AA 2K3TA 2X0UA 4H20L 3UAJC 5I16B 1KNOB 5IJBC 4O2FA 2RBLA 1RZJL 1CLCA 4R7VA 2I27N 1NLBL 2JVUA 4GKNA 5CGMA 1ZT4A 4WHTB 3VGHA 4JQVA 5CIPH 1N8ZA 4M29A 3VXUA 1T7ZA 3DURB 5C08A 5CD3A 5DJCA 4P05A 4X4YB 1IEBA 3RWHB 2H8PA 4UUJA 3WLBB 1RZKH 3MUJA 2ADIA 5F7EL 4CUCA 2J12B 3E6FB 2JKWA 3DYPA 3EJPA 4D65A 2ZNWA 3HAEH 4LAQH 3VI4F 1XSOA 1Q1JL 2B16A 2Q1EA 1MCQA 4OZGB 3X1BA 5AL0A 1BJ1H 2DIJA 5H4YA 4GXUM 2V9QA 3FQXA 3K6SA 2C1PB 1OGPA 3RFZC 1UH3A 1YYLL 2ATPB 2KQMA 3GUTA 4MJIB 3VRJA 1EFXA 3RKPA 1I1AB 2AQPA 2XJLA 2CCWA 4QY8B 1UA6L 5JPNC 1ILUA 2X3AA 5BRQA 5D5MB 1U8CA 5C0IB 1XR9B 4RAHA 5ID0A 3OZLA 2VQ4A 4Z7IA 3FW6A 4HAFA 1KGXA 1U8LA 2WUCH 4YDIH 5DJXB 1JN6A 4LIQL 3U6RA 4PRDA 3H55A 4YL4A 2H0EA 1X5YA 1ED3A 1MFUA 1TCRB 2DQEH 2GTZB 2QQLL 5AZ2H 1Y7VA 3CDZB 2HT2C 4I9XA 3TZGA 2EJ1A 1WWCA 2XZCH 3VXRE 1KB9K 2YGQA 3OKDA 2BSCA 2R0ZH 4D9RE 5DJ8A 3X3FL 5ADOH 3KL5A 2EYTB 4XPHL 1TVBB 3G6JF 1J87A 4YC2C 3D2UD 5IHZA 3EFFA 4LOUD 4QXTA 4AH2A 3HG0A 1TDQA 1T5WA 2WQXA 2HG0A 4QIRA 4XXWA 3DVFA 2ZF8A 4JFEB 3W0WE 2P9RA 3TO4C 2TSBA 4PGDA 1PEWA 4JAMB 2QSQA 3AS2A 4H44C 5HDBF 1XF3A 1HL4A 1CIDA 3QDMB 1OOAA 3RVTD 3L9RB 1I9RL 3GBEA 4ZNEA 1OANA 1QHQA 2AQQA 4QR7A 1GJWA 4MRBA 4BWWA 1QO3A 1P5UB 3GXUB 3G5ZB 1M4KA 1WIOA 4KJWC 2EABA 3NZSA 4GRLA 1M2VA 4HU8A 3NZ8B 2NOYA 4W70A 2XFXA 4X6EA 4YHIB 4YNYA 4DCQB 4G1EB 3ETSA 4Y4HD 4HUVA 3OMZA 1EANA 1UYWH 3MJ8A 5ICXB 3EXJA 3IPBA 4N0CD 2OS7A 4NQCE 4I89A 5GJSL 2RCSH 3RX7A 1ID5I 4FTVD 3IJSB 3T1FB 1HJBC 2H6OA 3GJEB 1OSYA 35C8H 3Q2LA 4K23H 4R4NC 3DX4A 2XETA 2N1KA 1X7TA 2IQAA 1G6RB 1AQ8A 4NHUB 1R6VA 3EFOA 4M5TA 3MRNA 3PORA 3CN2A 4EUPH 1SXNA 3HE6A 4A66A 5DMGD 1QKZH 1KACB 4ZS6D 3U4KA 2WKOF 1Z2KA 4ZAKB 3ZKNC 4G8GB 4XPBH 3OMNB 1NGYB 3EOYG 2X7LB 1AZNA 2EVJA 2BP5M 4CC1A 4OZHE 4EI5C 4U6HB 5I0WA 4Y9GA 2VLMD 3WTXA 3S2AA 2ZCKL 4TLUA 2XN9D 4UQEA 3PAZA 3UBXB 5F88A 2WJQA 1KB9J 4ANKA 4RMQA 4EO5A 1I1YA 2XWRA 4PJGB 3SGKA 3WUWG 2A5UA 3AWGA 1F4WH 1D3CA 3MJ9L 1PF3A 2J57A 2C34A 4W9FC 2DQIH 4XNMB 5FGRA 3RQ3A 3MLZH 1RZPA 1HWHB 4QRQA 3W5NA 2HUHA 1YHPA 4G7YL 3QEHB 4JFDE 2EDJA 3GI8H 4HWBL 4JG5A 2VSKB 2APVA 3QULB 4GKLA 3B9DA 3CSYB 3NFSH 4N90D 2IH8A 4FFZA 1BFVH 3OR7B 4AQ8C 1FDLL 2QVFB 3HUJB 3MI6A 4PJFB 3CPUA 1VAHA 3GLEA 3SDXE 2IAAC 4OCMC 2ZXBA 4RZKA 4QLWA 3PNWB 1UH2A 5CBAB 1QA9B 3IDUA 3FQRB 4L2LA 4UNUA 3CXDL 2H1XA 3VE0A 4BZ1H 1CFNB 4U3SB 2H0FA 3TZVC 3LXBA 4CKVX 5J6HA 1BYPA 4O02B 2J4WL 4PLKC 2YXWA 5JW5A 3EYVA 5L9DL 4AFKA 3SKMA 2E56A 4JZJC 5KEZA 5I5MA 3F85A 3GSQA 1PLCA 1FVCA 