4AYDC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 r106a mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
247
structure length
238
Chain Sequence
b'DIGAGLADALTAPLDHKDKGLQSLTLDQSVAKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEITLESGEFQVYKQSHSALTAFQTEQIQDGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 53
structure length 238
sequence length 247
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aydC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aydC01
3KVDD 4AYEC 4O49A 4O4UA 4O3XB 4AYDC 3PQUA 4O4XA 4U9CA 4O3WA 4AYID 3V8UA 2YPVA 4QQ1A 3HOEA 2Y7SA 4AYNA 3UAQA 3VE2A 4AYMC 2W80C 5T5FA 4Z3TA 2LFUA 3PQSA 1YS5A 4O3ZA 4O3YA 3HOLA 5EE2A 2KC0A 3VE1A 2W81C 2KDYA
chains in the Genus database with same CATH superfamily
5CINL 1OE2A 2GT9A 3MYJB 3D4CA 2C7UA 5LN8A 2XG5A 1KENL 4PP1C 1HDMA 4QXVA 3NFSH 4DKAA 5DK3A 5I71B 4Z8FH 3WDJA 2OFQA 1T6WA 1U0QA 1F2XK 2HG5A 4HJ0D 2EE9A 1PAMA 4X7TB 5I82A 3TZGA 3REVB 5BV7L 3B3BA 2R4LA 3F58H 5FGRA 1T03H 3E6HB 1BZEA 3HPLA 4NQSA 1QZ1A 2VR3A 1MFEL 3PJNA 4QRQA 4WU7B 1VGKB 5FO9A 3KS0H 4CADB 5KSAA 3EJPA 3OB0K 4JO8A 2A9AA 5FYJL 4F57H 5IK3A 2X2HA 1DR9A 2WVUA 3BE1H 2COVD 4YQXL 4X8XA 2ZXBA 3S0PA 3D12B 4EN3D 1CF8H 3C08H 1IEAA 4RZCA 1UZ6F 1OTUD 2ZAIA 1U2CA 3HI5H 4PJXE 3AXIA 4KI5F 5L6YH 3GXTA 3QO0A 1BF8A 1EUTA 4DQOH 2R7EA 4LCIL 3BD3A 3ROOB 2D3LA 1AGFB 3TJHC 3HZYB 4EE2A 1QHPA 1CFTA 1I9JL 1EJ8A 1ID2A 2NX5D 2ZKMX 2TSBA 4X4YA 1AVAA 5F1IA 1U8IA 3FH8A 5IESH 4H8QA 5EEUA 5AOLA 3BUYB 2XN9B 6CGTA 3BAEL 2YWZA 2ZAGA 4IRSC 5CZVH 1TZGH 3R18A 4OZIB 2IANA 4NKMA 1RVFL 2AKRA 2AV1A 2ZCHL 3LHAA 4JFZL 5JDSB 3C6LC 2JMRA 1ZKAA 3MV8D 4TNVK 3BOVA 1KIUB 2IWGA 5J1SC 2R2HB 4N6RB 4QAMB 1G7MA 3VFMB 2WWKO 1E30A 1Q4NX 4DHLA 2Z1PA 4ZMQA 1AY1H 3HAEG 5HHQA 3IKCA 4AKMA 5EU3B 4F2EA 2P8PB 4IW4C 4X4MA 1G6RH 3VO0A 2EVJA 4O02L 1V7NL 1Z6JT 5B1AB 3TH2T 5D7LA 2NTFB 4RH4A 4FFYA 5PAZA 2D7TL 2VLJD 2W95A 3AG2B 1ETZA 5CEXB 1J11A 2MTAA 4GXUM 5I30L 2DKMA 1X3DA 3MRHA 2HT3D 4CSSA 1J5HA 1L5GA 1KCUL 1UWEH 1YN7A 1HOEA 2D3NA 1GPOL 3MBEC 2YC1A 4FQXA 4NQXB 3B7UX 1ND0B 1FGVH 2GJZB 4HHAA 5D1ZI 2YPKB 4XO9A 4ZXBC 4PP2B 3APDA 3G08B 4XMPL 3MROB 1JWSA 4PYGA 4D9LH 4AQAB 1E6OH 5DVOA 5B38B 4J1UA 4JLRB 3JYBA 4X5RA 1LILA 4YHIA 1M1XA 3JUZA 2RFXB 1KYUA 3U48A 2PCFA 4JE4B 3V4PA 4HCRL 4AQEA 2AEPH 5FUZH 3VFUB 3EHBD 1O7DC 5IW1B 1BOYA 1Z9PA 2C8NA 4E0RB 2RCSL 5HI3C 1S7RB 4MA8H 4RGOH 1FYTD 1KBGL 1JCKA 4NLAA 3ESOA 1IC0A 2B9BA 1BAFH 2J5LB 5AB1A 1RZKL 4PWHA 3HHMA 3X1EA 3IXAA 1S9KC 1AQKL 4JVPA 3OB0H 5B8CC 2J4WH 3NTCH 5DUML 3ARUA 3HLKA 4F8LA 4N1HB 4ONGH 1DN0B 4P4KD 1CJYA 1J0IA 1F13A 2DJMA 5E7FA 1QUNB 4PV9A 4JPQA 4YHML 3ABMB 1NQBA 3TNMA 4CSPA 5FR3A 3LTVA 1ES0B 3TO4D 4OZ4A 3X14B 3W9EB 4NQDA 2FX7L 4N2NA 2ZQKA 3FFCA 2VZ1A 2X3AA 3ROLB 2Z8WC 3HCVB 2X1PA 3VFPA 1G1OA 5K9JH 1BZ7A 3O4OB 2KERA 3BFOA 1KTDB 2RQ8A 4NQEE 3UTSE 3K0WA 4BQ9A 3T3PB 2ATKB 3H8NA 2J88H 2FQGA 3T6ZA 2N4IA 2WHVA 2WYIA 1I1AC 1A6AA 2QADB 4GUCA 7CGTA 3LRLA 3VMOA 3OKLA 4IGBD 4TYUA 3CBRA 3EJZC 5J4MA 1RD6A 1A1MB 2WNWA 4L8SC 3T3MB 1GKEA 2F5AH 2NT0A 2APTA 3I3EA 1URLA 4N9GA 4Z7IA 5B38G 1OANA 2B4CL 3W57A 1F97A 1MVYA 2CA4A 3WS6C 4C54A 5DR5H 3F01A 4BFGA 5EUOF 2VC2B 3LNHA 1WZKA 4XCFH 1JZGA 2Q7NA 1XBDA 3L3OB 1UADC 3ARDD 4FQCL 2VXVH 2VMFA 1MHCA 2L7UA 2MH4A 4PJIE 2ZSWA 3UJTL 3ZRSA 3R06B 4OFKA 4K5LA 5A2AA 4A7GA 4RFEB 2XWXA 3WNJA 1QP1A 4WTQA 5KBPA 4QRBA 1CXLA 4CAGA 3MCLH 1RK0A 2MIZA 3DJ9A 4JB9L 1MF2H 2DEWX 2YBRB 2ATPA 1X5KA 3SKJL 1CT8B 1T6BX 1CDHA 2NUTA 2FATH 4I48A 1J88A 1Q9WA 3AAAA 2BS9A 5ADXK 1CDJA 4H8HA 5CJBA 4CU8A 3RI5F 5I17A 5DVNA 1NCCH 5I1GL 1M3IA 4YWGH 4KV5E 5HHOE 3S36H 4UTAA 3LEXB 2XICA 1NBVL 2HTKC 5F1NA 3QXDA 4PP1D 5ISZB 1CLOL 4B7IA 1F8TH 5AAMC 2A6IB 4MQSB 3H6AA 2AV7B 3AITA 2NY2B 1IILE 2J1ZA 4EZMA 4I0CC 5C6TH 5C0GB 1N8ZB 3MRFB 4AKOA 1KT2B 4U1IB 4KTDL 4KDVA 3QZLA 4TPRL 5CP3A 2ZUQB 1Q9LA 3PWPB 3GMPB 3WFBH 2IAAC 4O49A 2R0LH 3ARBC 4KZEH 3UPRA 4PLKD 1G9HA 1ETB1 1QA9B 4OF5A 4NDMA 1N26A 2LOEA 3CCHA 2YMXL 4UF7C 1KJ2B 5C8JB 2NW3B 2XVGA 1UZ8B 1UEMA 2ZE0A 4UIKH 3ECBA 3GHBH 3LQAL 5IHUH 1WS8A 3BVNB 1CICC 2R23A 4OCYH 2P1YA 4NKIH 4ODXB 4D0BB 1CFQB 5CD3B 4WY7L 3HPJB 3OKMA 3P11H 4HDIB 3AAEB 3T65B 1KN4L 3TJHD 4LEXL 4JVWA 1OHZA 1XZWA 3LXUX 4J7RA 5EU4A 5ILTL 4UUJA 1N64L 1NCAH 4G7SB 4IRJD 4A2MA 4TVPE 2G3XA 4DERA 1CI5A 1LO3H 2Y1AA 5IY5B 4HUXA 4IRSD 1B4LA 3QIWD 4MMZC 3GXIA 5K33A 5AAWA 1HXKA 5E24E 3INUL 5KYUA 5GS3A 2GQHA 4NQEA 3L1FA 3C6LD 5B66O 2OSXA 3SQBA 1MJ7L 5CP3H 3FSZA 3RL2B 4C69X 2BH0A 4YO0A 4RLDA 1EDQA 5EBMB 2AGJL 1R5VB 2DIBA 5KSVA 4NRZA 5JIMA 3WTSA 5DJZA 3NIDF 3L9YA 2XTJC 2EDJA 3FHAA 3GI9H 4ZO8A 4ZTOL 5K9KA 2F58H 1R5IA 1WFOA 3GSVB 5C0FA 1F6AB 3P30H 5ID1B 1HJBC 2X4QA 4FHBD 1U8QA 2PPCA 3VXNB 3OC5A 4LE8A 2OMWB 3KWWB 3HC2A 5D93B 4OCWH 3B1TA 3UBFA 4JFXA 3IN0A 4YDJB 4PJIA 4E42B 3TS8A 3ZPDA 2QKIA 1MI5D 3B7SA 4JY5H 4MNQE 3FCBA 15C8L 4AUYA 5F9DC 3MBED 1NMBH 1USZA 3NYKA 1ZTXL 4YXHH 2KDYA 3T0DA 5E5UB 4X5PA 1SJHA 4ZXBD 5JW5A 3MRRA 2GKIA 4FQQB 2NXYB 4AUIA 1PG7W 2CO7B 2Z8VC 3GC3A 1NCWL 2G3MA 2A9NH 2OSLA 4XVTH 4P5TD 1YY8B 3QRAA 5F72S 1PYWA 4MD5B 