4AYDC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 r106a mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
247
structure length
238
Chain Sequence
DIGAGLADALTAPLDHKDKGLQSLTLDQSVAKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEITLESGEFQVYKQSHSALTAFQTEQIQDGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 238
sequence length 247
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aydC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aydC01
2KDYA 5T5FA 4AYEC 2LFUA 3PQSA 4O3YA 2Y7SA 2YPVA 3UAQA 3VE1A 4O3XB 3V8UA 4AYMC 4U9CA 3KVDD 2W81C 4QQ1A 4O3WA 4AYNA 1YS5A 4O3ZA 5EE2A 4AYID 2KC0A 2W80C 3PQUA 4Z3TA 3VE2A 4O4XA 3HOLA 4O49A 4AYDC 4O4UA 3HOEA
chains in the Genus database with same CATH superfamily
1CFTB 1IB5A 5I5RA 2EIZA 2N2LA 4F1SA 2EIDA 4UIMA 3REWB 1CGVA 5AZUA 1LO5A 3WEXB 2YO3A 4Y8DC 2V17L 1CLOL 3NCBB 2NT0A 5JHLH 4L8DB 1CZ8H 3KE0A 4CC4C 4H88L 4QRSB 1VEOA 4UAOB 4AYID 4ABUA 2DMKA 3O2VL 3RZWA 2L0DA 4NQDD 2E47A 4JEGB 4R2GD 5BQDA 5GGRA 4FQQA 1OAQH 3E7JA 2EYRB 4FZEL 5HGDB 3WLWD 4OQTH 5INCB 4FXKC 5D96C 3VW3H 2TSBA 4K9EC 3U7WH 4PGDB 3WNPA 3I3BA 3INUL 1HAWA 1JF1A 5DJCA 5K1JA 2VCOA 3N44B 3RZCA 2NX5E 1N2RA 4PJBA 2XVGA 4DETA 4UCFA 3MV9B 4DPRA 1KULA 1JZGA 2DMGA 3ASOB 3SPHA 3QZMA 5JDSA 2G5BA 5F96L 2GJRA 1AJ7H 1OL0A 1PZ5B 2JIXD 4M7KL 4JE4B 3UC0L 3VFNA 1IKOP 2NZ9D 1GZHA 3GPEA 3T0EE 3WEOA 3W57A 1CFQA 1KZYA 2J1ZA 2P8LB 2YOCA 4LQ1A 4Y16B 4Y5XA 5A2LH 5G39A 1YEKL 2HSIA 1SJMA 3GS0A 4QRRB 3VGFA 4ONHA 3L6FB 5DUPL 4KZDL 5KZCB 4AW4A 2G30A 1AKJA 3D30A 3P4MA 3CFJA 3WFCH 3MRMA 1RZKC 3IB4A 2WZPA 3TBTA 2P7TB 2J73A 5GSVA 3TV3L 4N26A 1GS7A 2AV7A 1OSZA 8PRNA 5GJTH 3VNZA 2Z7YA 1EMTL 4JLRA 4NENB 1A4KB 3Q9PA 4DAGH 5KS9B 3JWDC 2W0PA 2LV4A 4RDQG 4HU8A 1BD2E 1T21A 2IF7A 4BM7A 3NIGE 4ZXBD 1SHWA 2IXQB 2VC2H 2XICA 1T0NA 3SOTA 3FU0A 3INOA 3ZMRA 4IQHA 2CDEA 2ICEC 2V7HB 2VW4A 3SPIA 4N9GB 3B4NA 5T3XE 5DS2A 1NUFA 4KMLB 2WOYA 1FJ1A 3D12B 5GGQH 3ZT6A 4X6BA 1XCQA 4OLXL 1HL4A 4PEEA 5FYKU 3ULUL 1AZVA 4AYFA 2PW2A 4LU5H 3G04B 3C2AL 1I1YA 3WIHA 5IEKA 4GXVL 5AVYB 1IQWH 3MRNB 4Z9KB 1S5HA 3RNQA 2VWEE 2BFVH 3NJIA 4JN2B 2C5DC 2O6DA 3ECBB 1TITA 3L13A 3L7EB 2WZ5A 1USQA 2G3NA 5E6UB 1YMHA 1FH5L 4AV0A 2OR9H 1M4KA 2CLZB 4S1SH 4HETA 5E8PB 5BV7C 3V0DA 1W72L 3D6GA 1NUDA 3CN4A 3RA7H 5GV0A 3QWRD 5I76B 3KWVA 3MJ9L 3TC9A 1QZ1A 1XGPA 2X1OA 4WV1C 4ZFZA 43C9A 4C47A 3BE1H 2O5YH 3WNIA 2P48B 4AYDC 4KVNH 1IEHA 4WI3A 4YK4C 5CR1A 1A65A 1OP3H 3GSWA 4YX2H 1QASA 4PRHD 3SOBH 1Z9SA 2YS4A 4KROD 3BUIA 3QT2A 4N22A 4AEFA 1WFIA 4MMXB 2IGTA 5ADPH 1AS7A 1EEYB 2I07A 2F8VA 5D7LE 2GBTA 3UERA 1JFHA 5E8EA 2CBOA 1RL1A 2OX5A 3MTXA 3SDYH 4OLUH 3WJJA 4FQXC 3FO0H 3AT0A 3O3AB 5FWRA 3VFTB 3TYFB 3D05A 3CDZA 1LD9B 3ENEA 3OMAB 2I69A 4FDWA 5MEPA 1EA9C 2APVA 2APTA 3QNXA 4KRAA 1OAJA 3M8OL 2V3FA 5GS3A 3QI9C 5K9KB 3B83A 5C9JA 3OAYH 1U8NA 4L1HA 1UQSA 2DEWX 1ZWIA 4ORGB 3FSZA 4O2FA 4JB9H 4UIKH 1MJ8L 4KAQH 3RBGA 4W81A 4X7CC 2OTUB 3OKNB 4IMKA 4R0LB 2J8UF 2VDQB 3UYRH 1QJ8A 5KAQF 3CQPA 1K8DA 2WGNB 4PGJA 4BH8A 4Z3GA 1UYWH 1QSEB 4UANA 3JWNC 1B0WA 1CT8A 4PHZA 4HV8A 3RU8H 3DX9B 1P5VA 2JCCF 2X7LA 5AG8A 2WINB 3OJDA 1PKOA 1NAML 1SDDA 2VLJA 4RCAA 4M6ML 2R2HB 5FUOL 3U79A 3X1EA 2FX9H 3PGDA 4I3GA 4RQQA 2AEIT 5D7IE 5I30H 2DICA 4YAQA 1W8OA 1A6WL 2FD6L 2NR6C 5J6SA 2J6EL 4BA8A 3ZYZA 2YJQA 1Q9KB 3UABA 1UZ6E 1OB1A 4GLRH 4LOUD 3D9AL 5AUMB 3ARED 3BD3A 2JNZA 3TN0B 4AY0A 4BQ9A 2B8OT 2ZUUA 2GUOB 2XFXB 3GNML 2I32A 2WNXA 3CSYA 4JPQA 1N5YH 1NM9A 1J1OL 3HLKA 3C5JA 2G75A 3HBZA 4FF9A 1Z9OA 1IGYA 3GI8H 1SYVB 2K9FB 5F7FA 5AALA 1MCCA 3PAZA 3X14A 1A6PA 3C60B 1HH6B 1J1XL 3L3IA 4RWYH 1CFVL 3H7BA 4CVUA 3ARFB 2Q1EA 3PWNA 4U6YB 4PW4A 1DJXA 2HZHA 2EDBA 1F02I 1ZXQA 