1EERB 2BJML 1LEIB 5AOZA 4YXKH 3ZN6A 2DN7A 1ZJBA 1N0XH 4XT1C 4X5XB 2VDRB 4RGMC 2XTJD 2YEZA 4GUPA 3AAAA 1Q9OA 1UB6B 5GS1C 2A6KA 3V6OA 5I9QB 1NANH 1KLUB 3BAEH 4ZPVB 4ZMYA 1BLIA 4NNYB 1RLWA 3CZKA 2Z7ZA 4GFTB 4I3SH 4M6AA 5EC2B 5C0BB 2AK4B 5TE7L 2TAAA 3NGBC 3CHXA 1I7UB 4YE0A 3L3OB 1T6BX 2BOLA 2RQEA 1EUTA 2I07A 1WA2X 4LEOA 4H0IA 1KXVA 4DKAA 5F71A 3E9UA 3AA6B 1Y1UA 4KK5D 2XWJA 3VB8A 2UWEE 3VDAA 5FF6A 4JDVB 4Y19A 1YRKA 3L6FB 1S46A 3T65A 1G7MB 1WWAX 4GG6B 1YC7A 1BXWA 3NABH 4HUMB 4E0RA 1NLDH 4OZIA 3FB5A 1CC3A 1U8JB 4XODA 2UXVA 4HKBB 5D7LE 5SWZB 4Q89A 4LARL 1I85A 3FC8A 4XVJL 1TVHA 2P24A 3RNKA 1HU8A 5BRZA 2GEQA 3BRFA 2DQMA 2UWEA 3VRLF 1Y18B 5J12B 3O9WD 4KROB 5HI3C 1MCPH 1XT5A 4RGNB 1E42A 1F58H 1YEFH 2V5SA 1T66D 3L4ZA 2YA2A 1IC0A 1MCSA 1TKWA 4PMEA 5IMOA 1HCYA 1XGUA 4NQUA 4ZBJA 4Z7VE 5HYIA 5D7LA 3RHWK 3JXAA 3QDHA 4Q9RH 1IGCH 4ONFH 3RWCB 1XBDA 1YMMB 5CBEA 3AMLA 4FQXA 4UIKL 5L4FA 3H3PH 1K2DA 1A0QH 4HXAH 4P57B 5FHAH 2JI2A 2HRHA 3S88H 2B4CH 4YK4C 2WQ8A 5I1JL 2JLLA 2BSRB 3E80A 5E00A 4FLOA 1H8OA 3WAKA 3AREB 4FXGC 3SE9H 5I6XB 5I0DA 4PU2A 2FSEB 1YY8A 3RVUD 4C69X 4QYOB 4Z7VA 1RU9L 1S78C 1SBSL 2JMRA 2X4PB 3DX7B 3IGLA 1XTLA 5IW1A 2OYPA 4ZFQA 2ZSVB 4OCNC 3TNMA 4HH8A 1GZQA 3V9FA 3EOTL 3CLEL 2CLZB 1MNUL 5C07A 4F24A 1F18A 2NXYD 3V0DA 4OIAA 5ANHA 4NUMA 5EPMA 4W9KC 2UY6A 3GS0A 2KYIA 4F7TB 3NQKA 4MQTB 5KVDL 2PNDA 4CVXB 4Y9CA 5A16A 1U93B 4G7QB 4H20H 3L5JA 4XC1L 4ZDHA 2KH2B 5L8JB 3LJ3A 4KQ0A 4QTIL 3OSKA 3BOVA 5D7JC 3PF2A 1NLBH 2XY2A 4L4TE 1J8HB 5DYFA 3MAWA 1DDHA 5D1QE 3VFOB 2X2HA 5I1HL 3RY6C 2A4EA 4BSWB 3IBOA 4F37K 1JZ5A 1OF2A 4GIPD 1BBDL 5F7EH 1N6QH 2GJPA 4Y16A 1NAMA 3U1QA 3IMUA 4E5XG 3VD1A 3CTTA 3L1GA 3RZCC 5I6OA 3HZ3A 2G9KA 4AYFB 5L8KB 4HCRL 4EDXA 1WRFA 4KOBA 5ESQB 5D1QA 1J9SA 1KV7A 1Q9KB 1F6AB 3MTXA 4TUUA 2K70A 1N68A 3KPQA 1BFOB 3FB7A 1G7QB 4I0PA 2A9AA 4QEGA 5T1LD 3GM8A 4O9HL 4JDTL 1M9WA 3PDGA 1YYLH 4PBWD 2V5YA 4PJ5E 4ELMB 2EO1A 2JKTM 2GTWA 1T3FB 2DL9A 1GYCA 1PY9A 1UA6H 1EUUA 1HH6B 1IARB 1U91B 4FJYA 2HRGA 2PWHA 3VI4B 1FNAA 2F1BA 5LDSA 4FXKC 3IXAA 5DD0L 1TJXA 3ETTA 2AQ3A 4W81A 4XGZA 5L2KE 4LIQH 3UTSE 3B2XA 2QQLH 1RJYB 3AA0B 3ZHKA 1H3PL 3U0TB 3BPLC 1IM9D 4PP2B 3IFLL 3GZPA 2HMIC 4JRXB 3HKFA 1OO2A 3K72A 2VB5A 3FB6B 2PW2B 5E6YA 5AW1B 3T3MF 3AT9A 4IMLB 3EGSA 1OM3H 1BZ8A 1JGLL 4HUUA 2XV2A 2VAAA 1RY7B 3ECBA 4YZWA 3B6SB 3X3FH 3APNA 5GSRB 4MCZB 5T5FL 3UTSA 1OV8A 4XPHH 4NFBA 5K1VA 4GO8A 4G75A 3T6WA 2VW7A 5AVXB 1E8ZA 2DQGL 1BZ7B 4YFEA 5KW9L 2JJTC 3RWJA 3QJZA 