1TCRB 3PQYB 5HHOA 3V9CA 4QRSB 2PORA 3OGCA 5C0NC 1C7SA 1L6XA 4WW2A 1FFTB 3NG5A 4D3CL 3ESNA 2B2XL 3HKFA 4BHUA 3EJRA 4UV7H 1DQKA 3MV9D 4MD4A 4YSTA 3IMRA 4P3WA 5HI3D 2VZUA 4CGTA 2F74B 4MCYB 3UTTD 1O7SA 4RRPG 3KG5A 3I9GH 4DFIA 4YHNB 2VABA 2VR5A 3ZDYB 4OZGB 4JO4L 5I1LB 1H3WM 2B16A 1SY6H 4WTZG 2YJLA 3S3DB 4XRCB 1TG8A 2ZG2A 1X4XA 1BWMA 4GYBA 3QPQC 43C9B 2EDRA 2F1VA 4W9EC 3QISA 1IGIL 1RIVH 2CKBH 4ZUUA 4A66A 4R2GD 5DL5A 5EUKA 2VXSL 1O9VA 1IC5H 2FZ3A 3TN0A 1NGPL 2EDTA 3DGGB 3PFUA 5EZJB 4DTGH 4DP2X 1L0YA 2Y7NA 5CWSA 2WXHA 2MRYA 3MRDA 4XVSH 4WU5A 5GSVB 4UZSA 2X3CA 1NANI 2DLGA 5TK4A 3KPQB 3IAGC 1R3LA 1P4BL 3EYFB 4FX5A 3U9PL 1UJ3B 1MCRA 3FONB 3Q0HA 4JY4A 1OSPH 2D2CC 2GC4C 4YGVA 3ZL2A 2AJVH 2Z92B 1ZPLA 5IHBA 4JKPH 1I1AD 1UB6B 1OW0C 4LP8A 1HHIA 2BNQD 1KJVA 3THMH 3MCYA 4EKJA 1YEDB 4PPTA 2YAHA 3H9SA 2AQPA 3T2QA 1J5OL 1GTNA 2IWEA 5FAAA 4PJAB 3W5NA 4HUKB 5EIVA 2HKHH 3K4AA 2Z31D 3DMMC 3QXAB 4EO5A 1D5ZA 2KMWA 3CZSA 4RRPM 3U4BL 3M1BB 1F00I 1JDCA 1JNNL 3W11C 4FI6A 2PTVA 1D7DA 4X0NA 3VXSA 3NZ8A 1AXIB 4ZFFA 1IBFA 5EEWA 3I2CL 2VUKA 3LOWA 3VXME 4F7PA 3QGVA 4GMTL 4U1MB 3AGVA 2I24N 2YK1H 2Y6TE 1GOHA 3VXRB 2QSTA 4Z78A 4AGOA 1FVCA 2DKUA 1KTJA 2QKSA 1YEJH 2X42A 1MFAL 1X4ZA 2M2DA 4NB7A 5FYKL 4MNQA 1H15B 2WLLB 3AA1B 3EFDL 1Z0NA 4X5WB 1R3IL 5AB9A 4NQCB 4ESKA 2E4TA 1U8KB 5KVGL 1J0YA 3AWGA 1CYGA 1PY9A 3IETA 3P4MB 4WV1B 1IQDA 2GSGA 3TIEA 5AZEH 2PPEA 3RWFB 5DJDA 5EIIB 3BKML 2UYLA 4MGXA 2FSDA 2EINB 2VXQA 1EAPA 3LZOA 3O3EB 3FTSA 2HTKD 3MNWB 3Q2VA 3OL2A 3U1SH 3NDZE 2V9TA 4RJWA 4XPAL 1FV1B 3PGDA 3QARA 1IAKA 4X83A 1S7UB 5IW6B 2OMUA 2BDNH 2VN5A 3MLWH 4RAUA 1RCYA 3MKKA 3MRLA 2ZD0A 4JRXB 3IFLL 3H3PH 3IFNL 5D7KD 2G3ZA 1SYSB 4KTGA 2X38A 1H6TA 2NYYC 3BUPA 1T21A 2XWJB 1UQSB 3HVDA 3FB6A 3GLAA 3EDDA 3A6BL 5IOKA 3D87B 3GSRB 3OPZL 4KDTA 1V3KA 1ZHKB 1R6VA 3QEQB 2BOLA 2H3NB 1DL7L 5DUBB 3EGXA 5HYIA 3HOLA 5LNEA 4PRBA 1CICD 5F7LB 1WEJH 3X11B 2ETWA 3HJEA 3UPCA 3FQUB 2PW2B 4MYWB 1KXTA 1CFMA 3H6JA 3HFML 4AJ0A 4XOAA 2QQQA 2G9KA 4KJQD 3TZVC 2OMZA 2A3TA 4YZFF 4BXVA 4DVBB 3KE0A 5D9SA 1JGDA 2ZF8A 3PY9A 3AREB 5D1QC 5FM4A 3LKPA 4KR8A 4HK0A 2X9YA 4X6DE 1NBYB 1RSYA 4JFDB 1XZ0B 2VQTA 5ADOL 2BHZA 2J12B 2WAHA 3M8OL 4P9MH 3S9DB 4YK4B 1BYNA 4F7EA 1F3DH 3H42H 4AIZB 4Z6AT 3C2AL 3LK3B 5ERWB 4I0PB 2BY0A 5IEKA 3FUDA 1N5YH 5CGTA 2C1OA 2KI6A 4MDIA 5C0CB 5JIKA 3S5YA 2J44A 2R9HC 4LKXB 3UG3A 4NUGL 2A4ZA 3AA7B 1DJHA 3ZDXE 5E03A 5EIIG 3BUTA 4ELMA 3BP6B 4BK5C 3JUYA 2FX8H 4BSWB 4OIIL 5J13B 2XTJD 5I1KH 1DP0A 4AZ8B 3IDGB 2UZPA 3ZE2F 3VFVB 3WEOA 3ZUCA 1UURA 3D09A 3ULUD 4HWBA 1MHPH 4HKBB 4L23A 1ODUA 2D31A 3L4VA 1O6VA 4JDEA 4A6YB 1CFSA 1T0PB 4WJG3 2XPGB 4UAOC 5GTHO 4HK3N 3O11A 4GI9A 1ZHYA 5LB1A 2P46B 3LNIA 5FDWB 4Q9QL 3WIIL 1AFVH 3DX8B 3ZY7A 2H26A 3EOBA 3GKWH 2VSCA 5CMAB 2IPKB 4WWID 2VMDA 3BKJH 4UQ3A 2W94A 1KUMA 5HHVL 2YD9A 3CN2A 2VC2L 2V5SA 1HVXA 3ZQXA 3S8WA 3QAQA 1UM6L 2C4FU 2NRDA 3EF7A 4XMKH 1MSPA 1AC6A 3RIFK 2R29L 4JO3L 2CDEA 5C0ND 3DSNB 1MFBH 1QW8A 4OD2A 3KZ8A 1TTRA 3EDJA 2V4LA 2ZOLA 2XN1A 1X5ZA 4MAYB 1T80A 3P3SA 5JDJA 1JK9B 2I7OA 2LV4A 4BFRA 1T1LA 4ODHH 3VRIB 3KZIO 3PV7A 2W91A 3AG4B 2NPLX 2ITCB 2BNRA 5MENE 4PGCB 3DKHA 4KKAD 1FE8H 1PLBA 5IFAH 1ACCA 3WAKA 4JPSA 3QPQD 4MCZA 4LSPH 4MXWH 4P2YA 5FM8A 5CR8A 3FSOA 4KKBC 4PRID 4MJ5A 2N0KA 5DS2A 1CUOA 1J8HD 4WFFE 5FHBH 1DJXA 1T5XB 3HI1B 5H4YA 1F41A 1H19A 1NCOA 1T04A 4NQVB 4DZ8A 2CBOA 4LHUB 4KQ3H 1M2VA 3HB3B 2OQJA 1SEBB 3V4VH 2ATAA 3Q13A 4C57C 4BWUA 2X4PB 4MA1B 3EJCA 5D7HA 1GXEA 3BH9A 3BZDA 3VWKB 3O6LL 3EYOB 3CWGA 4OB5L 2CIKA 3BJLA 4X6FB 5KJRL 1MXDA 5C0JB 1HOCB 1HL5A 1Z5YD 2CLRB 2L7EA 5EU6D 3LXBA 3VFWA 4B9GA 2CO3A 2VITB 4Q9CA 4UTBH 3FDWA 3JYCA 1MNNA 4FQXC 1KJ2L 4B3EA 3QUZB 2N56A 4AI7A 5EOQL 4OAWB 5KYYA 2IWWA 1C5DA 3ZE1F 3DX4A 4EDXB 1MCBA 1C9SA 2PRNA 3O2DA 5AVWB 1O6SA 5T1LA 3AROA 4AVIA 1DSWA 4Z7UF 2QPFA 3B83A 4HJJL 2BP0A 3W11D 3Q2LA 1GCFA 4OBRA 4E9SA 4FTVB 1NGYA 1RAMA 3L7FA 5E8EB 2L7QA 2WWOA 1Q38A 2KH2B 4I3SL 4TNWF 4UDTB 5B21A 1N0XH 1OK8A 3K6DA 1FPTL 1UWGH 1CLZL 3EYSH 3L3DA 4MD0B 4K3GA 3EUUA 1W8OA 5KVDH 1JI2A 1EO8L 2RQEA 3E2HB 3WTUA 2ZP8A 3KPTA 4N2DA 1Q0XL 1ZY9A 1SQMA 3WN5B 4K94H 4IK7A 2XFXA 1CQYA 3QHFH 2J4UP 3OGOE 2RACA 5D2LE 3MHZA 2ZIDA 3EH4B 3H54A 2VRAA 1Z2KA 1CMOA 2ZYHA 4QHMA 3NJMA 4HV8B 1QJ9A 4LHUG 2PYFA 3VD5A 2AQQA 3C6EA 2UUDK 5GS0L 1NBQA 4LSRH 4CU6A 5CUSH 3AADB 2D03L 1KLUB 5DC0A 4R7DA 4XXCC 4Q7DA 4FQ2H 5J5EA 5DD3H 3FUMA 3RE0A 1VADB 3D30A 4J3SA 1MM5A 4X5QA 3MLVH 3T4AC 3DO7B 4Q52A 2NYYD 5GHWH 3Q5TA 1Y6KR 2W1NA 3MKGA 3UBXA 4MJ6B 1M7IB 1N70A 1W91A 2BERA 3TF7C 4JL1A 2WXPA 4JFFE 2NY6D 1ZE3H 1CF1A 3BW9B 5MENA 4BWTA 2MNJB 5I1JH 4YJZL 2X4UA 1GRWA 1WG3A 5DA4A 1E9OA 2FJGB 5ALCL 5B7FA 1F3JA 3HIZA 3NH7H 3LKRB 4P2QB 3VTMA 2JJSA 3WMQA 5CP7B 1TETH 3UTPD 4OGYL 3MBXH 4IS6A 4AXWA 4XBGB 4KVCL 1DQDL 1CGSL 4HIIB 3NSGA 5AVUB 4NNYB 2AVGA 2E9GA 1HINH 3ES6B 3O45A 3TZVD 4BELD 4Y4HB 1IL1A 1NIEA 4V11A 1KEGH 1M7DB 3FQNA 5H4ZA 2Q2LA 3VE2A 3VJ6A 5ESVA 2RGSA 2JWYA 3ETBJ 4GEJA 5C08D 4G5ZH 3DGDA 4NGHH 5EU5B 1YNLH 3KWXA 4B97A 4A7VA 1EO7A 3DXAA 1FG9C 1SN0A 4BH7A 4QYAA 2FUTA 3Q1EA 1WDAA 4X6EB 1P7QA 