4ZRGA 1Y6NR 2F6AA 5F1SA 5DD0H 5AOZA 4IIQA 4EXKA 2X05A 3T2PA 3F7KA 1QBMH 3T3PE 1ZGLM 1JPTH 2B16A 3FOMB 4CVXA 2LR4A 1ZY9A 3O8XD 1D5RA 3FN0H 4P49A 4HIQA 5HD8D 2BPBA 5GS2H 5IUSA 3I6GA 4ZDHB 5KJ4A 4R8WH 1WVZA 2MCAA 3V0EA 4EQ2A 1BCIA 5E03A 1TNNA 3DUSA 4NZRH 4EZKA 5E7FA 3V9FA 4DCQA 2K1MA 2Q8BL 5EORH 2PCPA 4OFIA 3RY6C 4FQ2H 3CMOL 1A9BB 1GJWA 5E8NA 1U8QB 4RWHA 2EEXA 3FPXA 4WWPA 1MOEA 2DTMH 2ED8A 3VXSD 3MHZA 3LY6A 4OGQC 5FGRA 4ZXBB 1BMZA 3JZYA 4OFYD 4XTRD 2O1AA 2CR3A 1TTBA 2YPLE 3MJ7A 1L6PA 3C6LC 3Q2VA 4QKXB 4M7ZB 4L9DA 1NFIA 1YEFL 4ZMNA 1UM4H 5GISL 4I2XE 3SE9L 4KO5A 5F21B 1GYUA 2VLLA 3B9DA 3CN3A 3H9HA 3QE5A 5AQ0A 5MP6L 1F18A 1E40A 2DLEA 3LPOA 1IBDA 3SKNA 3ZDZB 4PLJD 4PJXA 4JFFB 4ONOA 4A67A 1ILUA 2WC7A 5C0AD 2ZWYA 4F5CE 5DQJA 2PCYA 2VQ1B 5SX5K 1CTNA 4NKIL 4GCQA 4GJTB 5F93C 4Z7QF 3VM5A 1VDGA 2X4PA 1JGEB 2WXPA 3QR1A 5AD0B 2ARJB 3KYMA 1RERA 1BFVL 3GYRA 5I8EA 2OSLB 2ERJB 1A7PL 5F1IB 1ZD6A 2XV6B 4JRYE 1U91B 2X4TA 3IU4H 4NWUL 1S9YA 2V3EA 2XN9E 4XAWH 4XCEB 1FG2A 2WWOA 3V6OA 1HHKA 2EUWA 3V0VB 1FO0B 3IRPX 2VDRH 4G43A 5DZJA 1I8LC 1YEHH 3FT1A 4KOBA 4QJ3B 3T8XA 3VVWA 4DVRL 1OGAD 1WBZA 2A73A 5DLLA 5ECGA 3PWVA 3STZA 2WQ8A 2GJ6A 4NHCH 2ZJSH 4MBRA 4HP5A 2PYFB 3RPKA 2BNRE 4PJHE 4KMTH 3MLZH 3TT3H 3LK2A 1XGRB 2LHAA 1G7HA 1JNLH 1NWOA 2QZQA 3DRQA 2W94A 4UYPA 2Y2YA 4APQA 1ZSHA 4FXKB 3A2SX 3U25A 2L7EA 4MJID 2TRYA 2VOTA 1YEWA 3BFQG 5LBSL 1A4CA 4RX4D 1WPCA 4X80L 4TLKA 5CSZA 5IW1B 3V6ZA 4ES8A 2JB6A 5D1ZA 5TGBA 4AXWB 4KK5C 4XHJC 2B4CL 3CFDA 4AVIA 4JG9A 5D1QC 2WXLA 3KPMB 4KY1H 2OL3A 2LAGB 1FYTD 3MLVL 5I6OA 4MXVE 3IDJB 5JYMA 4E9RA 4PY8I 4XBPA 4LP4A 1Q9FA 1F13A 2BVQA 4NWTL 4PP1C 5H37A 5ICUA 4ADIA 3RX9A 3Q6FA 1LVEA 2X87A 3VFPA 4FXTA 1AE6H 4XCCH 5BO0D 1AS6A 2YAHA 3C5ZC 5CJXC 4UTCA 1XV8A 2DYPA 4LL1A 3RI5K 3QFJB 4PJCA 3EYQD 2D9CA 1PG7X 1CO1A 5E8DL 3I6SA 3V5KB 1XCWA 4POUB 3QC5X 5HHQA 2X70A 2VR6A 3QDJA 2GUYA 4YC2B 4WDIB 1Q9OA 1ZJAA 4WKXA 4FX5A 4GSDL 5HVWA 4L4VB 3EYUH 5CEZH 4MJHA 3QYMA 3N40P 1IBGL 3S8WA 4PJEB 5C0IB 1T6WA 1C08B 4XRCA 2B3IA 3MV7E 1PCSA 1NFKA 4BHUA 5CBAA 2ZCZA 4HC1L 4KZEH 4WSKA 1B4JH 2DQDL 3VFWA 2NSMA 2CJTA 2ICEB 3U2JA 3DX8A 4ZNEE 4LGSB 4AEHH 2X6AA 2CHWA 3BSGA 5EN3A 2C7UB 2D7PA 4F15C 5DYOB 2RFXA 1PJWA 4XMTA 4QO1A 1IRAY 1MWAL 3F3HA 4KQ0A 5F8RC 1FNGA 1Z0MA 2YD1A 1K6QL 4JGJA 3TNNB 4TNWF 2QKSA 5ALBH 2EZ0D 3TU6A 3AMKA 3O8XB 4IDJH 2W9EL 4PJBF 3VMPA 4OCRL 1MRDL 1QA9A 5TFSL 1JHKH 2GKIA 4LLMA 4C83B 4BELD 3OHMB 3IGAB 2P24B 3IJSA 4HJJH 3DI2B 2ESVA 1G1CA 4N25A 1FZMA 4KQ3L 4WUUE 5GS1C 4O4XA 1Z3GH 3QEQD 4L3CB 3LIUA 2HRPL 2NNRA 3IF1A 4WV1B 4A38A 2X3AA 4XMLL 3HHMA 4LKXA 3T2LA 4EPSA 3RDTC 4V11A 1T0MA 5EZPA 2A7BA 1T4WA 1YN6B 3VXSB 4Z7WE 3LRKA 1NGZA 3RHWK 1UC6A 3OKEA 4NIYE 4YZFE 1FV1A 4WO4C 5AOMA 3U4BH 1EJOH 1S7SA 4M6AA 4JCMA 1ZS8A 2VXQA 3GIZL 3P4NB 4RBPK 5IB4B 2MNWA 5LQBL 5CGBA 4NKDA 2V3DA 3V5HB 1MIEH 4FGMA 1EZSA 2MOVA 3QDAA 3TT1H 3L2NA 4QXGL 1IIIA 4EUPG 1NBZA 1QI5A 1TSRA 1SEBB 3W82A 3FB6A 4CKVX 3C5OA 3EOTL 4QOKD 4ALAL 1I3GH 3J7HA 4QLWA 3Q1EA 1L4IA 3ZT7A 1TVBA 2DPKA 3H6AA 3B6SB 5KYUA 2QTKA 3JWOH 4U1HA 3B1TA 1ZT4B 2DQ6A 3BEWA 3TA3D 5ID0A 4TN9A 4UWQB 4CMMA 1EDYA 4XNYL 2AJSL 2DKUA 4I1NB 1LEIA 2ID5A 2UZPA 5BS0D 4L5FH 1IFHH 2DIEA 3ZE0E 1B4LA 4K3DH 3APFA 4D9QD 3P11H 4NQED 4A04A 4FG2A 2WXNA 3OTTA 4NQUA 4RGOL 5J1AB 4LASL 2MNJB 4WU7A 4JE0A 1IVTA 2B59B 1E42A 2BZCA 5JQIB 4YLCA 3GQFA 3WIHH 2B0SL 4W9CC 3BQUA 4C57C 1ZV9A 4RJWA 4OJYA 4A2GA 4KR4A 2AQ3A 1L7TH 1WT5C 2HRHA 2VDML 1JZEA 2P49B 3O81A 4R90H 3FTGB 3QFDA 1MFMA 4D0CB 4MJIB 4FLRA 1AS8A 4GKSB 1OIOA 1KPVB 4UDTA 5IJBC 2R89A 4OY9A 1CLVA 1Z9NA 4Q8BA 2GSGB 3NTCH 4YDZA 4TXVB 5EU7E 5GRVK 4G76A 1RMFL 1YEIL 4HUXB 1SZNA 2AK4A 3VQLA 2NW2A 1JPST 3ES6B 