5D2LF 5L88L 1MCBA 3IU3A 5H37G 1THCA 4EN3C 4MQ7B 3A6CL 5AVYB 3B3IA 4ONOA 4YZFE 3UZVB 1GPOL 1ZK9A 4OD2B 4E41D 3PRZA 3IETB 1FH2A 2IOMA 4AZLA 3FTSA 1AQDA 3G6JB 2OMUA 1CPUA 5I1EL 2A4CA 2JKLA 2Z4QA 3D3VD 4LLDA 4O2CA 4Y9EA 5E9DB 3ZKXB 4LNRB 4A7VA 4G8EA 4ISVA 1QVOA 5HJBA 2X4QA 4QHMB 4RESB 3VDBA 4K71C 2PXYD 2VZUA 2DWYA 3EGXB 1C5CL 4R0LA 5DMIL 4HK3N 5D4QA 1HZHL 4JCHA 3MRKB 4QRUA 2NX5D 1D9KA 3QFDA 5HVHB 4QCIB 3FUNA 2V33A 4GQZA 5GJSH 1PQZB 1W9XA 1OD9A 2DYSB 4RVBA 1LWJA 3TYFA 4KU1A 4M48H 2PYFA 2VRAA 2R1XB 4NUPA 1AHWB 2VH5L 3QUZB 5FKPB 3BEWB 4PHXA 4PJBE 5GZOD 3KWXA 3TBSA 5JDJA 3S0PA 3V4VL 3THML 1KY7A 2GW5A 5BXFA 3BD4A 1C08B 1RZ7L 5K9OA 5JA8B 3IF1A 4KHTL 4XVSL 2BOCA 5LLIC 3QE5A 1SLXA 4H88L 4Z3GA 2YXMA 5CD5D 3SBRA 2RAMA 2CO7B 3IJ7A 2W1NA 2DEYX 2ZNXA 3OLEA 5AKVA 1I9EA 3I6GB 2ZCKH 3SY9A 5EOQL 5J8OA 2ITCA 3L3JB 5ABDE 1SDDB 2ICEC 5HVFB 3TFKC 3F7QA 1L6ZA 1NC4D 4PFEA 3LPWA 3MJ9H 2NY5C 1NBQA 4BGLA 3GZOA 1UKQA 3LHPL 4P99A 1ZCRA 4Z7QB 1J0IA 4R96A 1HYRC 3BVTA 3H56A 3OPUA 1FNLA 1HHKA 3LD8C 3PAUA 4HJGB 3I6KA 1NAKL 2F74A 3KW7A 4GI6A 4HWBH 1NWPA 3EDKA 4M4RA 2WQWA 3WMQA 4DAGL 4W9JC 2QBWA 4GF4A 4HK0B 5CUSL 2J72A 3OAYK 1P4UA 3MREB 3T2OA 1FDLH 4C56A 4LE8A 3DOHA 3BJLA 4JPIA 2Z35A 4J7RA 5DJDA 5I1AA 3ZKQD 4MQXD 1B3JA 1U3ZA 3CZFA 4R9HA 5DZNA 3CXDH 1AO7A 2XV3A 5IEHA 4MHHG 5IB3B 1F4AA 3W9EA 2V2TA 3V7AG 4MAYD 5HI4C 3N1PC 1ZHZA 2CBQA 3ZZLA 2J4WH 1N59B 2WLIB 2YZ8A 4W6YB 2WQSA 1TEFA 5I75B 1O7DE 3J2PA 2BJMH 2VRQA 1JZ2A 1LMKA 3BRGC 4M62L 5AW7B 2XC8A 4OFVA 4JUTA 2V9UA 5I73C 5I6MA 3QA3B 4M8UA 4J4PA 4OGAC 2HRPH 4GP5B 5KYXB 3GRBA 2E9BA 4L8SC 1ZLUH 1KCVL 4KJQC 2GFBA 2F68X 2D0HA 1PTZA 3VD3A 2E27L 4R4FL 3FCSB 2EEXA 1Z7JA 2ZOKB 3D87B 3ZTEA 3ZL4L 4POZD 5JXED 1AIFB 4DP6X 2YKKA 3QNXA 5DU7A 1KIQA 1D5XA 5CJOL 2L3BA 5DVPA 1XSIA 5EO1B 2NLJA 5GGRY 1D2PA 4P2YA 2J5LC 1E4XI 3EADA 1K5NA 4LARH 5BZWB 4DPAX 3W11C 4EVNA 4XVJH 1QBAA 2K3HA 5AOLA 4DESA 1LO2L 3HRZB 3DWOX 2Q87A 4WI7A 3B4NA 3ARBC 1EEYA 4L3AA 3UPRB 5JLZB 1SYSA 5KAIO 1PZUB 5AW3B 2YPLD 1BZEA 4JL1A 2B59A 5IF0B 1ZLVK 5FK9B 3DHUA 2XHNA 2IH3A 4AGMA 1PY0A 4LZKA 1X4ZA 3LYRA 5E8OB 1UD8A 1NCNA 3TF7C 3Q5OA 1MQKL 3ZTDC 3ULVC 2CRYA 1UWEL 4UT7L 4R6UA 2OW6A 3OF6A 1P7QD 4HV8A 4KV5E 1KGIA 4UIKH 1XF5A 3FCGA 3O6FA 3CCHB 2Y9RT 3DHPA 4KUCD 4FQ1L 5D1XB 3I2CL 2VITA 3MNDA 4ZTOL 3T08A 1TR7A 2R2BB 1FZKA 2JQZA 3TV3L 4HCFA 1U21A 1F4XH 1KPUB 4MMXB 3PHQB 4YHML 1MKFA 3VI3E 1U8HB 3LPFA 1EEZB 1NOAA 1RU9H 1BX2B 4BUMX 1INEL 1X4YA 1MCOL 3DPBA 4NEHB 1FSKC 1R5IA 