3RRQA 3SDXB 3APFA 2BVTA 3CHQA 1AP2A 1GW6A 3D18A 3FQ1A 4R4BA 4CVUA 1H6FA 3DLQR 5F9OH 5DJ2B 4HBQA 4QLWA 1BCIA 3B2VH 5IHWA 4RQQA 1IBGL 1OGTA 1OK0A 2Z91B 5D4QA 3GEWB 2F5BH 2HKAA 4YFEA 2J57A 1E3FA 4HKXB 4AQ1A 2ZWSA 2A1WH 3AQYA 4KI1A 3QWOB 5I73B 1SLXA 2FGQX 2WCSA 4TV3A 1CIDA 4F92B 2NY3D 2EZ0D 3CVIL 4KR4A 1BPVA 5GRJL 5E6SB 5IB2B 4JZNA 3MXVL 4PHXA 2X70B 4LLMB 1NEZB 3I02A 5I8KL 1SF3A 2QTVA 3CPLB 1YNTB 4I18A 5KSAD 3TNNB 1G7HB 1XR8B 4JFEA 1EHLH 2EIMB 1FFNA 1AQ8A 2P52A 1KCRL 3ZLQC 1BPLB 3ZYOA 3UMTA 2WBJB 1JN6B 4G42A 3HR5B 5EF3A 3QFDB 4BA0A 3BUBA 3U46B 5DLML 1L6PA 2FK9A 4AMKL 5D2LA 1CZ8H 1G0DA 4E9LA 3U36B 5E4AA 1J9TA 3FT3A 1G87A 4GPVA 1CDBA 3F84A 2UUDH 4JKMA 3O6FB 1HHKB 1BXVA 3E6FA 3FUKA 2B15A 3BKYH 2OP4L 4KXZH 4PJGA 4RBPK 2IG2L 5JHMA 4Z7NF 5I76B 4B3VA 4HS3A 1RUPH 3RWJA 5DL7A 3WOVA 4NNPL 1HSAA 2FJFB 2IAND 5H37G 1YVLA 1DQIA 1TQCC 3SDCB 5K39A 5AAWC 3II3A 4ES8A 4JFFA 2OK0H 1KZQA 1ZK9A 4RZKA 4OZFA 2A6KB 3F12B 4KKBD 3BZEB 5KG9B 3DIFA 1M57B 4JQIA 2ZKXA 2AI0L 3K3QA 2GIYA 3I9PA 5BJTA 2I85A 2VM9A 4RDQF 5DDHB 3FC8A 2XRAH 4Y0GA 2OZNA 1L9SA 5GV0A 3TCLB 4OGXH 1Y7VA 4KO5A 3KM1A 4MSWB 4PJXF 4XB3A 5I2IA 2JKTM 4R96A 1XMEB 4R26H 1NEZG 1YEHL 2QKIC 5DZPA 3B8SA 3HI6L 4GQ9H 5EO9B 5DRWA 4FQXD 2R4SH 4WSGA 5FS5A 3RWCA 1YUKB 4K3EH 4NXSA 2Q3ZA 2QTKA 4QYOA 1XCXA 3K2KA 3MNVB 5IKCB 5FOBA 3B34A 1YAZA 1CXEA 3LCYA 4NRXA 1ED3B 2ZCKH 3BGFC 2VIRA 2F6AA 3UBGA 3NUKA 4YS4A 1T0NB 1FSKC 3EF4A 5AKVA 2Q87A 2N01B 3BEWB 2EO7A 3ASNB 4H5SA 4WW2C 2WXRA 4EN3B 4Q58C 3PF1A 2DDQH 4PTTA 3CVHH 4OLWL 1MIML 2O5NA 3TIDB 5HJ3A 3C60A 3JWDL 1UXWB 3UIZA 1QACA 3PYCA 1FO0B 5JHLH 5GJTL 1GSMA 3LVTA 1AGCB 3O6MH 4P3CL 5E9AA 5F6IC 5C2BL 4URKA 5JIPA 5E6UB 2NX5B 2YD2A 2B39A 4YXLH 5T1MA 3SZDA 5C7ZA 4P9HC 5LDUA 1OGAE 1NC4A 2FO4A 4Y2OA 4L9DA 2W07B 3RHWK 3DO3A 3K91A 4HIJB 5A2CA 1RK1A 1P2CB 3FRUB 4LK4A 3TN0C 3CFUA 1H6UA 3DURB 4A6YL 2R0KH 2ZKWA 4F2ME 5EO0A 3FCTA 2DM4A 4NQDD 1WT5C 5DJCA 4ZUVA 4BGLA 5FO8A 3FFCD 2W0KA 3RA7L 1C1EH 1A3LH 2IAMA 2MQ3A 4RSVA 4F20A 1IM9D 4XX1E 1MCDA 1IEBB 1T2QL 3L5IA 3OQ3B 5T3ZH 4UQ2A 2VLJB 1J48A 1PRNA 2Y5TB 2DYPA 5JOFB 2VSKB 4GRWH 1DVYA 1DLFH 5IB4A 2BSEA 2C3GA 3I84A 2OMYA 3Q48A 4IIQA 2BX5A 3G6DH 2X4SB 4ALAL 4S1RH 3BP4A 2WQXA 4RFNC 2YUXA 5ESAA 1PZ5B 2E86A 1FAKT 4HAKA 1L9RA 3EOTL 1YJDC 3I50L 3BH4A 3P1VA 4UOQA 3LZPA 3BAIA 3PGFL 3N85L 5EPMA 5MERB 2CJTA 4WKZA 4PUBH 1M4KA 1BFVH 3NSCA 4XMZA 2N0MA 4XZUB 1RZQA 3CN0A 3EYQC 2HFEA 4FJZA 4HSCX 4LHQB 4HZAA 3S37L 3FS9A 4JW3A 1KJ3H 1IGJB 1KPUB 2CXGA 1U8HB 4WUUA 5AB0A 4FFTA 4E9QA 3BVWA 3EHBB 2Y7MA 3UO1H 1EBAA 1X5HA 3VZUX 1DHKA 3HLAA 1WPCA 3VWJA 1P6AB 4Y5VA 3O3BA 4M8UA 1FYTB 2OLDA 5T5FH 4HWEH 4HCGA 3X3FL 3CFMA 3KJ4B 2ADJA 3W9DA 3F00A 4JPWL 1G43A 1NSNL 4JDZA 3VG0L 3U7AA 2LFUA 4O3YA 3CC1A 3BD5A 4LLWA 1BG1A 3L6FA 3TH4T 4GRMB 3JTSB 2WN3A 1IGTA 3WNIA 3PDDA 4M6OL 3DBXA 2BW5A 3DJTA 2AABL 1U2HA 1MCEA 4IJ3B 4P4KB 5L0QB 5HD8C 5J57B 1B9KA 2BMKA 4GEIA 1SOQA 5D4JA 1MW0A 4GXUN 4GSXA 3AA0B 5CAYB 4KZDL 4M9OA 3VFNA 1RUML 3SY7A 4QHKJ 1X9UA 3TO4B 1PD0A 3ZDZE 1IBDA 4P2OC 3DVNA 4PJCF 5IG7A 1PMYA 5IB3B 4G80B 4JMNA 2UWEE 1A22B 3B6SA 3N44B 3D85A 1A0QH 4HWZB 2XTSA 1QYGH 5DHEA 1OGAA 4UDUA 1L9NA 3RX9A 3CK0H 3BWUC 3QFJB 5FYLH 5EZOL 2HFFB 5HVGB 2DRUA 2G2PA 2BOBB 1OSZA 4OLXL 1XBRA 5HDQL 4OM1L 1BIIA 2IQ9H 3ZT5A 3E38A 1DUZA 1JHLH 4KV5F 2EH7H 5J7CC 1YEGL 4F2MA 3DJSA 4J3OC 2YAQA 1KYAA 3LK2A 4YFDB 5TDOA 2AS5M 4HJGA 1BREA 3IJ9A 3V79C 2FX9H 2ZCLH 4NRYB 3N50A 5FOJA 2H32H 2PPAA 3T0SA 4LT7A 1H3PL 1L6ZA 4WCYH 2AJSL 3ARDB 3ABKB 3OZ9L 5DC2A 2GJRA 5DQDL 3S5LB 3V0VA 2X10A 4NI6A 4MQ7A 4PY8I 1B2WL 3QDJE 3CVCA 5GGUB 3UTQB 5E4OA 3BZFA 2I5YL 2CGRH 5KSBE 3GUTA 5I6OA 1G1YA 4FCAA 1MQKH 2HFTA 4LCCA 1U8OA 4ZBJA 1HHHB 4PRAB 5SWSD 2AXFB 3P9LA 4XGZA 4OV6F 4X8JA 1NDGB 4Y7MA 4ZO6A 5DI8A 1PL3A 3LS5L 1HE7A 4UT9H 1HEZA 4P57B 3WS3B 4KUCF 4NAMA 2COQA 3CSFA 1U3HA 5D4IA 4FG0A 1JGEA 3CVDA 3Q8EA 4DOHE 5LXGH 1FL3B 2E76C 2OL3A 5DU7A 2B1HL 5HGHB 1JTOA 3MYZA 3TBTA 2XWTA 3BZ4A 2EYTA 3VQ2C 4KKPA 4Q2ZA 4HQQL 3VXUD 4BH8A 3LN4A 1GGBL 3N40P 1GC1L 3OLGA 5E6RB 3V10A 3W0WA 1DYZA 5JLZA 5DFWH 1MREL 2XE3A 2PR9A 2P43B 4Z7QE 4IRZL 3OLIA 4LCVA 4J2QA 1ETA1 1IGFL 1OAXL 1G4RA 2K3TA 4ETQA 4H88H 1DQTA 2QSCL 4HUCA 5EDXA 3VQMA 2EDOA 1KDJA 5IBTL 1I1YB 4N75A 1Y18A 3CNKA 4KUZL 1I7RA 3KHQA 5JPMA 4GW5A 1NOFA 2G5BB 1OB1B 5IYUA 3UCRA 5EUOB 1MCOL 2W65A 1XR9A 2B9AA 5FK9A 1JNLL 2VDML 3TESA 3VVVA 5M94B 4LKCB 5AL0A 4OCMC 3CH1A 3UAQA 4MB1A 3HHSB 2XWBB 2EILB 2VAAB 1ZS2A 4EQ2A 5A43C 4KTEH 1U8LB 4K7FA 4JQXC 3S5LG 4IRJB 4FDWA 2Z3FA 5E00A 4LCUA 3PHQB 4EVNA 4IRSB 3CFKA 3QIWB 4UQCA 5CJXA 2UWEA 2V9QA 2GI7A 1NCIA 3OKYA 1CLYH 2FTAA 1GFPA 4L1SA 3LZFL 5I18L 1ZXQA 3CMGA 5FO7B 2JKLA 3TN0D 4HC1H 3C6LB 3FYXA 4Y1SA 3U9UA 4ORGB 1N6QL 4K5PA 2WWNA 1VFBB 4M7JH 4OVVA 2ZUVA 1R3HB 3K8MA 4Y1AE 3ZN6A 1LEKA 1FF5A 3L3KA 4H0LC 4XX5A 5ALBH 1LGVA 4X0KB 4WF7A 4HUVA 5AKRA 3BSZA 3PV6B 3KPRE 1WWCA 3MRMB 3CX5K 1SFHA 5GGQH 1TCMA 2OMNA 1P7BA 4TVPD 3MJ9L 1RIUH 1XF1A 2DEYX 3T5WA 3D52A 1A66A 4ZPTB 4KJWC 5CILH 3SPCA 1JPGA 3AQDA 1TFPA 4G9FB 2QSQA 1Q9KB 3VX0A 4NQVA 3L8QA 3QUKB 1RPQA 4LP4A 3D3VE 1MI5B 