1P9MA 1QBLL 5H2FO 5GRUH 5T1DH 1ZHKA 4P5TA 3WN5C 1U8IB 2D73A 3BIKB 4MQ7A 4OCWH 4PTTB 2JKWA 2JQZA 4G3YL 4L3AA 3GSNA 4PW3A 4X8JB 5FO8B 1T2XA 4B9JA 5DJ8A 1DL7L 5KBNC 3EDDA 2V5SA 3TM6A 4N2BA 2WP3T 1JGDA 3CZKA 3ISWA 3B2VL 5G38A 4YHMH 1NC4B 2HJLA 2UYLB 5B38B 2VNCA 3P0VL 3U2IA 1BAFH 2YGVA 3GMOA 1BG9A 5D2LE 5INDB 3HG5A 4KPHL 3AAZB 3NFPA 3QNYA 4LAQL 4ELME 3PNRB 4FXGC 5SWZD 2F74B 5FV1L 4PJ5E 1GS6X 4ZW7A 4R4BB 3PWLB 3NIDF 1OSPH 3KH4A 1LYQA 3LD8C 1AI1H 5JHAA 5IV2B 3PP4L 2O93L 2R0LH 4KQ4H 5EFIA 3ZIYA 3H8NA 2ICCA 5D8JH 3MACH 1I1FB 2HKHL 1QFWH 1JGIA 2CK0L 3VXRD 1AYOA 1TJXA 1E28B 4OV5A 4MX7B 4XE5B 2BCMA 3BGMB 3FQ2A 1Q9GA 4YSCA 3QIWC 3VFUA 5I28A 4WWOA 2WXMA 3P54A 4ZFOL 1UJ3C 2FEEI 4WWNA 1R3JA 2B7DT 3GINA 5D72L 1E6JH 4HKBB 4S1RL 1NCAL 3G6JB 3JTTA 3FONB 2R69A 4N8VB 3QDMD 2CR0A 3QXDB 3PUCA 2KHAA 4NPYA 1HSAA 5CEZE 2ZUYA 4L2YA 3BWUF 4NNPL 4YBQC 2COVD 5IFJA 3RGVC 2X9WA 4NHUB 4ANXA 1LEGB 5F7AA 3QUML 5GRXG 2H2SD 2YMTA 4UT6A 2C9AA 3FFCD 4ZMLA 3CC5B 3WMPA 1S7VA 4NZUH 3X3GH 1U8CB 2RJMA 4ZUWB 2N1TE 3PWUB 4WW1A 3I02A 3MODH 1AR2A 3D48R 3ZL1A 4RMBA 1R33A 5C92A 5IHUL 2F1CX 5FW6A 4PWEA 5HGAA 3Q8FA 5D6CB 3FW6A 4BE5A 4P5MA 1DUZB 3WDJA 3ZL4H 4K8RL 2RTTA 3BAEH 2E27H 2ADIB 3G9AB 3O9WD 1TDQA 5FYJL 5JLZA 4FFYA 3CZGA 1MCOL 3UJJH 4RZCB 1P4LA 2A9NH 1WA0X 2W0LA 4UB8O 2IMNA 3LVEA 4GAFB 4Q56A 2VDPH 1ZCRA 1EIBA 2IDSA 3SGDH 4UQIM 2N59A 4J8RA 5CILH 2XE2A 4KFZC 3LQZA 2B5IC 4QOKB 3BVTA 1RUKL 3TF7C 3HC3L 2XTJC 3VXOA 2EJ1A 3T3MB 1SM3L 2QKIC 4Z3JA 3VNYA 4KDVA 2E75C 4WWKD 4HGMA 1SJVA 5D1QB 5EU6E 1BVLA 3RVWD 2GK0B 1KT2B 3EIFA 3ARQA 1MRFH 5F3BB 5T3ZH 3WDHA 1RY7B 5D71L 5AVZB 4AVJA 3HR6A 4PJXF 5DLML 1XZ0A 4J6RH 5FM4A 5DMGC 5BS0B 3WO4B 3FTWA 2JELL 5DK3A 5L8KB 3SBPA 1XXDC 3C5ZB 3FQWB 5GS0H 3IBOA 1OPFA 4HGWB 1N10A 2X42A 4QIRA 1PD6A 3N1PC 5IR1A 1RPQA 1WD9A 3N5AA 4YSSA 1ZSDB 4DT2A 4KY2A 3LEXA 1U6AH 4NQCE 2R8SL 4AL8H 1A7QL 1TIUA 1HL9A 3OXSB 2R4PA 3JSSA 4HIHA 5DT1H 3S37H 2H3NB 3CAFA 2EC8A 4F7MA 1BMGA 3UTQA 3D2UA 3WIFB 4U7MA 2MQCA 2H9GA 3ARYA 3BN3B 1I9RH 1YNKH 4KUZH 4ILDA 3MLRH 1U8PB 1UD2A 1MCSA 5KVFL 3VMOA 2X4QA 3FULA 1NDMA 3V9CA 4HKXB 4F37K 2N4IA 2YAFA 2CBMA 2UZXA 4UM8B 2AXFB 5A2IH 3SZ6A 4DP9X 4M3KB 1QPKA 2D31A 1JXGA 1KBGL 5K9OB 4OAWA 1CK0H 3B2PA 3QJRB 4MMZC 2Z6FA 4LSSL 5CHNB 3UX9B 3WKQA 2YSSA 1Q0YH 2BSEA 3HZYB 1NOLA 5JW5A 1CJYA 1JHLH 1ECYA 2C26A 2R7EA 2Z65C 4YDLC 5FR3A 4JO4H 5A2BA 5KSBA 4NX0A 4AGNA 4PV9B 1L3WA 1WZ1H 2DZEA 1DVQA 2GJZA 2ZKXA 5J6GA 3IXAA 5AW3B 3MR9A 3QWQB 4QF1B 3ALWA 4HHGA 1AQKL 3LMJL 4M62L 1KG0B 2D9QB 4TKWA 2K7PA 2VR4A 1CGSH 2PO6B 4XO9A 4P9HL 5IYUA 4KKBD 3EOBA 3C6SB 4RAHA 3KG5A 2ZIDA 4MVBC 2EDHA 3V2AR 3L5IA 4LIQH 4QTIH 5DD5L 3PWJB 2ZCLH 4I0CC 4G8GB 1CR9H 2ZX6A 4Y9EA 4TVPL 3RY5A 4FZLA 2F68X 2KT6A 4G8EB 3HE7C 3ZX1A 1XAKA 4AC2A 2OL3H 4PJCF 1FBIH 2A6KA 4JPKH 3SDXF 2NNXA 3O0RL 4K9JA 2DDQH 2JFCA 4FI7A 4JDTL 5H37H 1HEHC 3QXVA 4MB5A 2HKFL 2J2ZB 4LF3B 5E1HB 1WIPA 4HWZA 3KHOA 2AJVH 4N2CA 5B1JC 3RKDD 4U1JB 2X2HA 2J43A 3FQNA 3QXWA 4TUUA 4H8QA 1XXFC 2XA8L 3KCPB 1HE8A 1U8OA 3HKFA 3U0PA 4N2IA 2K7QA 1RZJC 1T04A 2OYMA 1N67A 1ZANL 3AM8C 3F58L 5AZEH 3GMNB 3BDBA 3FYEB 4XXDB 3UTTA 4LLWA 1C5BH 4W9DC 1EEZB 3UTPD 4PV8A 2HPTA 2V2WA 4M6NL 3QDGE 2KPNA 3FFCB 4HFWB 5JHDD 2WNWA 4Q2ZA 1EHKB 3FKUS 5JIKA 4Y2NA 3PGFL 2WQWA 4KKLC 4Q74A 3V4PA 3APMA 4ZBJA 1SXBA 4O2EB 1UHVA 2PMZA 4RAUB 5C07A 2VLJE 3N91A 3IJEB 2GHZA 2L4OA 4C4BA 3BH4A 1XWVA 2HPOA 3CFBA 2EP6A 4JO2L 1DBBL 4F7CB 1L9RA 3MRGA 4YIQB 4JX0A 4HK0B 3RGHA 2YZ8A 3HCVA 3VXQB 1J86A 3X1BA 1BHGA 2CKBL 3DHMA 1E4WL 3CE1A 2EXYD 3DTXB 5I1EL 3FT2B 3NG5A 1WS8A 5DSCB 2FX7H 4P23C 4JVWA 3IAQA 3KS0J 4S1DC 2IBBA 1ZE3H 1FYHB 1XR9A 3VXUB 1F6AA 4W9GC 2FH6A 5HYSA 4Y2LA 3FSVA 3EXJA 4OKVB 