3L08A 3EOTH 4XRCA 4GAAA 3CLEH 4H0GA 1MNUH 4PRPD 3L1FA 4DEPC 2H2SC 3KXFD 4OZHF 3E9TA 2VXTL 4EIGB 5C8JB 4GMTL 4QYAA 4RGMB 2VM4A 4HBQA 3BGFB 3LVEA 3QHZL 4JM4L 5SX5H 4ZFOB 4GKZA 4BCXA 5KVDH 2R51A 3FZUD 1CGTA 4XC1H 4GUQA 4U31A 3QIWA 2QGBA 5CEZE 2VJ0A 1TJIL 2AI0L 4D3CL 4Q2ZB 4XO8A 4MXQD 4K3EL 4IOIA 5I1HH 3UTPD 3DVNA 3O6LH 4XVUC 5AVQB 2NY2C 3A3YB 2ZP8A 2V9RA 5J7CC 2G0KA 3ATFA 3QARA 3S48A 1NJ9B 1OW0C 3SD2A 1BBDH 3VVWA 4LDEB 3TH4T 1BA9A 1N7ML 2R2HB 4EUPA 4HCRH 3IGUA 4OV5B 3SDXF 1TJGH 5LBGA 1YEHL 5IUSA 4OCRL 4DVRH 4FG4A 2V4LA 2HUEA 2UZPA 3BLBA 4NSKB 4YIQA 4YVUA 3V55A 2DRUA 1BVNP 5KJRH 1P5VB 3QXVA 5EIIA 3VWKB 2PR9A 5D7SL 3MC0A 4O9HH 4JDTH 2DEWX 4ZUTB 1WE5A 2VERA 3MLTB 3UFIA 2X89A 4OD1L 4WHYG 5GXBB 3GSOB 2KQNA 3DX8B 4P2OD 4AQEA 4H2AA 2E9IA 3N40P 3ZDWA 2WZAA 4A7GA 2WVSA 4L48A 4OR1A 2GITA 4UT6L 3QI9A 5DD0H 2IDQA 2ENSA 4EXKA 3KEHA 5EN2B 1I8IB 2QKSA 5C0EA 1H3PH 3BDBA 2Y4SA 3IFLH 2W65B 1UXMA 2FJUB 3ARFA 5DRNA 1JGVH 3K0WA 2FWUA 4GBXD 4KKAD 3ZO9A 1HSAB 2WBJB 3D25B 3MO1A 3OKNB 3Q1EA 4L23A 2UWEF 1JGLH 4ORZC 2ICWA 2PWDA 5DSCA 3ARDD 4BFGA 4FP8L 3B1TA 5T5FH 1MN4A 4TUJA 3B9KB 5B39G 1E4XL 4AQZA 2DQGH 3VQMA 2B1OA 2F15A 3TBCA 4JJOA 4BZ1A 4DP9X 5D7JB 3QQ3B 5KW9H 3FF7A 4A04A 3S37L 4F7PB 4Q9BA 5L88H 4I7ZC 2DS4A 2V5RA 3A6CH 3ARGA 3T3MB 1GPOH 1MM5A 1T0NA 2GBAA 1I1RA 5LVEA 4NBYB 2PTTA 5EIVA 1ACYL 3CFBA 2F9BT 2G2RA 2PCFA 3QH3B 2OI9C 4JRWA 2RACA 3C5JB 4UI2A 4Z7VF 2A9MH 5I1EH 1XMWA 1X5FA 2A6IB 1I8MB 2R29H 3KPMA 1ZDQA 3OV6A 4DNLA 4FNLL 5TGBB 3MGOB 2YSTA 3R4DA 1ZOXA 3DBXB 1C5CH 1FA4A 1HZHH 5ITFB 1SMAA 2AKRA 3H4FA 1TQBC 2R4PA 5E0QA 5EEWA 3PGSA 4P2RA 2ICCA 2V3FA 3RVVD 3K71B 3LB6D 3RWIA 1O5PA 1ZA6B 1KTKE 4Y2DC 5IEKB 1TITA 2LAGB 5G2NA 5DRWB 1ZGLB 2YAFA 3ZYJA 4ZO6A 1EJ8A 4Y4FC 3OZKA 4ZFGL 1KTCA 3BUYA 2VH5H 3MGTB 5DJAB 5KVEE 3V4VH 5KVMC 1ONQB 3V0JA 1FL6B 4Z0BL 1DQQB 4F33B 5F7YC 2EXYD 4HJEA 1RZ7H 5KSAA 2HVKA 3D4GA 2HN7B 4KHTH 4NWUL 2QFPA 4XVSH 2Y1AA 3GZQA 5HHOE 4TL5A 1UWXH 3Q8CA 4H88H 4P2QE 4WUUD 2P8LA 3O8XD 4GKNB 1ZT4B 4BUGA 1N8ZB 4RZCA 2IAMC 1JWMB 3NPSB 3VXUB 5C08B 2FT7A 4HOXA 4S1SL 3VNYA 2AP2A 5EOQH 2Y7SA 1IEBB 3AC0A 3HS0C 3P4OB 1A4AA 3WI4A 2H8PB 4GT0A 1T0MA 4OLVH 5C6WH 5LNGA 5I0ZA 3OHXA 1K4CB 3KCPB 2QPUA 3IT8D 1OT4A 3ZGHA 2ITFA 2ADIB 3K4AA 5H37H 4YR6B 1PZ5B 1B6UA 3DARA 4P2QA 3QORD 7PCYA 3RWEB 1JGDA 2DL2A 2E8ZA 1BD2E 1XF4B 4GW5A 3IRCA 3OAWA 3B9VA 1JZDC 1PYWA 4ZXBB 3DV6A 3RVXD 2P5WD 2VLJE 5K9QI 1T7YA 2N1TE 4IGBC 4DAGH 3FQXB 4CJ0A 3K6SB 3BQUC 2Y7OA 4MJJA 2K7QA 