3MUZ1 2YEQA 1NUNB 3H9SD 5JXEA 3MBEB 4LQFL 3ZMRA 5A3IC 4B0MB 1PIGA 4XN8A 1AQDB 3T77B 3UAJC 5IJDC 5KSBA 3HW9A 5K5YA 3L4WA 1KIRB 4AJWA 5ABAA 2FL5A 2VR9A 2VO8A 4RISH 4ZXBB 3WNLA 4N68A 3BWUF 3DX9B 3IFPA 2J8OA 5KOMC 4ADJA 1G7LA 3KVDD 5F9JB 1U95A 4P5TB 3F3HA 3CZFB 2BSSA 3EYQD 4XN1A 3V5KA 2ZWYA 5KS9B 3B5GA 4OQTH 3CFCH 4JO2H 5GRUH 2IH9A 1TZIA 2BW4A 4OTXH 1MAML 4FMKA 3E8VA 1YNKH 4J3OF 1XF2A 2AZUA 5BOZG 4MNQD 3K4ZA 3L81A 4YX2H 4JFVA 4QXTA 1DEEA 5LXVA 3LIZL 3MX0B 3S37X 3MV9B 3HJ0A 1JYXA 4GO8A 5D96B 2WIIA 3UTTB 3SD5A 3JV4A 4QWWC 3ZTNL 1K3ZA 1NFDA 1YEIH 3G5ZA 4UQAA 5C0AE 1HXUA 4MAUH 1HKLL 5KZCD 1WHPA 1DE4A 4POZC 4WWOA 3PXLA 5DVLA 3ASOB 3VI4E 5KVFH 1QO3B 4FULA 3AAZA 5B8CB 3R0MA 4ENZA 4M62L 1ZHTA 4PRPA 1TYJA 1ZDSA 3QJVB 3X13A 6FABL 2BXYA 4R2GB 3B9KA 5TQ0H 4NZTL 3ABGA 3LN5B 3FJTA 3W37A 5KVEL 4MZ3A 2LGNA 1D5BB 3QSKB 3VNYA 1LEIA 5E8DH 1ZPUA 2WJ7A 5DJYA 1MJJA 1TVHA 1QOKA 2H8PA 3HN8A 5JR1H 4R84A 3RL1B 4R3SA 4JDVB 4PLJC 2DIJA 5GGSY 3TWCH 1BJ1J 3MA9L 1TJGH 2MPVA 25C8H 3APNA 4LRIA 1L7TH 4D0DB 1KNOB 4L5FH 2JJSC 4HLZH 5IQOA 2HLEB 1Z1WA 4O3WA 2R89A 5IV2B 2IO5A 3L5XL 1I1AB 4RL9A 2DY2A 4N87A 4C83A 2E9IA 2BNQB 4NT6A 4G76A 4L8SB 4ODTL 3HNVL 4R0LA 4DGYL 1B6UA 4RMSA 3VU1A 4Y1AA 5J9PA 4GI6A 1NPNA 3NIGF 1KXQE 1N6UA 4N4YB 4N90D 4PB9L 2Z31B 4UQBA 4Z5RA 4MZ2A 5KYXB 2YD5A 3KPRA 4BCZA 1FWXA 5E99L 3SBPA 3DJZA 4A2LA 2VB5A 1HC1A 1NGWA 2D0FA 4HUMB 4G6AD 4HUWA 2MSPA 2C9VA 2PW1B 3GXDA 4ZDHA 2DYSB 2JQAA 3ARVA 4JUTA 2VR6A 3UADA 1FORH 1TQWA 3S96A 1XH0A 3WNMA 1UXSB 2OYLA 3K6SA 3FCSB 1CG9B 1ZHBA 2OTWB 4LRNL 2A38A 3QJZA 3OWEA 4AQ1C 3QEHB 1FH5H 4JO5A 3LZNA 1YZZA 3C8DA 2UY6B 2ZG1A 4Y9BA 4GKNA 5IVNA 5FYKE 2P3YA 3MFFB 4DEPC 4AYDC 2P8MB 2RB8A 3KDPB 1LE9A 5IIEA 4U6YB 1G84A 3HRPA 1ZS8B 2OX5A 5I8EA 4FP8L 5EBWB 2ADFL 1N7ML 2A6JA 3LJ3A 1CYXA 3QULA 4I3RH 1KBPA 1A64A 5EN2A 4GQQA 3F7VB 4UV4L 3W82A 1BFOB 1OD9A 1CE6B 3GIZL 4LLUB 3KR3H 1T22B 4X6DF 3N41B 3FU8A 1GMIA 3T1FA 1MLBA 1NWOA 2ZF9A 3QUMH 5J12C 2R8AA 3CXFA 1SM3L 3K2MC 4EUPH 1HKFA 2VDNH 3I6LE 5ETUA 2Y1YA 3PDGA 4XOBA 2DLTA 3VCLB 4K23L 4UZGA 3C5SA 1UCBH 2DBJA 1K4CA 2N3JA 1Z66A 1F90H 5ITFA 5EORL 5C0AA 5ADPH 1PFOA 3O8XA 1IVLA 4D5UA 3MUUA 3IPEA 3I6SA 1I8MA 1T1YB 1BW8A 1JERA 3Q8AA 3VI4A 1A5FH 3ZDXF 2XXMB 4KQ4L 1WZMA 5K9OA 4L05A 2YAEA 1CICB 4GG6E 4F4BA 5AW4B 3MNZA 4PJ9A 3IDJA 4F9PA 3WI9A 3HAEA 2E59A 4LOVA 4P4RB 5I1HL 2BNRD 3UABA 5L8LB 1ZHLB 1BIHA 5B3SB 4KMLB 4HHWA 5H94A 4XOEA 1S8DB 4FADA 4NO3B 4U49A 1DZBA 3HG3A 4OIFA 3H2WA 3X1FA 2CJUH 5D6CB 4MMZB 4TS6A 4GY4A 1RJLB 3KS0J 4PAZA 5MEOB 1R3KA 4PW3A 4GQZA 4GMSL 5IMMB 2WCPA 2XY1A 3Q2NA 4L48A 2H0PA 5KBDA 2CGZA 2X4RA 1AGDB 4WU7A 5ECGA 3S8GB 4XE0A 3KNBB 4W4OA 3WLBB 4MJ2A 4Z7AA 2VSDA 2XTJB 1MY7A 3WD5H 4J39A 1URZA 5EBLB 1JV2B 3NPZB 4U1LA 3TLRA 3VGGA 1BJMA 4HH9A 1KXQA 1P7KB 3IAPA 2B1AL 4H8VA 2XJKA 3L3IB 4AENB 2OJEA 4TUUA 5AOIA 4HA1A 2X7LB 3FQXA 3GBEA 5F6HI 3VXTA 5J6HB 4YE4H 2JXMB 1JMZA 2WMPA 4UNIA 4AG4H 5IUSA 1J1PL 1HL4A 4ZFGL 3DNKA 3K7UA 1A02N 1HX0A 3QUXD 5T3XH 4POUB 4PV8A 1OWRM 3LKQA 2D4FA 5BOPA 1FNLA 5A3ID 2F2HA 4WEBL 2HP4A 5HDBB 5T1LD 1YDPA 1LM8V 3NGBC 1ESOA 2GTQA 3F7LA 4YXKL 5DK0A 5LBGA 2PN5A 5JZ7C 4NC2B 2ADGB 3LK41 1ZLDA 5FUOH 7TAAA 1A14H 3T3ME 3T8MA 4WK4B 3TEYA 1KIUA 3FF7A 2XTQA 1GL4B 1NIFA 1SMDA 3C60C 3OZKA 1C16A 4PJDA 5DZVA 3QXTA 1MCFA 2B20A 2P8PA 3AQXA 3PP4H 1R0AL 2APFA 1MN4A 3PF2A 5F7MC 4BDVA 4DIXA 2FJSA 2IGLA 3N42B 2FE0A 3DUHA 3FOLA 4QWWD 3PGRA 1VAHA 5DTFA 4N0UB 4AL8H 4QXUH 4JQVA 4C8XA 1NMAH 4XWGH 2EUZA 4GQPH 4FXGA 4POZD 4XHQA 3OM3B 1A3RL 4BFJA 1IVTA 3EFFA 1H5BB 1WWAX 2AEQH 2WQSA 3CLEL 1DVTA 2ADIB 4PRIB 3ULVE 1P4UA 3Q5YA 2GITA 2X53A 3ZE2B 3P2BA 4F9LA 4FFZL 1J8HB 2FD6H 2YPKA 3NMEA 2DJUA 1UH2A 1S7VB 2EAEA 2QR0B 1MRCL 2IAMC 3JWOC 4UI2A 4GG6A 2QQLH 5PRNA 2B08A 4OLZL 4QT5B 4ZW3A 3PGCA 4N5EC 5ISZE 2W9EH 3T09A 3PU7A 5I9QB 4BZYA 1ADQH 1XF3B 4BZ1L 2BC4A 2J1NA 1WZ1H 3SKMB 1Q9OA 1T7YA 4ISVB 4IIQC 2Z1KA 1AANA 2V33A 2WAQA 5CJ5A 4X7SH 1MLCB 5EU6B 2DQHH 4LGPB 1UOLA 1MELA 1AHKA 5LGHL 3JXAA 4F15C 2AFNA 1F58L 5IW3A 3PWPE 3HZMB 1E8XA 1S7RA 2F1TA 4HFWA 5DUPH 4F24A 5FPIA 5AYUH 1SN5A 5GXBB 1JGIA 4MZIA 5DWUL 1CXHA 2WTOA 4YBLC 4RMRA 4CVZA 1ZVYA 5L9DL 2A73B 6PAZA 1E5ZA 5HDOA 2CA3A 2AJ3B 5FKAB 3FU0A 3KPMA 1RHFA 3UGEA 3BRGC 5CZKA 1DN0A 1FL5B 3PJLA 4H0IA 1BXUA 1EEYB 3DXAD 4GAGL 2VDLB 5DSCA 4IDLA 1QR4A 2J73A 2YD0A 5EOCH 1GGCL 5FGBA 2JB6B 1P7QD 4GQRA 4GXVL 2XTLA 5ICYB 4AVJA 3VWJC 2I9LA 1GFOA 3IMVA 3OAZK 4Y5VC 1ES0A 4YNYB 1GH7A 5I16A 3P4OA 1Q0YL 2FWUA 4PJFA 3W9EA 4ZUTB 1F1AA 5FLVA 1E2VA 1HILA 3ILEA 5C0DB 3H4FA 4OJEH 3GJFB 3HCVA 2LTQC 2R69A 4QTHA 4ZI8A 1QNZH 2KXPB 4Q0XH 2C34A 3OG6B 4MJIE 3MCG1 4Q6IA 4W9DC 4NENB 3IS0X 2ODIA 3CDYA 1WFJA 4CW1A 2RBLA 1QVOB 4N8PA 4I8DA 5FCUL 3WKML 3HZ3A 3UYRL 1K5NA 1EHXA 1AIFB 4JFED 4GP4B 5DD1L 4HG4J 2GIMA 2F8OA 3JT2A 1U4FA 5AOZA 4FGMA 4FN0A 3P73A 3TJEH 1RUAH 3S3PA 1C5BH 2IOMA 3L3GB 2F7RA 2HN7A 1EWHA 3VFSB 2HKFL 2NY6B 3CFNA 4AYFB 3GO1H 1WTLA 5ABZA 1IGYA 3LKSA 3AMLA 4OLEA 1E28B 3Q9QA 1LNUB 2AQ1A 2FYVA 2CDFA 4NJ9L 4GOSA 4K0OA 2DJSA 3MLXH 1YN6A 4W9IC 5DEFB 2R69H 4AJYV 3GHEH 2K9UA 4L2YA 2EEBA 