2XCMC 3CFEB 1JDDA 4OB5L 2R83A 1CU4H 4J28A 3TIDA 4Y4HD 2LU3A 1RIVH 2BVPA 2Q87A 3V79C 2B1AL 2NLJB 2X1PA 2CUMA 4XN7A 2XZZA 5I23A 5ANMB 4JY5H 4ABVA 4YSAA 1BXAA 5JPNB 3NSJA 2X10A 4C59B 1I7UB 1OK8A 4N0CC 3WS6C 5D1XE 4NS0A 4AJWA 1G7JA 5TDPB 2DQEL 4AZLA 2VXQH 3FC8A 1BZOA 3EO9H 1HEZB 5JO5B 2QGDA 4LGPB 4IMLA 4OIIL 5GTIO 1CDGA 4A39A 5TDNB 2WO4A 1ZIAA 2HWZH 3VI3B 4EDWL 2CA4A 1JPGB 2WLIB 4NZJA 3V5DB 4EDXB 1KXVC 4JY6B 2CO1A 4RISH 4GQZA 3GJEA 3EH1A 4J1UA 1A6VH 1IC4L 2YK1L 2ZQKA 3RVVC 4E9TA 5LNDA 3WTWA 4HS6B 3LD8B 4HHAB 3SCMC 4BUHA 5T3ZE 3LRGA 2P9RA 3VQMA 1OQOA 2RALA 3ZSSA 1JK9A 1E30A 3MFFB 2PCFB 3QUXD 1WAAA 4PJFA 4LARH 4GIOA 5HI5D 1YUHA 3FO2A 4M00A 5DVPA 4G42B 3DPDA 4F9LA 5A2FA 1TVHB 1EUTA 4JNXA 4QGYA 1E2WA 2A4EA 2LGNA 3GSRB 1LM8V 5F3HB 1HXYB 3QIWB 4YO0B 1RVFL 3P9LA 1UB5B 1UJ3B 1WLHA 3COOA 5C0CB 2PR4H 4WY7L 1KYDA 1C8QA 4OZHB 1I9JL 5C0FA 3AA7B 1I31A 2NY5C 3DMMD 4KVPA 4LSPL 2Y3AA 5IQMA 1G6VK 5HI4D 4GP5B 3B2MA 1DQQB 1ZA6B 4MHHI 3QCUH 2XBDA 5IEHA 4I77H 4R26L 1DQJB 3MYZA 4PJ9D 5DJDA 5E99L 3DK0A 3WLBA 2DI9A 1XO8A 3RGVB 4PGEA 4JFEA 2YD3A 3MRHB 4JO5A 1GGBL 4MNGA 3ASWA 4OD3L 3LH2H 5CJQL 4HS8H 3ZW3A 4YL9A 2PPEA 4PWKA 1OAKL 3MRBB 1DVFD 1QI4A 4G9FB 1RIUH 5BOZG 1CICC 3SE8H 1DQLH 3V6OE 1K8IB 2AJZB 2JKTM 4PRIE 5DMIL 1NC2D 1HZLA 1X5AA 4LSTL 1VKXB 4N0UA 4FLSA 3V4VB 3HZVB 2ZKMX 3Q1SH 3ZKND 2LE9A 4C4VA 1Q9WA 2X2IA 1CDBA 4OFPA 1UZ8A 2CQVA 4PJ7A 3AVEA 4FLHA 4EMZA 1L9QA 5DEFA 5LUMA 1WZMA 3FT9A 3I6KA 4X4YB 5GZOA 4PB9L 5KVGH 2V5TA 3H9YA 4JM2F 2L8AA 3GT6A 3T1WA 4LRNH 2ADGA 1KTDB 2WLYA 3B9KC 4JHAH 3VSVA 4MXQD 4HJIA 3S37X 3R18A 1R6VA 4HWEL 2F8IA 1YNTB 1XGTA 1FLTX 5I15H 1GY1A 1NEZG 2WKOF 5I8KL 1V05A 4LCCC 4P3CL 3LZFH 5HHME 1J9CT 3VU1A 1BAWA 2DWEA 1RPKA 4V1DE 1QSFE 2B5IB 4ECNA 4NUQA 1C1EH 3KLKA 3VD9A 2FR4B 2XTJB 2UVEA 2VZSA 5DHXB 2EYTB 2QKIB 2NY6D 2P46B 3HVDA 1JYXA 2ZYHA 3FT4B 3OAYK 3MRIB 4L4JA 2NTSP 4J4PD 5MERB 2FIKA 1F5WA 1SY6L 2EVIA 4H8HA 2XVKA 5DJ6B 3T0DA 5EOTA 2ZAIA 5FYJE 3CBRA 1BX2B 4PWGA 3WJMB 2OMVB 4MCYB 3OR7B 3CDCA 4I7ZC 5C2BH 32C2A 4K71C 3CFNA 3HMWH 1QYGL 3BZ5A 4KI1A 1K2DB 2W0FB 3VYPA 1N6QH 4N2HA 1EXHA 4ONGH 4MJ6A 3ZTJH 1U95A 5IJVA 4HT1H 1OTTD 4E41D 1CN4A 1R19A 4PRPA 4UU9A 2R69H 5DGRA 1TUPA 3APDA 4S1QL 1AO7B 5L2KD 1SVBA 1UM6H 4Z7UE 4A7GA 3NIFB 5AOIA 3CFIC 4AKMA 2IWWA 3GMQB 3CVDA 3C5SB 5F9JB 1S78D 2Q5BA 1MHPH 4AX3A 2C1PA 4EVNB 1JYWA 1H9DA 1UKQA 1MNUH 4JRXE 3L4UA 1X5HA 5LXVA 1S8DB 2E9JA 4DKEL 4GAYB 3FMGH 3WTYA 3MJ9A 4UT6H 5I1IH 5CIPB 3WFZA 2A9ML 3PHQB 4HCFA 4A37A 4HKZA 2PF6A 2VO5A 3H42H 2OMTA 4FD0A 4MMZB 2FSEA 1YEEH 1L9MA 3O4LD 3MRJB 3BLPX 3FUKA 5IOKA 5EDXA 1XTLA 2YGPA 4OF5A 1T5WA 4P59L 2ATKA 3VD3A 1ZA3A 1MFEH 4YDLB 3IVKA 3EJTA 2IEPA 1PZDA 2BHZA 3FCUB 4Z8FL 2XYCA 4UM9D 3NUKA 4Z3EA 3O45B 4YHPA 3NP4A 1QFWM 2IQ9H 1H3PL 2IQAB 3PJSB 3V6BR 2ZX5A 4ZZFA 4G82A 4FFYH 1J8HE 1Q72L 1L9PA 2APBA 3UADA 3CBKB 3BSZL 5ISZD 5IB3A 4XVTL 3MROB 1OPGL 1T0PB 4Y2DC 4DP7X 4FRXA 1KCBA 2ESVE 1N8OE 1I4FB 1MCRA 4NFBA 4XZUB 1QUNB 2BCKA 5D4QA 4I0PC 4UQCA 5BCAA 2OXGB 4EOWL 4FOMA 4F8LA 4FQJH 2A77H 3QUZA 2AZUA 2R2EB 3W0WA 2QJDA 4F8QA 2BRRL 3II1A 4JFTA 2C9SA 4JR9L 2JV6A 4LHUB 2ZTBA 4JG0H 3HE7B 5CMAB 3QUXB 4FE9A 4ABQA 4ZODA 3J07A 1PX8A 3FO9A 2BLFA 5B39G 5J7CC 1F2XK 5H94B 1RJLA 4JFYA 3E8UH 4HIXH 5JR1H 3QZOA 3HB3C 4GAJL 3RG1C 1W91A 4MJ5A 2WCPA 2B15A 2DQGL 3T0WA 5K33A 4A1RA 1MCNA 3A67H 1H6S1 2HFFB 4HISA 1N64L 1CL7L 1XB3A 4I18B 2CGYA 3GSUA 1D5BA 4AZUA 4EI5C 2GEQA 4ZTOL 2CO6B 3QQ3A 2HVKB 4PGCA 1MDAA 3ULVF 1KCVL 1DHKA 4BSWB 2J6EA 1CE6B 1AOHA 2EO7A 2G60H 2WXJA 3B3IB 1BJ8A 2Q76B 3FCBA 3NCJH 1QG3A 4XP5L 4G2AA 1KTLA 5I24A 2B1HH 1X6LA 3NQKA 3CFCH 4Q6KA 3IJHA 4LPTA 4L37A 5H2BA 3EW3B 2QR0A 1Z2KA 1ONQB 3F5WB 5DA4A 