4X4KA 4KKZA 5CUSH 4G6FD 4IKKA 4YL9A 5LKNA 3GKWL 1HE8A 5CILL 3WS3A 4P9HC 1MLCA 3GUTB 3VRJB 1EFXB 4PSRA 2XQYA 2BOBA 4H5SA 2MCMA 5E2TL 4FZLA 1U8CB 1W0YT 4K3CA 5ID0B 1MCIA 3VM7A 2A9NH 1B2WL 2P80D 2HFTA 2WSPA 4UOW0 4AKQA 3LKPA 3LK2A 1LK2A 1OT2A 3U6RB 1R46A 4KRAA 3RIAF 1ED3B 4XX1G 1V3JA 4UANA 3DA3A 1YPZA 2XUWA 4LL4A 4HZAA 1SN2A 2QV2A 5ILTL 1UATA 1IBBA 4AL8L 2BVYA 1AGFA 4M62H 5DJ8B 3BGAA 4UQ9A 2DM7A 4IRZL 4HG4K 1BVNT 1A3ZA 1K3ZA 2IADA 1DJIA 4FZEL 2YBGA 1KCVH 5EU6D 3BLPX 2MQCA 2D9CA 3AAZA 3EFFB 4QXTB 4AH2B 3IAGC 1T5WB 2E27H 4FJ6A 4R4FH 1ZHWA 4YZFF 3ZL4H 3VXRB 3BVDB 1IZNB 3K0YA 5EHFA 4ZX3A 5CJOH 5J11B 4CW1A 1K5WA 5FOBA 4LF3A 4LPTA 3HZKB 3SQBA 2CDEB 2WBKA 1XO8A 5IMMB 4L29B 2MPAL 4A67A 2CRZA 4WFGE 1A3LL 1YEDB 2FLMA 3F83A 4P5RA 1QRNE 4DKFL 1PAZA 2YN3A 1A4JA 1LO2H 2ADGA 3RUGE 4LVNB 3KPRD 4F2EA 3IJ9A 3NJFA 5EBMA 4AMKL 2V0AA 1M2VB 1UD6A 2XFXB 3ZQWA 3QPQC 4X6EB 4YNYB 3ILDA 1ZHTA 4W6XB 4HUVB 5E6ID 1DQDL 1W0VA 4R26L 3MJ8B 3D18B 1MQKH 5F2FA 4UT7H 2OM5A 5DEJA 4JNXA 3D2UA 4PJCE 1SVCP 5K9JL 3GHBL 1MG3C 4KKBC 2BRRL 1NMAL 2N01B 2X4TB 1OAKL 2F8VA 2HJKA 3I2CH 4FFVC 4FQ1H 1U0QA 5MERA 2IQAB 3PGFL 4ELKB 4PJBF 1A1NA 5HYJD 4N3UA 5CJQL 1Q0XL 5IROD 4YHMH 4LLAA 2R4SH 3EJYD 5BUAA 1CFBA 1A9BA 4F7CA 1G84A 1YEJL 5FIEA 1OCRB 3GUFA 4NQCB 4PJCA 2Z3FA 1GKEA 3BAWA 5D2NE 4U1IA 3TT1L 4BE6A 5AW8B 2X6VA 2V37A 4WI6A 1O7DC 2VXTH 4U0QB 2VJXA 3GMOA 3LZFL 4GMTH 4C00A 4PBDA 1Z3RA 1HCVA 3NA4A 3QHZH 1AG0A 2OLDA 4JM4H 4M1CC 4HJIA 3WNNA 4Y4HA 3FU3A 5F88B 1RHHA 3AQDA 1I1YB 3WEAA 4KXCA 3D51A 4WSKA 5E5RB 2AI0H 4JREC 1M1XA 2IH9A 4FTVA 4D3CH 2DPKA 4WK0B 4K3EH 1HEHC 4X0KA 2IOOA 2IALA 4OZHB 2DJMA 4MYPA 3AQYA 3CFUA 2XFGB 2XVLA 5LCVL 2K4WA 1N7MH 1VFBB 2APWA 3KEDA 3GMMB 5CZKA 4WTWA 2X9WA 4F57H 1YEHH 1M3JA 3RPIB 3FH5A 1A7PL 3LQZA 1J48A 1GCYA 1FFNA 2OK0L 2I9TA 4WIQA 1NM9A 5D7SH 2XX0A 4JFDB 4L8CA 3VE0B 1OAZH 3GXTA 1A9EB 5AAWA 4OD1H 5DT1L 1H15B 2XN9A 2N2LA 5JW5B 2FSDA 3UBFA 3EYVB 1WHPA 3SKMB 2F8OA 1EO7A 5EU4B 3FO1B 1RXLA 3MJ9A 3GSQB 3SDXB 2WYTA 4UT6H 2UXFA 2DM2A 4N2FA 4HJSA 3O3AA 4XMTA 3FRUB 3SZKC 5DL8A 2YEZB 2NPLX 4GUPB 4I13B 3V9CA 2TRYA 4WGVB 3UH8A 2A6KB 1SEQL 4HWBA 1Z3GL 4QGYA 3IDNB 2CH8A 1G9HA 2VZOA 3FQTA 1DVFA 2I07B 5HSFA 5FO2A 2XWJB 4FP8H 2YD2A 4Y1AE 5FF6B 3V79C 5E1AA 1FCCA 1RP9A 2FBRA 5F89A 3X11A 4ENZA 2YUZA 1MEXL 1E4XH 1IBFA 3FTVA 3PDOB 4JHZA 4OZIB 3FB5B 1QX1A 3S37H 1KYUA 2WIMA 2ZWZA 4NUJA 5BVPL 2P24B 3RNKB 3ZHDA 1UM5L 2CBOA 4TLSA 3HEIB 4B6ZA 2UWEB 2HLEB 3N04A 4NYLB 5C0GA 