3MV7E 1J1OL 3OAUL 4XNUH 2N1KA 2EIZB 3TZVB 3QNZA 4XNXL 4WHYH 4LSVH 4HVBA 3LEXA 4TVUA 5T33L 2FBJL 4NFDA 1L4IA 4FXKA 4FZLA 1L3WA 5ISZA 1B3JA 2FHFA 2XWCA 3HC0B 4LU5H 5C08B 1WCBA 4KFMA 1N12A 1KJMB 1PKQE 3UJJL 1ZRUA 4GUPA 4F58H 3UMNA 1KT2A 1YS5A 3G5YA 4OZGE 3QG7L 4LCCC 2ZTBA 3MMEB 5E8PB 3IMBA 3VQ1C 1X9LA 3IWUA 3QG6B 3LD8B 1JDAA 1M71A 1N3NB 3KPPB 2PABA 3TONA 4PGEA 5DQJB 2Z0BA 3UERA 1V7ML 3KYNA 1MOEA 1TMQA 2FHBA 5BZZA 3RB5A 2D3VA 1EZSA 1U3HC 2GT9B 5B3NA 4KMTL 3ZJAA 1RZ7H 2C7UB 4H44C 3VYPA 2Y5QA 2XG5B 3OKDA 4RMTA 5C8JA 2NW3A 1UYWL 1KEML 3NJLA 1NDTA 3NIFB 2DQTH 1HXMA 2EDKA 5F7UA 4PJ7E 4P04A 3ABZA 3KM2A 4S0SD 5TDPA 2VXUH 2HG5B 4CN4A 2FLBT 3OHXA 3HPJA 4FZEH 4J27A 4DP1X 2XXFA 1JVOA 1O75A 4UAOB 3VSQA 3WJJA 3HPLB 3UDWA 2KC0A 2NUPA 1QBLL 4P23A 3OAZH 4YZWA 4QRQB 1XV8A 5B22A 5LN4A 5FO9B 3US1A 4L9LB 5KSAB 5IK3B 1QTPA 1VZHA 4HU2A 3E8UH 3HVNA 4I9WE 4LNRA 4MKMA 3SJVA 4D2NA 1YECH 2V0AA 5T3ZD 3L95A 5JPMC 1IEAB 1MXGA 3ATEA 4MJIA 3T71A 4RZCB 3WE6A 4IBLT 1HEJC 2RH0A 2UXTA 2RHEA 4L3AA 3MUHL 12E8L 3EAKA 5GS1A 3JSSA 4DKFL 3QO0B 4NZRL 3SSGA 4YC2C 2R7EB 4JM2D 3SPHA 5BPPA 3IEAA 4Y7OC 2CUIA 3RDTA 2BSBA 3KHOA 1D5IH 4XP5H 1CGXA 3UEQA 1CFTB 5AVTB 3UP1A 1NJ9B 4OFYA 2WBKA 1KN2H 1NCTA 4X4YB 5F1IB 1U8IB 3WY1A 3B37A 1UA6L 3CSPA 3GBNH 4L3CA 2CQVA 5LHDA 1NC4D 4P48A 1ZHNB 1KCSL 2GTWA 4LESA 4KXZI 4LSQH 1H8LA 3JBG7 5CJXC 3VXRE 4ECNA 4ZX4A 3QRLA 2IANB 1S7TA 2DQCL 4G43A 1LO4H 1D5MA 2HLAB 1KCVH 3DIDA 4HFUH 4NKMB 4P8QA 1B88A 2I07B 3DHMA 4MS8C 2AKRB 2AV1B 2DQJL 4NZJA 2N59A 4ZX5A 5AYQA 4JFPA 5JPNC 2P8LA 4NQCE 1G7MB 4LLQA 3K2UH 3DRTA 5AWNH 4F37K 5BRZD 3NSYA 5HHQB 3IKCB 4MX7A 4UNVA 1J5CA 2AMGA 2IV8A 2WNKA 3A6OA 1JGLH 1DANT 5DL6A 3UXFA 4APQA 3WFHA 1DBJH 3SGEH 3MV7A 3PAUA 1AS7A 2FQEA 4OCRH 3P0YL 2DYPD 3FYIB 1QATA 1TCRA 4I77L 4QRSA 5I6XB 3VU2A 2XXCB 4ERSL 4NPJA 5AD0B 3MRHB 4IIZA 1RH8A 2MOVA 5CHNA 1L5GB 1FNAA 5GGSA 4OZHF 4L4TE 4OLVL 5JXEC 1PKQA 2YC1B 4FQXB 1B4TA 3IXTA 2P42B 2JKWA 2GCYA 4AC4A 5GGRY 1E4WL 3LAFA 3PP3K 3MOBL 2IPTL 4HGKC 3PWUA 3RIAF 1P5UA 4MCNA 1LK3L 2D3JA 5FF6A 1AIZA 4HT1L 1JWSB 1OAKH 3QEQE 4PCSA 2OMTA 4Z7VA 2IEPA 3T2NL 1ZGLM 4J1UB 3QIBA 4RGND 3U79A 3DETC 1QI5A 1I1CA 2YQBA 1M1XB 4XPFL 4XMLL 3FN0L 5MEQA 2CCLA 4LMQI 4WFHD 2PCFB 4NYLA 2QDVA 4WUUD 4X9YA 4LLDA 4AQEB 3V8CA 1PCXA 1LP9E 4U7SA 5SWQB 4PJ7A 1WA1X 1DJSA 4H0HB 5EWIH 4PRNA 5FYLD 1DO6A 3BVVA 2AQRA 2LLLA 4UT7H 5HY9A 4Z9KB 3D9AL 2WKLA 3BLPX 2VDRL 2YAOA 4JFDE 1UJ3A 5PCYA 4B7LA 4GHBA 3AM8A 2JH2A 3VGEA 3IXAB 3MRKA 1DBAH 2B0SH 3V4UH 4UOJA 2AJZA 3QQXA 2WIMA 4QTIH 1LDPL 1UB6A 2YFNA 4PUXA 1WAPA 1OAUH 1B4JL 3B9KC 2D7OA 4PV9B 2NNRA 3HMXL 4XB7A 4AEHH 2QPUA 4KRPC 2EDBA 3EYUH 4HJTA 4AIEA 2DQIL 2WJRA 3TA3A 4XBEH 4K07A 1UFGA 3TNMB 4C4BA 3FT9A 4OZ4B 4NQDB 3FB5A 4PVBA 3AW5A 2CMRL 3FFCB 4JKWA 3MNMA 3ULAB 5KW9H 2JFCA 4KC3B 1PLGL 5FCSH 1E4XH 3LQAC 2Q7AA 1TO4A 4WFEE 1BZ7B 3VFPB 3CN1A 1BVNP 5I1IL 1IM9B 2XHNA 3D85D 3QNYA 4LRIC 4U1MA 5TE7H 1TLKA 2PCPA 3VXRA 3RAJH 2Z9TA 1H0DA 4Z3TA 3ELQA 1HK6A 4LSUL 1A6AB 1VKXB 1MJUL 4KH2A 2QEJA 2IGFH 3OKLB 1L3NA 5F1OB 5HGAA 4QRPD 4JG0H 4R0LC 3DIVA 1WIOA 2WINA 2KQNA 4ZOCA 3WKPA 1IZJA 2CO6A 5TE6L 3P4MA 2HWZH 2PO6A 3GSNA 2E8YA 4JHUA 3P0VH 3LPWA 4FE9A 1F3RB 1KCBA 4PS4L 3MLSH 4FJYA 1I3GH 3NSXA 4TUKH 3O3EA 4PS8A 1HESA 2IDSA 1MHCB 4POYA 2ZSWB 1EGJL 3FQTA 4M3HA 5E2WH 2PWDA 5FUCE 3UC2A 1QRNE 1ZEAH 3HKZA 3O0RH 1A7RL 2CM6A 3ESMA 1RK0B 3JQOB 4M9PA 2FGWH 3BMWA 4NN6B 3ZDZF 1WVZA 4B41A 2YKLH 2ATPB 4L4TA 4YHKL 5D7SL 5F7BA 5KN5A 2YA1A 2VYRE 4CVXA 4G1MA 2FO1A 2XWJA 1V27A 3BPNC 4LPTA 2ZWZA 2NUTB 4I48B 1Q9WB 3AAAB 1AE6L 4EBQH 2QDWA 5I17B 4JFBA 3PP3H 5J11C 2XWRA 1W8NA 1U3HD 2XWEA 3HBPA 3GPSA 2ZXAA 1FVEA 1E40A 4E9YA 3G04A 4Y1TA 4IYKA 1S9XA 3QXDB 4Z0BL 5F70A 4NWTH 1R9FA 1G4MA 4DP0X 5I26A 1RXLA 2XX1A 5LG6A 1J10A 2J20A 2YD1A 2YLKA 2DQUH 2HXAA 3IU3A 3GSNH 3NA9L 3W0WD 2R0ZH 3RZCD 1LP9A 4RAVB 5AEAA 4RCAA 1RZPA 3QCUH 3RVVC 1G7JA 1Q9LB 3NZHH 1F3DJ 2PXYD 8PAZA 1OPGH 3AXLB 4ZUWA 4ZD3H 1ZT7A 3QUGA 2ODHA 2OKMA 3U7YH 5DVMA 4N22A 4JFDA 3RNQA 3U82B 3UPRB 1KULA 1RI8A 3BWAA 3BN3B 2ZWNA 3O8XC 5G5DB 1QI4A 2WLHA 3CCHB 6PRNA 3DECA 5DUJA 1TTCA 4FOMA 2YQ2A 3ECWA 3ECBB 1YCSA 3QCTL 1JXJA 4XNLA 2GY7B 2R23B 4LKXA 4CN6A 4XXDA 5I0WA 1WAAA 1Q94A 2N1TE 4N25A 4PJ9C 4F9PC 1FNEB 1GJUA 2FIKA 2GB2A 1SPDA 2AAAA 5AAPA 4BSWA 1OAQH 5CXPA 3SQOL 1A6UH 1BM3L 2R2BA 3IDGA 1QWNA 4YSQA 5EU4B 4ZMYA 5JQ6H 3CHSA 3ML9A 3NRQA 1DVFA 4UUJB 1JPTL 3SPIA 2XTRA 4G6ML 5EB9A 3UGXA 4M5YH 1HXTA 4HUXB 1WWBX 4D8PA 2TSAA 5J1AA 5L2KE 4OJYA 4WENB 5FKPA 3TYFA 4F8NA 2GEEA 4YIQA 1OKEA 4K5NA 1KFGA 2XPGA 4WWKA 4LARL 2DZEA 3L5HA 3SQBB 3C8KA 4JFHD 1A6ZB 3RWHB 3RX8A 1INEH 4YO0B 2C3XA 3TT3H 5FGSA 2M8XA 4FXTA 2K7QA 4W4OC 5IMLA 5KSVB 3WI4A 3AB0C 4NRZB 1VERA 4RESB 4F8QA 2M06A 2H7WA 5DJZB 1J9QA 4N9OB 4HXAH 3QJQB 3VFOA 4G6KH 5K9KB 5SWSB 4Z3GA 4OLUL 5C0FB 3P0GB 4NQTA 2X4QB 3DVGA 1U8QB 1SBSL 4J8RA 3TEWA 1FFOA 4W6XB 1NBCA 1P4LA 1UT1A 1VFAB 2V5TA 2YGQA 4YVUA 4ZTPL 2MNWA 4JFXB 4PJIB 2PMZA 2YEZB 5CZXC 5FGCB 2YUZA 4H1LA 1O7VA 3C8HA 2HVJA 3CFIC 1MEXH 1XB8A 1JK9A 1RZIA 5JXED 2V17H 3A23A 4UTCA 4WUKL 3E3QE 3VXUB 1CL7H 