2NW3B 1FC2D 3PREA 4Y4FC 5LWYL 3EFDH 3KXFD 1MVUB 2LFGA 1FDLH 1CI5A 5ID1B 5KSBF 3I9GH 4KJYB 4L1SA 1DVFB 3GSVB 2AKRB 1WSST 3F00A 4MZRA 3RWIB 1F1AA 3EG9A 3I9PA 3TBVA 3GTTA 4AMKH 1JPFA 2C9RA 3T0EC 1NC2B 5DHEA 3WY1A 4U3XA 4Y19D 1JD9A 3WD5L 4YWGH 1UT1A 1FFOB 2WBKA 3DUHA 2WN3A 3FU7A 3ZE1E 4H8WL 4Z3HA 4YFLI 5D7IF 5BZDA 2YAPA 3FH5A 1A7OH 3T71A 5C0GA 4R83A 1GKEA 3HOLA 1F3JA 2QZ5A 1QABA 3OMIB 1VENA 5I6KA 5EIQA 3M46A 1OTSD 3FQTB 3IMSA 4YR6A 5KVEH 1KIUA 2DBLL 1MFCH 1MI5B 2OJZH 4GKZA 1FUNA 2WHVA 3ECQA 3NFNB 4GPVA 4P23B 3U30C 1XMEB 5ACZB 3GXIA 2YQ2A 4TSCH 4OT1H 3BW9B 5EBWB 5HDLA 3U46B 3W11D 4AQ8C 5I6MA 1B4RA 5DZPA 2WJ5A 5FX3A 3HE6D 3WAKA 5DC4B 1N5AA 4KXZH 2J3SA 5KN5A 1WA2X 4NBZB 1UWGL 4PJDE 2GIMA 1AY1L 2HT3C 4LP8A 5IW6B 2NY3C 5FAAA 2E6JA 3OHXC 3UG3A 3ULAB 2R39A 4QRPA 3LEVL 4BFJA 1FORH 4JO8A 3UBGA 4NQDA 3ORJA 4JRLA 2VUKA 4PD4K 1IC7H 3QXUA 3FN3A 4FKKA 2XQBL 3C09B 1IM9B 2VWEC 1KCUL 4MDIA 1QLFB 4G7SB 5CJOH 3LN4B 5G4NA 4OJFL 2C4XA 2H47C 3NSXA 2F19H 1AG0A 4X7EC 1FN4A 4JFVA 1MEXH 3ZN6A 2WKLA 1UXMA 1ZEAL 3EO0A 4GNKB 1OF2B 1G9NC 3U0WL 3K2KA 3DETD 2VMEA 4LSUH 3KDMB 4U1KB 2AK1H 1KJ2H 4GT7A 3VFOA 2FNBA 3R0MA 2JIXA 4KK9D 2VITA 4Z0BL 4HXBH 4P2OA 4KK6D 5ESVA 5ENWB 4N28A 1JPSH 1BM7A 4ZD3H 3TH3T 1ZHNB 5SWSA 3VFSB 5BV7B 4ZPVB 3IFPA 4B5EA 2V2XB 3ESPA 4MAZA 2YD6A 1M6UA 1P6FA 4XWOD 3RUGB 4UTBA 3O4LB 5TE6H 2VR3A 3G5ZA 3V4PH 1MCIA 1WBYA 2ZPKH 1ADQL 3UJTL 4HH9B 4K7PH 4IRJC 1QSVA 3ZRFC 1NCBL 3DVNB 5E6ZA 4H40A 5AFUK 2HX8A 2FJFA 3K2IA 4GMSH 4XWGL 4X99A 1AG6A 1RJYA 4UM9B 4AYEC 1NAKH 3QHFL 4N3TA 2WK2A 5H4ZA 1KN4H 4TVUA 3M07A 1FFNB 2CPUA 1XCTB 1JP5A 4J3OG 3WSQL 4M4PA 5KG9A 4QY8A 1TZAA 5A3IC 3MREB 2QFRA 4E1SA 4DO6A 5LBSA 2RA1A 5JQ6H 1IJ9A 2Z0UA 1GKOA 2CIIA 4OVVA 4PG9B 1HH9B 4WRLA 1EFXA 4GRWF 1CICB 2V33A 1NEUA 3F7LA 3CXDL 4MA8H 2PP9A 1WG3A 4DZBB 1TTGA 2DD8L 2XOTA 2AXGA 1TJHL 4H1LG 1OV8A 4LLQA 1HL5A 2D03L 4N5EC 4AIZA 2X3CA 2BVOB 4K5MA 2CA3A 2F54D 3B7SA 1RULL 3K6SB 3IEAA 4UV7H 5KAFO 2ZCKL 5KANI 3BPNC 3CVIL 4KRPC 1BZQK 5DL7A 1FVEB 3HJEA 3TBYB 5DD3H 2YC1B 5EO9A 4PI0A 4XN4A 5DRWA 4FXLA 2P8PA 4NO0D 2CBPA 5IQNA 2W60B 2XRAH 3B9KB 3NABL 4OM1H 2NY0C 4S0SD 2PTTB 5C08D 3HJ0A 1WAAF 1DVUA 4IHOB 3TZVC 1MREL 5AVXB 4OLYL 3RAJL 3VM7A 3UAJC 1KB9J 1KB9K 1IQDA 4NZDA 2HTKC 1J05A 1KLFB 1A2YA 2PTVA 2GC7C 3P9WB 4G8FB 2FEEL 1XFPA 3B34A 2J88L 4X6DB 3FRPG 3II3A 2MWCA 3WHXB 3EGDA 3OPUA 3KXFB 2VLRB 4OZ4A 4PRHA 1TZIA 2JCWA 2X2JA 4HC1A 1K85A 5CWSB 5J89A 4Y1AD 3D0LA 3VRLE 4HUKB 1RSFA 4L4TA 3TPUB 5GGSA 2ITCB 1IEAB 3EJZD 4A7QA 4M1GL 3KYAA 3CU7A 1BEYL 4Z7VA 4Y19B 4K71B 1E3FA 3MA9L 1JZHA 2PW1A 1CLOH 1RFDL 1T83C 4HUNB 5BRQA 4E9WA 1U92A 2F7QA 4HF5L 4LCUA 3FU5A 2FWOB 3APNA 1JWMB 2FJHB 3H9SE 4H88H 4WQOA 1KELL 1IC0A 3ECVA 1MM4A 2QMJA 3T77B 1T4KB 1LP9E 5AVWB 1HZHH 3O2VH 4YSTA 4BEIA 2CJUH 5FB8A 1S7WA 3IMBA 5EU4A 3VH8B 3DBXA 4TULH 5AAWC 3PFUA 4MSWB 4NRYA 1F11A 2IDUA 3GRWL 3ZY7A 1PLAA 3N55A 5FGBC 3CVCA 3OGCA 4GXUN 5D5MB 9CGTA 4Q0XH 1BFTA 4MRBA 4R4FL 4M7LL 1LJMA 3LS5L 3GSQA 1KPUB 5LBVA 2DL9A 4NOBA 3HE6B 2DQFA 3MRDA 1KN2H 1ETJA 2CKNA 2PTUA 1AGDA 3PQYD 4ZSOB 2HUEA 2R1WB 1IBFA 1ETB1 2IG2L 2Q9OA 5IHLB 4P2QA 1YNLL 2A0LC 5F96H 4X6EA 1MHEA 3N43B 4HWNA 2HTLD 3KPTA 2WW8A 2A3TA 4M7KH 3UC0H 4NQSB 3AAEB 1OGPA 2N0KA 2WP3O 4U1LA 5DUBA 2Y22A 3AY4C 3IJYA 3Q7JA 5EC2B 4JG1L 3ROOB 3MUZ1 5FDWA 3CHPA 4XMPH 2YRLA 1O0VA 4KTDL 4MAYC 2AP2A 2DLGA 2XJKA 4R5VA 5G4OA 4NNYA 2YQGA 5I1LA 3AREA 4EUPB 4KZDH 2K6ZA 5ADXK 5DUPH 1DP0A 3BEVA 4PVBA 2OQJB 3LPPA 4HCRA 1CXKA 1Y6MR 1VFBA 4XAKD 5D2NE 3LNDA 4ONFH 3WXWL 4MNQD 4NUGL 4ZMYA 4KX9A 1GZPB 1ZGLB 1SXAA 3TV3H 2CBQA 2APSA 3MBED 4X6CB 3P0GB 1TPXC 3LK3A 1AD9A 1NCGA 2EIBA 4I0PB 3SO3C 1JJUA 3ARGC 5DWPA 4JZOB 1EMTH 