3PAVA 4PW3A 1MY5A 1ACYH 2QMKA 6PAZA 4U6VL 1JNLL 3TPUA 3N91A 1P4IL 2DQUH 1JPST 1RULL 3WD5L 1TKWB 5IMOB 1GGTA 2NY3C 3GPSA 1CYXA 4AYNA 1T0OA 5D7LB 4KV5F 4TQPA 3ZLQC 4FNLH 1IFHH 5D71H 3NTCL 25C8L 3LXCA 3LZRA 1RERA 3LTVA 4TSBL 2P8MA 1TQUA 4AOFA 2MFNA 1F6LL 3VI3F 3QPXL 1LEGA 2NW2A 2Y2XA 2X88A 3M88A 4P46B 4KGJA 4WHYH 5LGJB 4LSUL 2PCXA 1JFHA 4Z7VB 4N25A 2WTOA 3WUWA 3TJHD 5IW1B 3TNMB 4DP8X 4P3CL 1GZQB 4ZFGH 4OKVA 4TTDC 2JCCE 4A63A 5C07B 2UZYB 3IGFA 4JN2B 3KWUA 2EUVA 3TLRA 5EPMB 3T8XA 3FHEA 2G75B 1KGWA 2UY6B 4J6RL 4Z0BH 2FGRA 4B9FA 2A73A 2CIIB 4NO3B 4AV0A 4BK8A 5L0QC 5A16B 1F0LA 4NWUH 3MCKB 5DLLA 2DI8A 3UGUA 5IFHL 1FCGA 1VSCA 1R9FA 4Y2OA 3QCUL 5T1MB 2JCCA 3S5YA 3VFMA 4H25A 4DGYH 2HX9A 1Q90A 3KYAA 4S1SH 3HN5A 1UD4A 4YLBA 4CRPA 4Z7OE 2E7CA 3FK3A 4K8RL 1F2XK 4JFUA 3ILQC 4K8RD 3BZEA 3P9LB 3U2IA 4P59L 5EBLA 1NAMB 2B0SL 2QQKL 4N5EC 5TDNA 3SZDA 1ZLDA 4UOW1 3WG7B 4PTTA 4A7GF 4FZMA 3TL5A 4EDXB 1ZSDB 3QFGA 3QJSB 5D1QB 5FFGA 4FXLA 1T83C 4G6MH 1UXSA 2QKIC 3RILA 6CGTA 3KPQB 1MI5D 1BQSA 4I0PB 2GBTA 2FWOA 4Y5YA 4O4YL 3QZWG 4TQEL 2BZCA 5CILH 4EN2A 3GDBA 3LEXA 2AJUL 3DUUA 4OCXL 2GTWB 1MFEL 5E2TH 3PL6C 3RBHA 4FFWD 1IAMA 5T3ZL 4WWOA 3BVNA 3S8WA 1B2WH 1T04A 2F7QA 1TQBB 3IXAB 3D85D 2PCYA 4XGZB 2FO4A 4OUOA 3X17A 3HC4L 4WSGA 1Z9LA 2C1OA 4TNVF 4GFXA 4GXUN 5JOPD 1BAGA 3QAZC 2Y5TB 3LKQA 4FABL 4IOFD 7CGTA 1FL3B 2OMVB 5ILTH 1IBZA 4HCRA 3EGSB 4AL8H 4HUUB 2VAAB 4FHKA 3ECBB 4KMTL 4IJ3C 5L2KB 1C5DB 1OGTA 3UTSB 4UTCA 4WFFD 2F53D 3KWTA 2JQYA 2WB7A 3V95A 5C0DA 2X05A 1LD9A 3H6JA 1MREH 5E2WL 4NAJA 3RWJB 1FQ9C 4H7VA 3WTYA 3IU3B 3AG3B 1J1XL 2NUPA 4PJ9A 4LCWE 4IRSC 2CJUL 3ZDXE 2XV0A 3UBHA 3MUHL 3L3GA 2O4VA 4N87A 1QUPA 1RUKL 5G38A 2BMKA 1YY9C 3D5OF 4IBZA 1SJXA 2K1MA 1HQ4A 2Y23A 1G94A 3CQFA 1OSPL 4V33A 5ABAA 2MPAH 1T22B 3WY4A 4QNPE 5F7KC 1AQDB 2OMUB 4FRWA 1A3LH 1NINA 4LLDB 4O2CB 4DKFH 4HFWB 1QVOB 2X4QB 2HH0H 3P4NA 2FE0A 4FERA 1I3GL 2WZ0A 4PWIA 1JWUA 5HP5A 4OCLC 1PIGA 1VRSA 4NI6A 5F93C 2Y7NA 4QRUB 1SVZA 2I60L 3HN3A 4R83A 1KBGL 1DQDH 1D9KB 5T5FA 3QFDB 4R26H 4YDVB 4J5VA 2J1XA 1MRDL 3SKNA 5DLMH 1SEBB 3GSWA 4G6JL 5AENA 1DFBL 3ES6A 5K9JH 3GHBH 1J1PL 5B8CB 3C5ZA 1X5IA 4XCYA 2BRRH 1NMAH 4GQ9L 3VXSD 1OAKH 1EHKB 5KVGL 3MXWH 3MNZA 3PGFH 1O9ZA 5IFAL 3FT4A 5CJQH 1D7CA 1Q0XH 2JV6A 4ATTA 1R3KA 5JPMA 4E41A 3B83A 3AY4C 3LPPA 4YDLC 1S4IA 4N74A 1F56A 1SYVB 1YEJH 1PLGL 2QT6A 1ZDSA 5A2BA 5BXFB 1BEXA 5K9OB 4E5XA 2XSKA 3D3VA 3TT1H 2BOCB 1QTPA 2R29A 3NSDA 4JGMA 2DMKA 3LZFH 1Q38A 2DM4A 3S5LG 