4AKRA 1QRNA 2X4TA 4BIKA 2AJUH 1SJHB 4NUPA 5JW5B 3MRRB 4LGSB 3IBOA 5FFOA 3ARQA 3N91A 1FBIH 4EDWH 3F58L 3C09B 5GZNA 2OSLB 2NNCA 4P2QE 1UM4H 2FHCA 5JDPA 3DETD 1OOAA 1IUZA 5IJCC 1PYWB 4RLCA 3NK3A 5AYTA 1JWUA 3J2PA 3OGCB 4WW2B 5EEZA 5F7FA 2J6EH 3LZRA 3EGDB 3NFNA 3S34H 4O2FA 3V7AE 2I9TA 1G1CA 3RIKA 4MD4B 3TBBA 5MHSE 2LAAA 1KTCA 2WQ8A 2QGBA 5CEZH 1OARH 4GI8A 4HULB 3VWKA 2VABB 5LQBL 4JQVC 3DVIA 1HOCA 5F6IB 2VL5A 3SDDA 3QNXA 2DOCA 1JK8A 4FXGC 2Q8BH 2HLFC 5G39A 4FI7A 2ENPA 5E9DD 3GEFA 1HCYA 3VUAA 5IQMA 3SDXE 4JPVH 5DD5L 4PRPD 1V05A 3UC0H 3ZVVA 4ZUUB 2N7BA 4F9LC 4YSPA 2OS7A 4K3HA 5IFJA 5EUKB 3NCJL 4KY1H 4XMVA 2FZ3B 3TN0B 3HNTL 5E1AA 3TP4A 4TLUA 1IFHH 3MRDB 4WU5B 2FLRT 4B9IA 5LBSH 1R3LB 2MQGA 3WNPA 4JY4B 3VGBA 4GG8A 3SE9H 1OLLA 3QZMA 4YHZH 3ILQD 3S3JA 2Q76B 1EO5A 3QDAA 1HN1A 3L4XA 2CHDA 4YGVB 4B5EA 1JP5A 3PQSA 1QFWM 1DQML 2WSPA 2ZXQA 5IGXL 4WNJA 1P5VA 2X4OB 5L2KA 1U91A 3KBFA 4HETA 1BDYA 3GSQA 2OCCB 1HHIB 4LXFA 1WFIA 1HIMH 2AJYH 4K7PY 2PETA 4XCCL 1CGVA 1KJVB 2WUBL 3WXWL 4Y16A 4MD0A 2N7AA 1T0MA 3H9SB 4RFNB 4FLQA 3KCPA 1EA9C 2BFVH 3DYOA 4RNRA 4JHZA 4D94A 1JZ6A 1S7QA 4RFOL 3V8UA 3KPRD 3SKOA 3ALWA 4QRUA 5AFUL 2XJLA 1FGVL 5L88H 1PX8A 2DMBA 4IU3A 3SKNA 4F7PB 4RMBA 4D9LL 5K1VA 1RSFA 1MZZA 3ATBA 3C5XA 4M4PA 4KKZA 4YAQA 3TBCA 1MDAA 2GBVA 1DSFH 4Z78B 1FVCB 1MWAA 4OUUB 1SGKA 3PCYA 4TQEH 3UPGA 2DLHA 5E2TL 3RU8H 3LB6D 4TL5A 2CZNA 1VADA 4MNQB 4TQ8A 3R1GL 5C3IA 5C70A 2GYSA 2QQNH 3U0TA 1HH6B 1E3ZA 1CBVH 3MRPA 1EXUB 3O4OC 4MJ6A 4EI5D 4GAJL 4M7KL 3V0DA 3IETB 1IQDB 2GSGB 3TIEB 4MA8L 4OI7A 4FFYL 5DJDB 2UYLB 3B9VA 2HH0H 4R90H 5LGJA 1EAPB 5KZCB 1Z32X 3LKRA 4WEUD 2O5YL 1L9QA 2NDGA 3FZUC 4FQJL 3PGDB 4C4UA 2XZCL 4ABWA 2J4WL 2OCFD 1OF0A 3ZHNA 5EZIL 3MN8A 3POUA 3ECUA 1U6AH 2OMUB 4R4FH 4RAUB 3FPXA 1E8ZA 3MRLB 5EC1A 2WKGA 3F6LA 5SV3A 3DOSA 3RVVD 2EDXA 3L3OC 4YVNA 2Y36H 4JPKH 1SHMA 5CCKH 2WW8A 5KVMC 1HL9A 1T21B 4XODA 2WLNA 4G6FD 3OWRA 4CNIA 2NY5H 3FB6B 4Z23A 1OAZH 4HX1A 3O8XD 4HPYH 5I15H 1XB3A 1MWAH 2OJZH 3D0AA 4X6EA 1QW9A 2IV9A 3MJWA 3V4PL 5LCVH 4PRBB 3SDXA 5D70H 4BUMX 3ULVC 2J8UB 2O61B 1MFDL 1KXTB 5I6LA 1A25A 5T3XD 3N9GL 4DGIL 5DFVC 1G9NH 1BH3A 1KB5H 2OMZB 2QHLA 3TFKD 2JELH 5D6DA 5D9SB 1JGDB 4FXKC 2J2ZA 5CS7A 3VXPA 2F5AL 3FFDA 3LKPB 5F7KC 4HK0B 1ZHWA 3RIAK 3L1OH 3VDAA 4XAWL 1GGIL 3B9DA 1IQWH 1HWGB 4F7EB 5IB2A 4N2FA 5D1XD 2XZQL 1CR9L 2X70A 4K2UH 5IEKB 4BQCA 4QJ3B 2C1OB 4MDIB 3DV4A 2E6PA 3LN9A 3N1FC 2BY1A 4PB0H 3U2SA 3MXWH 3EGSA 3CV5A 2ODJA 2BZ7A 3WFEH 4Z3EA 3Q1SH 1NCNA 4ELMB 5CJQL 4NO0D 3TCXA 4W9GC 3BKCL 4NQQA 4DP9X 2ITFA 4V2CB 5BZDA 1MF2L 1J0HA 4ZRGA 1KTBA 2R59A 1UKQA 2YS4A 4OY9A 3KGUA 3MV8E 4EZJA 2V2TA 2EICA 1S2EA 4J3BA 1IV8A 4JR9H 2EDQA 3HC4L 2B59A 3BDYH 2D31B 1KGCD 1E90A 3NN8A 3AS3A 3OHXC 4JDEB 4KO9A 2WJQA 3OR6A 1CFSB 5AENA 2WZAA 2OSWA 3U25A 5C0EA 1LL1A 1MIEH 5CZXD 5D1ZA 1OALA 4JCWA 3O11B 2KZKA 5EOTA 3L4YA 3UDWC 3WJJC 1VENA 5DVPA 4NCDA 3LSOA 2A9BA 1A9EA 1E6JL 2FJUB 4P23C 1PD1A 1A8JH 2R4OA 2VLJE 5I28A 3L5WA 5E6YA 3VH8A 2H26B 2JKXA 5BQDA 3WIFA 3VRJA 2OZ4H 3ZTEA 2FJFA 1TQBB 2IPUK 4UQ3B 5E4IA 5GGRA 3L16A 3SDCA 2WYTA 3IK2A 3WJMB 2ZOKA 4D9QD 2DQFA 4YLCA 3I74A 1QSZA 1T2JA 1YY9C 4GCQA 1SRDA 5GS1C 2CDEB 2PTTA 5TFSL 4OD2B 4M5ZL 5IREA 2V3FA 3SYBA 3SE8H 3RDTC 2ZOLB 2MOQA 1UOWA 2FT8A 3HS0A 5DDHA 4BKLA 5H2BA 1IZNA 3GHBL 4ABVA 1IE5A 5A7BA 1NA8A 4LBAA 5DZOA 1CTNA 3B2UC 1KENH 2BNRB 4IOSA 2ZJSL 4NN7B 4E9XA 2MQ0A 2HTLC 3P11L 2RIKA 1BXWA 3IE4A 4G7YL 3W38A 1PY4A 4UTAL 5EN3A 4AVKA 1QBAA 1BXXA 2HRPL 4MCZB 1ADWA 1NCAL 5BV7H 2WXMA 3FMGL 5MI0C 3BIBX 1FYTE 4MJ5B 3PGSA 4G1EA 2DS4A 2FH6A 3BP7A 1T04B 1I7UA 4OKVA 4DZ8B 1MFEH 3KVPA 1M2VB 5JHAA 5FYJH 4APQC 2OQJB 4NX0A 2K4WA 5F21B 4K3JL 3Q8FA 3CPUA 3WJLA 4YQXH 4G2AA 3BH9B 1SUJA 3T3MF 5JHDE 4JZJA 2NQ3A 3CC5A 4RJXA 3VFWB 5ACZA 2F58L 4LCIH 5E79O 4DPBX 4AIXA 4AYEC 4EN2A 1D5XA 2ZUWA 4YUEL 1ILSA 1QFWL 1FO0A 4IJTA 5EG6C 1I9JH 5I6PA 1HYSD 2C9RA 4OGAC 1AGCA 1W0WA 3RGVA 4MVBC 4G3YL 3NZSA 1P5UC 5BO0D 3OV6A 2VGLM 4OCWL 4J8QA 5E1QA 1BVLB 3BAEH 1O6SB 4KROC 5T1LB 3QIBC 4DUXA 3P9MA 4BUGA 2KBGA 1RVFH 2XLLA 1OO2A 4JFZH 2ZCHH 4YXHL 4U31A 2BP0B 5F7EH 2FDBP 3ULVF 5ACLA 2A77L 4R8WH 4MB4A 1NGYB 1JGVH 3L7FB 1EAOA 3MV8A 2A9NL 3KPSE 4PI0A 4Y19A 1P4IL 1A7NL 3R7QA 4A39A 1A4JA 4O02H 1V7NH 3LPOA 2ZX8A 3VW3H 2BJML 4K9JA 1CXIA 1UJ3C 2D7TH 3L3DB 3ZZLA 3AM8C 4WAFA 2NY1C 5HP5A 2XQ0A 2YIHA 1IBYA 2Y5TA 4KHTL 2XFXB 5I30H 1MRDL 4N2OA 5JOFA 1P69B 4HKZA 4UT6A 2UZYA 1KCUH 1HHGA 4Y89A 1E4KA 2W0FA 5CCHE 1N18A 1GJIA 1HZHL 4OF7A 1GPOH 2PYFB 4MRCA 2LLGA 2G0KA 4X7FC 1IBBA 3DI2B 4DP6X 3FZUD 3K8LA 3LXCA 4WNSA 3EJUA 4R7DB 4XMPH 4WJ5B 2FO8A 4U1KA 3RGBA 3L9EA 2NDFA 3UBXB 2EXSA 5MEPA 1F42A 1T7VA 4RWYL 2GJPA 2BP8A 2LR4A 3S35L 3MSPA 4HCRH 4JPIA 2EDMA 5C9JB 2EYSA 4XVSL 3HW7A 1IGJA 4XVJL 1GYWA 3NFPA 4W4NA 2K6WA 2X4UB 1E9OB 1S5IL 1F3JB 1HTYA 3TT1L 1X6LA 5D7JD 3IDYC 2G5RA 1KCLA 2IBBA 3NQKA 3ZIMA 1RZKH 1PZ2A 4AUJA 2AJVL 2PO6C 4PN6A 1A21A 4AXWB 4QRTA 5AW0B 5I5JA 3ZSSA 2WC7A 4JKPL 1AQKH 4ENEC 4UT6H 2I32A 1PF3A 1IL1B 1JD7A 3WEAA 4QXGL 5DUMH 4R4NC 3THML 1R34A 3FQNB 1E27A 2DLFH 3KBEA 4N2AA 5BZWB 3VJ6B 