5DJ0B 4XOCA 3ZDYB 2WQRA 3AG3B 2FQFA 5J12C 4AJVA 4XPAH 3ZDWA 3ULUF 5HDBB 1VGKB 5D5DA 1BQLL 1EZLA 2FL5B 2VE6B 3VFRB 1X5IA 1AXTL 2J56A 4KX8A 5KBMA 4GUCA 2CDGA 3HB3B 2Q86B 3QW9A 1MH5B 5GHWL 4YS4A 2XWBB 4WUKL 2K9UA 1W0YT 5GZNA 4GW5A 4A7GF 1X7QB 2FWLB 2YMOA 5E4AA 1ZVYA 5D7JD 5DO8A 4EI5B 1MLBB 2EH8L 4OLXH 1LWHA 3KPOB 3QR2A 4LAJH 3V9EA 4TMPA 3AA0B 4WTQA 4XP9L 2AC0A 4B61A 1UKSA 4GAGL 8CGTA 5DD6B 3L3OC 4CAGA 2DKSA 4GXVH 5BVJB 5CCKH 3VCLA 2MHAB 4X5XA 1NMCC 1U93B 4ORZC 3DX4A 3QIUC 2ZKYA 5I1DA 1A22B 5DL5A 4Y4FB 1MFAL 1A14H 3PFQA 4YZWA 5J1SC 2VDQL 1X5JA 4MDJB 1FH5H 3QJHB 4JFPB 5KYXB 4OFYA 4HIIB 3TXAA 5EOQH 2Q2EB 1JFQH 2BFGA 2A4ZA 1I7ZA 4D8OA 3MJ9H 1JN6B 5MEOA 4ICXA 3BPCB 2KI6A 3FF8A 4W4OA 1HNGA 1I3RA 2VLKE 1PZCA 3QIBD 4F3FB 1DJZA 1O7DE 2HLFD 4QHLA 3U1SL 4NC0B 3MPCA 3L4TA 5ESQB 1EXUA 1F4XL 1X5ZA 4GFTB 3BT2L 1H3GA 4OZGF 3HC4L 1OP9A 2PYEA 4JKWA 1CGWA 2W88A 1OP5H 3TO4C 4LDCA 2NY4D 2ERVA 2XSKA 2Z35B 3NA9H 2WUCL 4UBDD 3S48A 1BWWA 3U30B 2X4RA 4TNVK 5AVRB 1WV7T 2FX8H 4ZUUA 4E2OA 4DGYL 1U3HC 2FNWA 2AJYH 4G6JL 5HGHB 3OKMA 5LG6A 2YARA 3LHPH 3I84A 1GW6A 2YBRB 3AXIA 2WCGA 5DR5L 1DLFL 3QEHA 3EJJX 4BCYA 4PJ8D 1IEBA 2HVJB 4LNRB 3SPVB 5AZ2H 2EE9A 1IAOA 3SKOA 2H6PB 4KFMA 4Y1AB 5BVPH 3QPQC 1IL1A 4Y9FA 3IPFA 5AENA 1T7YA 2C9UA 1NFAA 3L9RA 4DFHA 3CLFH 3H0TA 4K7PX 4ZFOA 3AA1A 4CJ1A 5TE4L 2QADD 4H8PA 4H25B 3BWAA 2VN6A 2JVUA 1RU9H 3ARTA 4M6MH 5FUOH 5KYWA 4CGTA 1NGPH 5FLUA 3DO7A 1RJCA 2D4FA 4RX4A 5CJBA 1KTRL 2DI7A 1JV2A 1RLWA 1YEGH 2FD6H 4KXCA 5EBLA 4AKPA 2J6EH 3ZE2B 3SKMA 3AGVA 3D5OF 5HYJD 4DP6X 3QQDA 4ZUTA 2XC8A 2Y06L 3D9AH 1HXXA 1J0YA 3ULSB 3GNMH 4QTFA 3IWVA 3PGUA 3ARDD 4G5ZH 5EEVA 4L8CB 1J1OH 1RUAL 2DMHA 2F5BH 4EN3A 1LE9A 1VACA 4WJG3 3RWHB 1E4HA 5I1KL 5CM1A 2IIJA 3DIDA 3I9AA 1J1XH 2XTRA 2ED7A 5KBPA 5EUOA 5I0ZA 1A6TB 4IIZA 5JMOC 3RPBA 1FL5A 3HW7A 2NRDA 2ATPA 2ZXWB 1M3JA 2XX0A 5DMKA 3LQAL 3GXDA 1HIML 1IV8A 3KLHD 2XQYA 1IGFL 1WYJA 5IVXB 4YQXL 3QORC 3AQXA 2KPWA 3BMWA 5DHVA 1TG8A 3VTMA 5CUSL 4B9IA 1HXUA 3T6ZA 1W16A 4OLVL 1DCLA 5JXEC 3DO7B 5J4MA 4YSPA 2FEDD 5EN2A 1II4E 3NZSA 3IS0X 3EMNX 3MBEB 2R9HC 1Y1UA 2AJXL 1FO0L 3PNWA 2DQTL 3RVXC 1M6OA 4MFHA 3L95A 3GJFK 1MVFA 1MWOA 1E65A 4ATTA 2YXVA 3QARA 4F20A 3K0WA 3MBWA 4LSHA 3T4AC 1YEFH 1LDPL 1U8HB 1KCSL 4ZFGL 4X7SL 2MKLC 3HRZB 4DGIL 4LHJB 5BRPA 3P77A 3S5YA 3CDYA 3OV6A 3SYOA 5MP6H 3B5TA 4FFTA 3PL6B 4RA3A 3MJ8B 4JDVA 3EYFB 4FNQA 4K9EL 3TZVB 4F7TB 4HIJA 1ZV5A 2XXCB 4NKIH 1KWKA 1ES0A 3JTSB 4I9XA 4MZ3A 4Z7NB 3TBSB 5EU7C 1V7NH 4XNQB 1BFVH 1PYWA 3VFGL 3GF8A 2OZ4L 4BQCA 4G6KL 1YEJL 4R3SA 2Z4QA 4GINA 1A8ZA 4WO0A 4GUOA 4DUWA 3GXUB 4G1MA 3SDCD 3BVNA 5IB2B 1UXWB 4JW3A 1NBQA 5EZOL 4DEUA 2WSDA 1KXTB 1IGTB 2BOCA 5GGRY 4RMUA 2JE8A 2P47B 3WHE1 3T3PB 1F3RB 5CU5A 2VIRB 1RUQL 2EDYA 4DVRH 4K5PA 4CADA 4E9SA 5LVEA 3UH8A 1RZKL 4UTBH 3UTSA 4MA1C 1TU2A 4FEIA 5IMKB 3DWTA 5MHSE 1Z66A 3GKWH 2YHGA 3QRBA 3MV9E 4OCMC 3KWUA 1R3KB 5I16B 1IE5A 4Q6IA 4RNRA 3R8QA 1G7QB 4PJ0O 2NY4B 1RUPL 3JWDL 3RIKA 4IBLT 1JZDC 2W0KA 3TA3A 3LNIA 3GMMB 4CGUB 4KMQA 3FQ4A 5IJKA 3G5VA 1UTDA 5AW2B 2BNQD 1NPNA 5LBSH 4AW7A 1R3LA 3NEEA 5ICZB 2QPUA 1BZ7B 1JHTA 2VR9A 1H6EA 5ITFB 4CVZA 1EX0A 4QRRE 3SYPA 1XH0A 1NCCH 4WFFD 4JDEB 1SNRA 2UXVA 4NQEA 4ZX5A 4ODWA 1FA4A 1DO5A 4POZC 4PJ8B 2A9CA 2XBZA 2BSRB 4I2XB 5GS2D 3OR6A 1CDUA 2YNKA 3HNTH 5F9DC 2DW5A 4KNUA 3MO1B 3PGSA 2D4DA 4FMSA 5TE7L 1TKWB 4LLVB 4NWTH 2QL1A 4AQAB 4B97A 3IFOB 2AW2A 4ZMWA 3BAYA 3CZEA 1G4MA 5JUEL 2H0EA 4JY4A 3RX5A 5IMOB 4R7DA 4LCYA 4PVLA 1NMAL 4NERA 4AV4A 2DF3A 2BVEA 5ETUA 2CO4A 1RZFL 3BGFC 4XNMA 3MMEA 2OSYA 3RL2B 1TYRA 1CXHA 5E8DH 1IAIL 4NUJB 4CW1B 1TPXB 4YHZL 2ZG1A 1UENA 4I88A 2VC2B 2LQRA 3SO3B 4N1HB 4UF7C 2L7UA 2XTSA 5DJYA 1XT5A 4JRYB 