2PXYA 5F21B 3ERXA 2AGJH 1UD5A 2G2PA 4X9IA 5JZ7D 1F3JA 1ZLVH 2NX5A 3QP3A 2ITCB 2HLFD 1WBZA 4LRNL 5IK3B 1HJCA 4KNSA 1THQA 2DI9A 2WXMA 3CFMA 4WHDA 1CCZA 2R4OA 4UMGA 3AAEA 1YO4A 3GJFK 3SQOL 2Q7YB 3EF7A 1LWHA 3R06A 2WO3B 4PI2A 4R96B 5IMLA 1U2CA 4HWNA 1HHKB 1MHEA 1VEOA 3S5ZA 3SY6A 5GZOA 3KS0H 3I6KB 4M5SA 2F74B 1ET5A 1VENA 2I69A 5LCVH 2ZPKL 4M4RB 4N86A 1SHSA 1F3DH 3V4VA 2VIRB 1CD9B 2PYED 3FFDA 1G1CA 3VH8G 2GQHA 4UDUB 5L4IA 1EWHA 4X6CA 4C56B 2K78A 2G3XA 4JPIB 2Z35B 1QSEE 5DJDB 1AY1H 4FQIL 4IRJD 3ZRCC 5I1AB 2OK0H 5EN3A 2Z31D 3T2NL 4Y88A 3CZFB 2DH3A 5IEHB 4NN7C 1J8SA 3W9EB 4BA0A 4DK5A 2XPGA 4M00A 5DT1H 3C8DA 1UM6L 1I7ZA 5EWIL 3L5XL 1IBYA 1T2JA 4ZUSB 4NHCL 1H8LA 1E43A 3T8MA 3C9NB 5H37A 1PLAA 5HHMD 2ZKMX 3WS6A 1ZGLM 5FA4A 2QZQA 3V8OA 1H3UA 4HFUL 4MDJA 2BLFA 3VACA 5J6GB 3BP7A 1ZY9A 5HGGS 3TX4A 4F9PC 3QUKB 1OKEA 4CN1A 1NQBA 1SEQH 1CDGA 1OAJA 3OLGA 1Z3GH 4PJIE 2D4FA 5E8EA 1S7SA 2GFBB 4KTDL 1X3DA 3Q2WA 4XNLA 3CUPA 2JIXD 1EZVX 4PS3A 5HHPA 1TNMA 2ZKWA 3ISWA 1D5XB 4KDTC 4X8CA 4Z3FA 2Y2TA 1XH3B 3INUL 1MEXH 4KR4A 1MCHA 1L0PA 4ZUWA 4F58L 4PJIA 2NLJB 1MCWM 1UUSA 4MAYA 1CFTA 1K5NB 1DSWA 3RUGF 5BVPH 1UTDA 4DPRA 1MXDA 4WY7L 3VFGL 1WDAA 4HEME 3MUUA 4YDJB 4LL1A 1MJJB 5BV7C 1SYSB 3ESNA 2V9TA 4U1JA 4MVBD 1PFCA 4WI4A 2B59B 2ZOTA 3WD5H 1IVTA 2IH3B 3NUKA 4PJCF 4UIMB 5GSVA 3SDAC 3QO1A 3EUDA 1WGOA 1HXUA 1XZ0A 3NTCH 1YN6A 3MBXL 4HV8B 5F3BA 5KYYB 4DEUA 1XF5B 4UYQA 4TSBH 3B2UC 5AOMA 2VITB 3R1GL 2WK2A 3ZTJH 5JXEA 4IW4C 1AZVA 1FZKB 3PQYE 3U30C 2FHFA 4JY6A 2JTYA 5C0AD 4KK9C 2JKRM 3V10A 1UOWA 3OQ3B 4QLRA 4KI5E 5GGVY 5F1NB 4NO5A 4WWKA 3FQWB 3DPBB 1DQLL 1JNNL 3BH8A 1EBAA 2IPTH 5JHMA 4P3CH 1J88A 4XRCB 2BO0A 3QIBC 4WW1A 3K7UA 4LDLB 3QDJE 3FPYA 4HSCX 4I85A 4OAWA 4OY9A 3A0HO 1DO5A 1RK1A 4G2AA 3K81A 2WO2B 5LUMA 2YPLA 4K5PA 4GKZB 4NGHL 1CXLA 5BVJA 1W72L 1CDIA 2F54D 5I0YA 4MAZA 3N1MC 5DFVC 5IFHH 4DTGL 3BH4A 4JFXB 3QCUH 3VFWA 4AGNA 1P7QA 2C9XA 3IN2A 3QDJA 2WGXA 4XAWL 2WAHA 4IOIB 4N8CL 4PB9L 3DVNB 3F64A 4GG8A 4TPRL 3M8OL 4K8RH 3W2DL 5JMRA 5IWLA 3QEQD 1BAFL 1LWRA 4XWOD 3B56A 2OQJA 3M17A 1BP3B 5TH2A 1LP9E 3QS2A 4P59H 5B1AB 1KCBA 3LIZH 2QQKH 2RR3A 5DQDL 4EUPB 4FAAB 4FG6C 2GJZA 5FV1L 5IKCA 3DO7A 3JT2A 4JVPA 3DBSA 4B97A 4YIQB 2C4FU 2H26A 2WXKA 4RFNB 3LQAC 4NOFA 4TQEH 1VB9A 2HTKC 1LP9A 3QRBA 1SXAA 3VQ2C 4MYWB 2AJUH 4GAYB 3RZWA 4N2HA 4OCXH 1WEJL 1OGAD 1MFEH 4RLCA 4AQEB 2OMYA 1QLFA 3DSFL 4A2FA 1YYML 2ADYA 1QHOA 2F8IA 3TVMD 3OKOA 1WBXB 4OUUB 3QI9B 4FKEA 3R4RA 4M7JH 4Z7UA 3NJLA 