1K8DA 4NCC1 5ESVB 3BP5A 5CU5A 3GWJA 4CJ1A 5JHDA 1NC2D 3TPKA 2JMMA 1AQHA 3DXAB 1VPOL 3H1ZA 1E2WA 2O6CA 1N2RA 1KMGA 3Q2CA 4BH7B 3UZVA 1FC1A 2KQMA 3ILPA 4KVNL 3CDCA 5F2FA 1P7QB 3DVFA 4U1JA 4C55A 5BQ7A 3AJ7A 2FX7H 5E0QA 3D18B 4I87A 1AP2B 4UQIM 4R4BB 3TPUA 1NCJA 4M7LL 2JTYA 4DT2A 3MACL 1N9PA 4RQQB 3FN3A 1OGTB 3B3IA 3B1UA 3F83A 5IB3A 3FKUS 3HA0A 4HXBL 1UFUA 1NCDL 1NCBL 1W8EA 2K6ZA 3L48A 2CR6A 3SYCA 2VQUA 5DK2A 4AY0A 2V9UA 1XEDA 3NBNA 3FQ4A 4DEPB 4TVPL 2E9BA 5E2UL 1S5HA 1IC1A 3M6DA 4IGBA 2B4CH 3B9AA 3CDFA 4JZNB 2EE6A 1GHFL 1OM9A 4K71C 5E94A 3UBXG 5KAQG 4RGMB 3KPSA 3I02B 4IBTA 2AAVA 3ILDA 4P23D 3U1SL 2GAZA 4I18B 4JFEB 1KBBA 1XGPA 1FFNB 1A7BA 4FQCH 5FV2A 3SGKC 4K55A 4G7VL 3SJVD 4K8RH 2BDNL 4G42B 4LVOB 5EFIA 2ZXEB 3UJTH 1YJDL 1SN2A 1XGZA 4G8IA 5J12B 1X9RA 4MJID 3FO9A 2B77A 1FLRH 1MI5E 1SUHA 1OP5K 3S5LA 3SYOA 3ZDYF 5D2LB 4OZGF 2MFNA 1YY9D 2YUWA 3C6SA 3LKOA 4JB9H 4X6BA 1BGXL 3KPNA 3CMOL 3UTQA 3DUSA 3U83A 3FT3B 4D9RE 3SKJH 1Z3RA 4ODVH 4XN9A 3RDTD 4L4VE 4N0YL 3WXVL 3E6FB 5J6GA 4OFYD 1TEYA 1GGTA 2APWA 5I1GH 4JFYB 1GY2A 4PJGB 5CN3A 3CU1A 5JMRA 5T1KA 4LIQE 5DJXA 5KS9E 2D4DA 1NBVH 3B2UD 2FECI 4FQPA 4HS3B 4X99A 3RWJB 5DZJA 1CLOH 1HSAB 2HTLD 5I0VA 4QY8B 5K39B 4XCNA 3MODL 4JFFB 4WWKC 2V6HA 1U33A 2BIMA 1Z5HA 4PI2A 4OZFB 2VXQL 3FU6A 3RFZB 1WUZA 3DIFB 4KTDH 4U2YA 3UTTE 1INDH 4TPRH 5LDSA 1SFDA 4K9EC 4I7ZC 2CHZA 4X7DC 3W39A 2Y7QA 2EUVA 1TQTA 5BJTB 2VQ1A 5I1CL 3H42L 1WE5A 4P59H 1I82A 1THAA 4APQD 2ARJA 3MV7D 1UD6A 2XG6A 4NQUA 1OPFA 2YMXH 4X98A 1XHHA 5DHXB 5I2IB 1ACYL 1DQVA 5KANG 1WZAA 2O6PA 4JFUA 2VISB 4PJAF 4R96B 3WIAA 4BGDA 1QEWA 5HGDA 3RGHA 4U3CA 4LSFA 3FQWA 1XMWA 4DGVL 2F8XC 4S11A 5FUCC 5IR1A 4DAGH 2C3WA 5DRWB 3U2IA 4LKCA 1D6EA 1KN4H 3ZO0A 3RWCB 2ENSA 2J21A 4OGAD 5ILTH 1H6S1 4MVBD 1N64H 4QYOB 4KJYA 5ENWA 2Y7SA 3MA7A 1R33A 5FOBB 4FFVD 4NRXB 1U8LA 3D4YA 2VIRB 5GZNC 4IRJA 4GAFB 2CK0L 4KROD 3QIBD 1WS7A 1OEZW 3NGBB 3INUH 2NY0D 1FCGA 3ZZQA 3QIWA 2APBA 4DO4A 4R7LA 2AXTO 1LEGA 1MQ8A 1KTLA 4H5SB 2WY3B 1J7VR 4ZAKA 1MJ7H 3FU7A 5E9NA 2BNQE 1ET5A 3TBYA 3SD2A 3S3CB 4GF4A 3SGJA 4PTTB 3T0AA 1KFAL 2AGJH 2BCKA 5HJ3B 2K8QA 4OCXL 3GD1C 1WICA 3C60B 3GMQA 1X4YA 4L1TA 2IBGA 4XMKL 4ZTOH 3VWKC 1BQ5A 1TYEB 4HCFA 1QFHA 4H40A 2NY1D 1UWFA 4OFQA 1GKOA 3RWDA 1A1OA 4ATTA 4OZFG 5T1MB 3HRZA 1R1CA 2LT9A 3GSUA 1NC4B 2FO4B 4Y2OB 2K4TA 3M17A 1C7TA 3OLEA 4TXVB 15C8H 1E8WA 1RK1B 5E8OA 3FB7B 3QUKA 4HWBL 4D0CA 1K5WA 1NINA 1MI5A 1OP5H 1EJ6A 1FE8L 1ZTXH 4GCPA 2CBQA 4O4XA 4OKDA 3EKCA 3TA3D 4FLSA 2Z93A 5JOPD 5EO0B 3FCTB 4JZOA 3K4DA 5BRZB 4D64A 1KIRA 2E6JA 5DJCB 4ZUVB 5FO8B 1NCWH 4L4VA 2HFGL 3RVUC 2E7DA 4IMLB 2LU4A 3K74B 5GGVY 4XCEA 1M2OA 5IFHH 4P5TA 4UQ2B 2YAPA 5KS9A 2DYPB 4JRYA 2E9JA 4ZW8A 4D3CH 2B2XH 2Z7YA 5IB4B 2Q8AL 2OMYB 3SGEI 5FHAH 4ELKA 2EDEA 1RERA 1WC7A 5D7KE 3S35X 4Y16C 4F15B 4FI8A 4AV0A 4DP7X 3BP4B 5BW7A 3E2HC 3U2JA 1FNSL 5DS8B 5ESAB 4MXQD 2PO6D 4JO4H 5DEGA 3UTOA 2JIXA 4AEIL 4YBLB 1RL1A 4IU2A 4IKIA 5IVZA 3EJYC 1P1ZB 1LYQA 5EPMB 4A1RA 3J8F7 4R4ND 2I60L 4WKZB 4ODBD 2OXHA 2WOYA 4BK8A 2B5IC 1IGIH 1IFRA 4RGNB 2HFEB 4GW1B 1DANU 2VXSH 5C0IA 3K6IA 4XN4A 4M6NL 4WUUB 1NGPH 1REIA 2ENQA 1RURL 2DQEL 3CSBA 4L4TD 3HLAB 4HKJA 3QRCA 2MCPL 1P4BH 3VWJB 3U9PH 4M4RA 5HPMA 1OT4A 1XAUA 1KYOJ 3QQ4A 3BHBA 3RX5A 5TK2A 1T6VN 2ADJB 4QOKA 2X88A 4JDZB 2NSXA 5TF1L 2LTQB 2XT1B 4EXPX 1JNJA 1QSFA 4AKPA 3S5ZA 1IGCL 4LLWB 3B2PA 3H9HA 5IBLC 4Z7OE 2GI0A 3L6FB 2XX0A 3H55A 2H32B 1BQKA 3D25B 4F7KA 2VLLA 3DBXB 2C9AA 2FIRT 2QSVA 2NY7L 1CE1L 3QHFL 4Q56A 1HQ4A 2CBMA 2BNQA 1IT9L 2JV6A 2DV6A 2ED7A 2MKLC 4PCYA 3R7RA 4DZBA 1LO0L 1J5OH 1S9YA 4FQIL 3CZNA 1UACL 4IBSA 2XTJE 1MCWM 4AYMC 3VFNB 2MOGA 5SX4H 3H7LA 1PNDA 1RQ5A 5JA9A 1JNNH 2DD8L 1L9TA 3ULUE 5IG7B 5IZ7A 3O2DL 1I9IL 3FRPA 3IVKA 4GMTH 4CMMA 2LW3A 2BWQA 4Z77A 3D85B 1E4XI 1OGAB 4UDUB 5I66A 1MFAH 2CUMA 4WSJA 5FYKH 5IROA 4W1TA 3GIVB 4FJ6A 1Z0MA 3T0VA 3EFDH 4BV1A 4XNYL 5JQIB 3BO8A 1U2YA 4GKOA 5I1JL 1OSZB 5KVGH 2C3VA 1BIIB 4QRPB 5DMKA 2OTWA 1U41A 5D6DC 4JKKA 5AVYB 1DQLL 3HBQA 1DVFD 2F0CA 3LK2B 5TDOB 4J4PA 3OMZA 3TO2A 3GGWA 2DI7A 3CN4A 4HJGB 4MLSA 1FNGA 2X2IA 3MFFA 1C08A 3WGVB 1LDSA 2A7BA 2CG9X 3TBVA 4XPAH 3GF8A 4GSQA 4WJKB 4WWKD 1KXVA 1ZS8A 3ZKMC 5KJ4A 3V0VB 2K1MA 5HI5C 1W0VA 4LAJH 3V0WL 4MQ7B 4BSVA 3IFLH 3IFNH 5CLYA 3GMOA 3BZFB 1LO5A 2Y07H 4JM0A 5GS2H 5D5ME 4B27A 3NCMA 2KHAA 4ZS6D 3GUTB 4AMXA 4X4KA 2XBTA 4LCCB 2WBJC 1BVKA 1U8OB 3DK0A 4W9KC 3EOAA 3US9A 2ZAHA 4CA4A 2MEJB 3ZIYA 4O3ZA 3A6BH 3P9LB 4CC1A 3OPZH 4X8JB 4XGZB 5DI8B 1A3QA 3TVMA 2YA0A 3VCLA 4P46A 1HEZB 1RKRA 3US0A 4PCTA 4PRIE 1U3HB 5F9OL 5I24A 5J06A 5LLIC 5JIIA 3BCDA 3B2VL 1JGEB 4XWOC 1JI1A 3QC6X 3CBKB 1T1YA 1I8IA 4FNUA 5INDA 3O6FC 2ARJQ 5D1ZC 1KELL 3TYGL 3MDJA 5FM5O 4ODSL 3EIFA 2XN0A 1DBBH 3RB7A 1GMEA 2XWTB 3BZ4B 1MFVA 3SPJA 5E7BA 2APVA 3WIHA 4Q2ZB 3LDBB 4BH8B 1QRND 1YMME 2HUHA 4UB0H 3ESPA 4Y9FA 1DCEA 3W0WB 4P4RA 5JLZB 3RZCB 2R1XA 3SDCC 3IGAA 3MPCA 4JFWA 4R6UA 4FG6C 2PXYB 5EU6E 3GFUA 5GZND 3M8OH 5ADOH 4NO3A 4XNQA 3RKDC 2E56A 4RIRA 2DKSA 3C2AH 3K8KA 5DMGC 4KK5C 1Y18B 2O5XL 4ZQKA 1I7RB 5AZ2H 2IXQA 5JPMB 1SQ2N 4GW5B 4TN9A 