4ZX3A 5J12B 4GSDH 1KF9B 2YEQA 4PG2A 4N2GA 2J12B 3AA6B 2XN9B 3MA7B 2AABL 2I7OA 2ICES 1IT9L 1IBGH 5EIIG 4C56D 3AC0A 5T1KD 2CRYA 3IAPA 3ARDB 5IVZA 3T6VA 4AENB 4HC1H 2DEYX 1WITA 5IVNA 2HJKB 2YD9A 2DQIL 3V7AE 5BXFA 1HU8A 3O3EB 2HJFB 3UEZA 5E94B 1D2PA 3R0NA 2BNRB 4PJHB 5E9DD 4GRLC 3O11A 4O2CB 4XVSH 4P5KB 1HI6B 4JFDD 2PPFA 5HI3D 2EUXA 4PBDA 4JCLA 5AVTB 2E8YA 2CALA 5GIRB 1PL3A 5JOPE 3L3OB 3GHEH 2APFA 1PZ2A 2CKBA 1K6QH 4UINL 3MNZA 4H7VA 1QLEH 3PV6A 1CXEA 5CLXA 5BW7C 1NMCB 4UQEA 4OGYL 3BO8B 3WUWG 3SODB 1D6EB 1P4BL 2BNUB 3BVXA 1HHIA 4KTEH 2MSPA 1U3NA 5TFSH 2IV8A 4OD1L 4N2EA 1FNSH 5I74C 5BMFL 3HG1D 4PJAA 5KYYA 1YECH 2PWDA 2WBJC 5FKPB 2FHCA 3VXRA 4YH6A 4JHWL 2VDKH 2BVTA 4KQ3H 3CCHB 12E8H 4YBHA 4ETQB 2ODJA 1INQA 3U7AA 4NC1C 2LVCA 2HRPH 5CD3A 4PR5A 1QO3B 4Y5XC 4XMLH 2ADFH 2EDTA 1KYOJ 1KYOK 4IEFA 2XE3A 1LLAA 4MGXA 5ANHA 2YA2A 4BUMX 3QDMA 3MNVA 5DVMA 5F9WB 4NRXB 4CN6A 1QJ9A 1EAJA 3OAZH 3FO1B 2Q3ZA 1VFAB 3OQ3B 2MTAA 5JIIA 1H5BC 1LEKB 2YEVB 5MEND 2DS4A 4YFDB 3GIZH 2HMID 3H6JA 1N8ZB 4CC0A 1XB6A 3TO4B 4HZLB 5LQBH 4HQQH 4IU2A 1CCZA 3JWOC 1D5XB 3D4GA 1CLZL 3PPEA 4HCRH 1TETH 3UJIH 1QSEE 5K93A 3UIYA 3EBIA 4QXGH 3P0YL 5L88L 3FQRA 1I9IL 2BIPA 5B3NA 4P2AA 1AC0A 4G71B 4ALAH 5L9DL 5IG7B 3MV7B 2VZTA 2NUTB 4G6AD 8FABB 1BJMA 1WFOA 3FTSA 2MCMA 3S96B 7PCYA 4FQHA 3NDZE 1ILSA 3KEDA 4NQVB 3CN0A 5DQ9B 4ISVB 3K4DA 2NNAA 1U8LB 1IAKB 4XNYH 5BJTA 1BQUA 1DANT 2ITDB 4PY7B 3VE0B 4HFUL 4F58L 2Q0ZX 6PCYA 2WVVA 2JJSA 1H0DA 4M3JA 3KYNA 3ZDXB 4ZYKA 4L8SA 2JCCB 5CZVL 2V8MA 1NCOA 4RGOH 4G7VH 4X5LA 1I7RB 4J3OC 5B4MD 4DO4A 3SDDC 5EUKA 3M17B 3MJ6A 5MEQB 2BINA 2ENSA 4Y5YA 5G5DB 3BP6B 4N90D 2V9TA 1GMIA 1PW3A 2BRQA 4DEPB 3BD4A 4NAJA 3PAVA 3DV4A 3KLSA 2W92A 1GHFH 1CFSA 1GS8A 15C8H 2HT4C 5HHOD 3BN9D 1I8MA 5E2WH 4O49A 1YEIH 4Z7WB 2IDTA 1QRNA 1HS6A 4ENZA 3GDCA 2FO1A 3ZU8A 5FKAB 3D39B 3PWPA 2X4SB 1Z5LA 5FYJU 1T20A 1JGLH 2DWXA 1A1NB 3BP4A 5L7XL 3WJJC 1JK8B 2J1NA 2PXYD 1I1AD 4G3YH 4A66A 3P9MA 3PHOA 3NJGA 4OJAA 4OZFA 3KPRD 1HHJB 1XX9C 1DL7H 2VXTH 4ANVA 5K9JL 3D09A 3QORB 3RZCD 4RGND 1JNHB 5FA3A 4LEOB 1O6SA 1JRHI 1Q9LA 4ZFFB 4EI6B 4JAMB 4KK8C 2ZKHL 4IMKC 3P0VH 4G7QB 1YYML 2Y7QB 1U8MB 4LAQH 3HW9A 1AQDB 1JCKA 2QT6A 5DJXB 2XTLA 2O5ZH 4LLYB 2NUPA 4BH7A 5FYKL 1SY6A 3Q3GB 2VSDA 3NCYP 2AVFA 3PP4H 1CDYA 4KDTA 3ZDZE 3ZE0B 2YGOA 4KJPD 4JFFE 1OGTA 2ZNXA 1QEWA 2HKHH 5DVLA 1AKJD 3KBEA 2CK0H 3RPIA 1K4DA 1URIA 5GSRA 1KB3A 2FLBT 2XT1B 3BH8B 3NJVA 1EFQA 3S35H 4GCSA 4HLZH 3T4AB 4BQ8A 4C4UA 2K6WA 3UTZB 1JUFA 4RFEB 3C2SA 4UAHA 4LSVH 5E9DB 2ZUTA 5PRNA 3EOAB 1XR8B 4S1RH 3UZQA 3QULB 2DWYA 4JFDB 5L6YL 4NNXA 4PREA 2Z91B 1M7IA 1LK3H 1FNLA 1RKRA 3MCG1 4GF4A 3LB6D 1PG7W 4U3SB 4YSOA 4RRPA 1G7LB 2RAMA 4J3TA 2VDRB 4Z7QB 1AXSB 5JTWA 4WEBL 1IGML 3G6DL 3PGCA 4OGXH 3QRLA 4L8BA 5EUOF 4Z78B 4M93C 3VXPB 1DVTA 2AJ3A 2HFEB 5GJSL 3NT0A 2OJEB 3DUUA 4XNBA 3UO1H 2E0PA 1S7XB 3LKPA 3T65B 4F7EB 3HUJA 1TTAA 3CZFA 1BVKB 4HS3A 4Z7VE 5IHUH 2ADJA 2XZCL 3HG4A 4RSYA 5TH2B 4WVRA 3DIFB 2AXJA 3U1QA 1XGUB 4UQBA 3SJVA 5I1AA 4MA1B 1N0LB 5PCYA 3G5YB 5H35A 1DN0A 5FO7B 1I53A 1VA9A 2EEFA 1QBAA 1V3JA 1DN2A 2ZONA 4LCWA 4OD2B 4PSRA 1I7TB 5D9SB 4FA6A 1Z9MA 2XKNB 4D0DB 1R0AH 2QVTA 2P42B 5MENB 1GY2A 2D3VA 3PP3H 3BUTA 4W6YB 3ML8A 2FGQX 1PEWA 3RWGA 1SLUA 2W9DL 1UD5A 2ZYSA 5DHVH 3GKZA 5JOFA 2J20A 4NKOB 5J3HD 4KHTL 5JHDA 1JBJA 2FYYB 2VM4A 4PJGB 1RUKH 4G9DA 3POUA 3BWSA 3TFKC 5B39B 1KWGA 1J48A 1HX0A 4M7LT 1ITBB 4FNPA 2O72A 5GS0C 1FZKB 4S2SA 5JW3L 1G84A 2Y7LA 4Z0XA 5GGTH 1WTLA 3C8KB 1MXDA 1QD0A 1XIWC 3C6EA 3K2MC 3VRJB 4AL8C 3NGBC 3GBDA 4HBQA 4RMVA 4KRNA 4NC2B 5IIEB 4TPRL 3NK4A 4PHXA 1MFBH 3CJJA 1KBVA 3D52A 1FL6B 4NJ9L 3JVGA 2ZP8A 1BXWA 3R19A 1N3NA 1I8KB 1RXLA 3DHJA 3BGFB 