3IMBA 4APQC 5HYQA 3HC4H 5C0EB 4X83A 4WQOA 4K9EC 2E3VA 3VRIA 2ODJA 3RI5K 1G7HA 4PJ6A 4LEXL 1ACCA 1XQ4A 1A1MA 3KE0A 2YD1A 4LLMA 1E5UI 1KPVB 2CHNA 3MO1B 4AIOA 4XXCC 4ZZFA 4FC3E 5DSCB 1M3IA 1NEZG 4TUJB 2BXYA 4HZLA 4UQIM 2GHZA 5HPMB 4GY4A 5L0QB 2EUWA 1N19A 2IXQA 3INOA 2FVNA 5MEQA 5CN1A 5F8RC 2AITA 1JXGA 2APTA 4GYBA 2HB0A 4NCDA 5DURB 2CJUH 4PSPA 3ARGB 4V1DD 1RIUH 3SBWC 1WFNA 4YXLH 3LPOA 5IB5A 4PGCB 4GW1B 4UT6A 2N7SA 2WTRB 1VKXB 4IKIA 4APXA 3CFBB 3GSUA 1OSPH 3DA4A 2G2RB 2PCFB 2X2YA 3L3IB 2OTUB 4H13C 2NSMA 1UKTA 3U7YL 2R7EA 1QI5A 2Y2WA 4ODVL 3IDJA 1OSZB 2GJ6D 3EAKA 3KPMB 3LV3A 1PFOA 4GBXA 3NCWA 1H6EA 4ZX6A 1R19A 1PVHA 3QC6X 3WFZA 4UMSA 1UJ3A 1AR1C 2R56L 3F7VB 3ARDA 3PWJA 2I60H 1KBGH 4D0BB 3OKMA 5E4IA 4J3OC 5F1IA 2WLLB 4TXVB 1MRDH 1J5OL 4P2RB 2WZPA 4G6JH 1DFBH 2P28B 3RWIB 2O6CA 1J1PH 1CYWA 3HE7C 3PNRB 3P2BA 2JCCF 4GQ9H 4JRYE 4BQ6A 4FQCL 5IFAH 4AKOA 3NMEA 3BUYB 3T5WA 5D7IE 4HBCL 4O5LL 1OCZB 1PLGH 3EH1A 1QSZA 5C70A 1CS6A 1WCBA 4MS8C 2D3LA 4XN2A 5KSAB 4XMLL 2H2PD 4JRYA 1X5AA 4Y0GA 4XZUB 1W6WA 2NSQA 2B9BA 4NC1E 3BVUA 4IJ3B 4RZCB 5D7IA 4C55A 4U1GC 1R0AL 3DO3A 2AXWA 1W0WB 1G0XA 5I1DA 2JJSA 1T0MB 2AQSA 4LRNH 2ED6A 3OHXB 3TP4A 2NW3A 2YXVA 3I75A 3IMSA 2C7UA 4P5MA 3MRPA 1HQRB 1DQKA 4XNDA 4PI0A 3CQPA 1QTSA 4AYSA 2W9EL 4P2QB 3SQOH 4H4NA 5IMKA 1NFIA 1JGDB 3Q1SL 4NO2A 1KYFA 1F4YH 3EJUA 1HAWA 4GW5B 1PYWB 4ODSL 4IBUA 2ZPKH 4BFEA 5F7HA 4FHBD 1BQKA 1CN4A 2E7LC 4LLYB 3EJTA 4MA3A 3IGAA 3UPGA 3WS3B 4OIIL 1QYGL 3G6AA 4E9YA 2Z92A 1GIGL 1BD2B 1G87A 2BOBB 4NKOA 4WUUA 1S9XA 2AAAA 2K8MA 3FT9A 3M1BA 1HNYA 3NCBB 2GSMB 3O8XA 4G9DA 4X8XA 3UBXI 1A7RL 3T2NH 1T20B 4IQHA 3T6XA 5IQLA 4IKLA 2FBOJ 2Z65C 4LP8A 4O00A 2WNGA 5B7FA 3HJ0A 2CM6A 4BJLA 1LK2B 5B39A 3FPXA 1DE4B 2VOTA 5F96L 2DMBA 4BK5A 1XXFC 1UM6H 1KTJA 5EWIH 4AYGA 1HSBA 3L5XH 2A9BA 1PGRB 2HYMA 4NHCH 4PV8A 1YPZB 1A22B 4U3HA 4J23A 2GPZA 3QORA 2NY7H 1I3VA 4HFUH 4CGUB 3DK2A 3AADB 1NBZA 2WQAA 2QLYA 1UM4L 1AGFB 2CHWA 4CNIA 1KUMA 1I1AD 5FOJA 4CMHC 2QEJA 4E42A 1EK3A 1EZSA 2P5WA 4LL9A 2IADB 2VXUL 4YE4L 1GSKA 5AFUK 3AAZB 3CFTA 3L9EA 5E5UB 2QADD 3MRBA 3ZDXF 1WCQA 2HJLA 3L3DA 5I30H 3MBEA 2G2NA 4QHUB 3INUH 4J8RA 1W91A 3PLYA 4QNPF 3T4YA 1FFPA 3LZOA 4PCSA 3SQRA 4CW1B 4F58H 2P80A 2X4UB 5FOBB 3OAUL 2WVPA 1FZMB 4OQTL 4X4ME 1D5IL 1F45A 3VXTA 3L7EA 3EYOB 2Y22A 4HC1L 5DMKA 4F15C 1J0JA 3ZKSD 1EMTL 5HGDB 1A4JB 4WY7H 4TVPD 2ZP0T 3VFGH 2ADGB 1ZV2A 5F6HI 5EBMB 4JO5A 4N85A 5HTSA 2F61A 2GYSA 2XKNA 3CFKA 4JFED 4D2NA 4JFFE 1FYTE 4HQQL