4NUGH 2W65B 1XR9B 2VH5L 3HS0C 4TTGA 1O5DT 4LPCA 5FK9B 1S7XA 4OIIH 4U0QB 1G90A 2IDFA 5DO2C 2EEDA 4KK6C 2R51A 2IH1A 3CH1B 5JO5A 1XCTA 2XPZA 4GUQA 3P4LA 3CLWA 3EW3B 3D48R 2BP3A 3LKNB 3SY9A 3SDDD 3X3GL 4K7FB 2FR4A 5A1AA 3MV11 5AOJA 5E00B 3QQ9D 4LCUB 4EVNB 2P45B 4DUWA 2UWEB 4FYQA 4HJ0C 4WI5A 1RUPL 1MRFL 4AOFA 4Q9QH 3WIIH 3IJSA 1I8KA 2YMOA 3U9UB 2A2QT 4OT1L 4LLVA 4K4KA 1FZJA 4G7RB 3OB8A 3BI9X 3DV6A 4QIRA 2OULB 5DHMC 1CGUA 1LEKB 3L3KB 3WJLC 3Q8CA 5TH2A 2GHWB 2UZXA 5HHVH 4DKDC 4HUVB 3RVUD 2OA9A 2V7HA 4U6VL 5GPRA 2VC2H 1GZQA 4JZJC 1UM6H 4ZZFA 2H41A 1NFKA 4EN3C 4XO3A 2R29H 4JO3H 5J89A 3IDXL 4U1NA 2DIEA 1INQA 1OTUC 3N3EA 5L2KD 1JPGB 1YEFL 2QHRL 4WIQA 4OBSA 3RGVC 4Y16D 2WWMC 4FL4C 5IEHA 1I9EA 3DUUA 3V6FA 4AV4A 1ML0A 3SYQA 1RZJC 3QJHA 2FBRA 1B3IA 2R2EB 5D5MA 2Q9OA 3WSQL 1XXFC 4X8CA 4M48L 5KSBB 9CGTA 3EJYD 2X3BA 3BPLB 1E5BA 1EERB 1CL7I 3SDXF 2EEFA 2EACA 3IFPB 2EADA 2IBZY 1G7LB 1U95B 3WFDH 2BSSB 4BM7A 1PGRB 3KH3A 1OP3H 1FRGL 2FEEL 3UTPE 4N2EA 1DJZA 1TZIB 1RPKA 2WVSA 1K8IA 1XH1A 3RP1A 4UAHA 4DOHB 2P80D 2A9ML 4Y2DD 5SWZD 4JQIL 1S7VA 4ZS7L 2QR0A 2Q7YA 3H9YA 1DQJA 4XMUA 2F8IA 1YMMA 4OB5H 2WIIB 4H4NA 5FWRA 5KJRH 3JV4B 4YFLI 1GFNA 2EEAA 3D69A 1G7PA 1NFDB 3SPGA 4IOFD 3G5ZB 2W8CA 2DH3A 2DQDL 1JOIA 1E4KC 1AH1A 2ERVA 4Z7QB 4O3XB 2UXFA 1L9PA 1DE4B 1YNTF 1MVFA 3HTLX 3O6ML 4ZW7A 4MZRA 3P02A 1KJ2H 1LWRA 1BWWA 2I26N 3DWOX 3AAZB 3FSVA 4U1HA 3WTWA 2D8KA 1OCWL 1IKNC 4PRPB 5F7YC 3X13B 1K3IA 2XI9A 3TXAA 2A4CA 1CGWA 1LK2A 2G75A 3B9KB 1BZOA 1OT2A 3JWNH 4L1HA 3A0OA 2Y2YA 3G6JE 3HWBA 5IM7A 3KBPA 4F8PA 1LEIB 2WO4A 3BSHA 1GIGH 3ZMNA 1TXKA 2AJ3A 5EOCJ 5DJYB 1MJJB 3S4SA 4PJBE 4HJJH 3VSVA 2R0KL 3NIFE 2JJTA 3ATAA 4XH2B 2AQNA 1EEYA 1E2ZA 4R3SB 1T3FB 3KYMA 4I3SH 1BXAA 5HYFA 4K15A 2YARA 1A1NA 1A3LL 1FPTH 5C0RL 1BM7A 1S78D 3E9TA 1JJUA 1CLZH 1MNUL 1GYCA 4M93C 4WI4A 3T2LA 1KGXA 1G9MC 4LPWA 4WZ9A 4BEIA 1FJ1A 3PL6D 4U6HA 3REWA 4C83B 2DAVA 2NXZD 3II2A 3VDCA 3RUGA 1EO8H 4X9GA 3ESVF 4NT6B 1Q0XH 5F3BA 5L2JA 4R0LB 4Y1AB 3VE1A 5J9PB 3IF1A 4HPOL 4ANVA 1T89A 5ITBH 2VUYA 4NENA 4Z5RB 2UV3A 3L5JA 4O4UA 4FSPA 3KPRB 2C1PA 1UGNA 4K8RC 4M3JA 5DF0A 5GS0H 1AKPA 1NGWB 2BVOA 3C5JA 1HXYA 3QUHA 3PRNA 4HUWB 3VB8A 4HLZG 1Z3GH 1TQUA 4Z76A 3ZKMD 5FEBA 1OTSD 1W72A 5HI5D 43CAB 4ZDHB 2HJLA 3BUDA 1JPSL 5D71L 1VEOA 1QFOA 1YA5A 5E4EC 2WM0A 4OF3A 3TO4C 2XA8L 4DGWC 4L18A 5A6MA 3S96B 4OF8A 2FSEA 1KJ3L 2GUOA 5LVEA 1ZA3A 1I3RA 2DEXX 3D5OF 1IAMA 2EE3A 2IANE 3PWJA 1SEQL 1ZHBB 3E80A 4LPYA 4EI5B 3F7KA 3KLHD 3BPNB 2ZICA 2P7TB 5T5NG 4GKNB 3JWOL 3KH4A 5ALCH 2FB4L 2XVBA 2VKXA 1XIWD 4RVBA 1LE9B 2KZ1B 1CI3M 5IIEB 2JCCA 3VM7A 4IGBC 4FQLL 4OGYH 4UQDA 5D1ZD 4X4ME 5T1DL 4RLBA 2OX5B 4S2SA 4KVCH 3WY2A 3ECQA 1DQDH 1CGSH 1RK7A 5I8EB 4A55A 2W80C 2ROXA 2A6JB 3QULB 5G26A 3SY6A 5EN2B 1WCQA 1F4XL 3AWFA 3BS0A 4XO4A 1KLGA 4NO5B 3T1FB 2CWRA 1KLFA 1MLBB 2EE0A 3ARDC 4MNGE 4F5CE 3VQLA 4G6FB 4NHUB 5ETUB 3ARWA 4TNEA 1U21A 3C5SB 3TV3H 3QW9A 1K4CB 5ITFB 5DMGD 3O8XB 4KK5D 2RA1A 5ICXA 2WO3B 1CD1A 3LEVL 3VI4B 1M9SA 3F85A 5IWLA 4FLOA 3GINA 3QG6A 4AZUA 1N3NA 5K9OB 5LAPA 1IBGH 1FAIL 2X44D 3MNZB 4PJ9B 3IDJB 5DO2D 1BYOA 1EK3A 4KK6D 4WEMB 1ZVSB 2KPNA 4TM9A 4IOSD 3AFLA 4W6YB 5L4IA 4Z7OB 3G6JA 4PGBA 3GMRA 4EUPG 5H94B 2XCMC 4PJBA 1OE1A 2CHXA 3OQRA 1OP4A 4F7CA 5GRJH 3W56A 4J3XA 3ISWA 2GSIA 3MXVH 5D7IA 4J6RL 1PDKA 1NGQL 1R3KB 3GB7A 3Q8BA 5I8KH 4GIPD 2WTPA 2AEOA 5D1XB 4G72B 4L2LA 4PJEB 4HS8L 2XU9A 4IL6O 1JPEA 2X4RB 3QXWA 2O26U 4NZFA 2EIJB 4L9LA 3EZJB 4JGNA 1G6RA 3AB0B 4PLKC 3GZQA 5DLMH 3SN6N 4AMKH 1RU9L 4U1LB 3NCYS 4HH9B 1MQKL 4PWFA 3WO3B 1TNNA 1LO2H 1NAMA 2DWSA 2OJEB 3GT6A 3ETBF 1H3TA 3VXTB 1A6TA 3FQXB 4FQ1L 3QPXL 1ZVNA 3VXSE 4XN2A 2WMPB 1CPUA 3D2UA 1EJOH 3GNML 4NQDE 2IDCA 3RGVD 2OP4H 2WWMD 3FFCE 4ATWA 2D73A 4PV8B 2IG2H 3LKQB 3ZBMA 1ZLEA 1NJ9A 2E46A 3D50A 3MLUL 4KXDA 5AQ0A 4NHCL 2EP6A 4IRJC 1I9RL 4NNPH 3QI9A 1YDPB 1VLXA 4AX3A 1ZHNA 1OIOA 1DJYA 4BD4A 3QIWC 5DK0B 1PZCA 2HLAA 4X7EC 4ZAKC 2I07A 2QGDA 4BXSV 1TSRA 1XL6A 4HISA 3SGJC 2AI0H 1HCVA 5INCA 4Y19D 2K9FB 4JK0D 4E68A 4N0FA 3DX1A 4FKHA 1C16B 4PJDB 4P2AA 2G3NA 3K6OA 3ZTJH 1T7XA 4Z7WB 2CE6A 4BDVB 4ANUA 2JJUA 5DD0L 3AT0A 4LP5A 1TKWA 2Q5BA 3E7JA 3SDAA 3TGXA 4NWUL 3T6QC 3D1MC 2XG4A 3DZMA 3NK4A 3FOLB 2DBLL 3FUNA 1NAMH 3HRZC 3LHPL 5DTFB 4HG4K 4QJ5B 1F6FB 1YEHH 5GGVH 1VGEL 2XWDA 3HI6H 1TPXC 3CU7A 5AD0A 4MNGA 3GM8A 2E9WA 4FXGB 4QDGA 5KUMA 4F5CA 3S8FB 4LLYA 3OBAA 3LH2H 1UD5A 4H26A 3EFFB 4P49A 2CJSA 5I8OL 4XNKA 4W9FC 1S9WA 2GITB 3BRFA 2OL3L 5G3AA 2FEDC 3N44F 4CSTA 1BMWA 4JX0A 3WY4A 4ONHA 3VTAA 2BP5M 1ZLUH 4NNXA 5AW3B 1F11A 4GG6B 2ISDA 1MH5A 2YLHA 3PGCB 4P5TC 4ZMOA 4KKQA 3OR7A 2CPUA 4P07A 4TMPA 4JG1L 2BC4B 4R7VA 5B5EO 4FCHA 2V37A 1WGOA 1Q9OB 1HZLA 3FULA 1CFNA 2EYRA 4GO6B 4OLWH 1XSOA 2VM3A 1WRFA 3IE9A 5SWQA 3JWDH 5BW7C 5GJTH 4BZ2L 4HFWB 4FNTA 5D96C 2HZHA 3VGDA 5C2BH 3A2SX 3NOIA 1QZNA 5D55A 1T1ZA 3OSVA 4YHPA 4W9LC 4CVZB 3F7YA 3V6ZA 3S88H 4UU9B 5GRVL 3KPMB 5JHDD 4JFSA 4K8RD 2AHIA 5KYWA 4HIEA 4C58B 4R2GC 1JGUL 4A6YH 3OC8A 2DQ6A 5DSCB 2R1YA 2XBDA 1TTAA 5LUMA 3IRPX 2VDQB 1QSVA 2FEJA 3WHE0 4R97C 2VDOL 1IKFL 2Y1ZA 2I9LB 1JFHA