4HEPA 2UWEA 3HAEG 2BC4A 2DN7A 5CJ5A 1J9SA 3HFMH 2M06A 2CPCA 3KNBA 4Z77A 1OAXH 1ANUA 3Q5OA 4KNQA 3LEYH 5B21A 4NOFA 3U6RA 3AW5A 2O61A 4U3HA 3S36L 1JXDA 4M61A 4Y4HA 2YAEA 3ILEA 2E4FA 5DURB 1PY4A 3CMGA 3V6OC 2EIZB 2IWEA 4BUQA 4UIMB 3CPLA 5KVFH 1G7IA 4HPOH 1LO5B 1UXSA 3A4DA 3PS6A 4PVNA 5I6LA 4A6YA 2VDLH 1JWSB 2XWDA 5C7XH 5KVDH 3EDEA 4K3CA 3EZJB 2EICA 4LSIA 3K5RA 1MJUH 2VERN 2WB1A 4J6IA 3SQOL 4QRUB 2H5UA 5HHVL 4FNLL 4FERA 1KBGH 2QMKA 3BLKA 5SV4A 3DWNA 4LSSH 4QT5A 1UWEL 1SPDA 3BXNA 3MYJB 5JIHA 2ZUXA 3KH3A 3L45A 4OTXL 4R96A 2KZBA 1X5XA 4M5YL 2IJ0C 3GK8L 3ARPA 2QSCH 1V7ML 3L3JA 4DOHE 4NT6A 5TQ2H 3PDOA 1IZKA 1JWUA 3A5VA 1ZVSA 5T1LB 1KEGL 3DX6A 2A6JA 1OAYL 3LMJH 3O2DL 1JF1B 4NJAH 3RZCB 3U9PL 5I8OL 4ZUVA 3O6LL 1AHMA 1N2RB 3K19A 3VXSE 4PJBB 1C16A 3TBWA 2J25A 5HVGB 4B7LA 2VN4A 5EU6B 5JDSB 2G5BB 5CGYD 5J13C 1P5UC 3FS9A 2CO7B 5DO2C 1HYSD 1B0GA 3N04A 2IFFH 4YHNA 4YNYA 5DI8A 4FZNA 2UV3A 2X6UA 3VFNB 5DD5H 3WKPA 1CFQB 5LG1A 3W2DL 5IMLA 4Y5XB 5IHWA 3CFQA 3UDWA 3DMMA 1FI8C 3ZE1F 5C0AE 3QYCA 3P4MB 1YDPA 2W5PA 3MRMB 5C09A 4E5XG 3O0RH 2KZKA 3TBTB 1VJSA 4BK4A 1LO4H 3VXMA 5GSVB 1S9WA 4PJ9A 5E9NA 4UILH 3AQZA 1NPJA 4YXHL 3ZKMC 3NJNA 1KCWA 3QUYC 2RCSL 4RH4A 3FFDA 3GSXA 2NDGA 4BK5C 3G5XA 5DFWH 3U2SA 2XA8H 2G0LA 5AL0A 1T21B 5JXAL 2XTQA 1VLXA 1TCMA 3L3HA 4GRMA 3BP7A 3DXAA 1ZANH 1ASOA 3KGUA 3LNFA 1D3CA 5DL6A 3F58H 4WK2B 3LN5A 1T0NB 3KWWA 4LPWA 1E8WA 2Z9TA 3OMZA 3CNKA 4DO5A 5KSVA 1WISA 3K6OA 3P02A 2CDEB 1OGAE 4W9HC 3OC8A 1F90L 2FYVA 4PJDF 4CSSA 3O6FD 1FJ1B 4M6NH 4WAFA 5E5UB 2GVYA 3BLBA 1YY8B 1X9RA 4IBQA 3VE2A 1R75A 1FGVH 1XCQB 3NAAL 4X6BB 3RVUD 3NN8B 3QAQA 4Y4KC 4AYFB 2PW2B 1BXXA 4IOFD 2WZAA 3MBXH 1F4AA 1D6VL 4QR7A 2JLPA 5A2AA 3AZUA 1SOXA 3GMPA 2M2DA 3RNQB 1S5HB 3F6IA 2G4EA 4MJIE 4N2LA 3DPBA 4PJAF 4XXCC 1DBBH 1ZTXH 1RP8A 3QQXA 5IKCA 1RPUA 2JQAA 3CPUA 3CTTA 4JFZL 3DARA 4TUJA 3KJ4C 2HT2C 1FYTE 4JFQA 5FK9A 2EKSA 2CZNA 4P2CG 3WS3A 2FB4L 2G0KA 4EE2A 5I1EH 1T7VA 2DIAA 1YMMA 1XGPB 43C9B 4ZFZB 1RZPA 3GSWB 3S9DB 4N2FA 1Z9SB 4O3YA 1R3HA 4AQ1C 4HJSA 4OB5H 2ZYRA 4XPHL 2G3ZA 2I07B 3PF1A 1Y07A 2B1AH 2VXSL 3CZLA 2Q2LA 3BAWA 3QA3A 5E8EB 3RTQC 4ANUA 5DCCA 3UPRA 5J11C 3KPSD 4APQD 2RD0A 3KW8A 2YD8A 3H56A 5L2KA 3CDZB 4N59A 3QJUB 1L9OA 4K5OA 4M9PA 2WWMD 4JFHD 5MEPB 4FNTA 3I2CH 3QNXB 3LYRA 1FE8L 2YSTA 3UEQA 5D1ZD 4DESA 4DZ8A 5C9JB 1U8NB 2HFGL 1UQSB 4O2FB 4PGDA 4EDWH 3FZUC 2OXHA 2DM7A 5C9KA 1IILE 2GBAA 1K8DB 4QWWC 4FQCH 1UFUA 4BH8B 2R23A 1IC4H 3M7FB 4AKQA 3SCMD 1G7PB 3OG4B 1DBML 1MCWM 1PZ5A 4JHUA 4HV8B 1P5VB 1H9VA 1N4XL 2AJUL 1MHCA 2BIHA 2X7LB 4LESA 1OE3A 4GSXA 5E0FA 4ZO7A 1LE5B 5FM5O 1SDDB 2VLJB 2DYPD 3QHZL 5I75C 1IC5H 3K91A 4HEME 5DFAA 5F7BA 3PGDB 2F53D 1KXQA 2JMRA 2ZAHA 4OCNC 4RQQB 4WNSA 2D3JA 3TEYA 4YAQB 3S4SA 3N42F 3V7AG 2D0HA 1JVLA 4HJ0D 1QKZH 5ISZA 5C0RL 4R97C 3WYRA 1NCDL 4WFED 2Z31A 3BQUC 3QDJD 2P7TA 1EDQA 1OB1B 3ATDA 2IANA 4NM4L 2ZXEB 4LSPH 2CH8A 1M7DA 3DRTA 4U1SA 3QEQE 5DDHA 4ZS7L 4N2KA 5EEZA 3CX5J 1M2OA 2CNYA 3CSYB 1WF5A 4CN4A 3AS1A 2ORBL 4QTHB 5KS9A 1CG9A 3C5JB 2G75B 1FWXA 4R26H 2WMPB 1C7TA 1IGYB 1G94A 4L29A 4WNJA 4L3ED 2D7TL 2WXKA 1GGBH 3L3IB 5KVDE 3H7BB 4I4WA 4UT7L 5CJQH 3VJ6A 2AV1A 3WE6A 1NGWA 3DURA 2UY7A 1KCRH 3HI5L 3MJGX 3NDYE 2FWUA 3M1OA 4IIQB 1R4XA 3MVSA 4AK2A 5DMIH 2WSKA 5I5IA 4LSTH 4NKMA 1BEXA 3CZSA 1KPRA 3U7YL 3OL2A 4FI8A 1A9EA 2IVFC 3D34A 4QOKE 3I6GB 1RH8A 5KJ7E 1BDYA 4Z7AA 3T3ME 2OV0A 5CSBA 3K6NA 4YLBA 5I6XC 3MOQA 4HAGA 5D1QE 1DVYA 4OZFH 4PRBA 4M1CC 4DCQB 1XD1A 5KSAD 4Q6YA 3DVIA 5BRZA 3HI1A 2ZOLB 1QATA 4NGHH 3CSFA 3VWKC 2PCPB 2CLZA 1OP5K 3GZPA 5E8PA 3V4UL 5DS1A 2I5YH 2Q7NA 2YMXL 5E8NB 5I8KH 4P3CH 4LSRL 4X5RA 5BS0E 4JMXA 1JIBA 4FL4C 4L9LA 1JNJA 2G2NA 3EBAA 1WE5A 2C8NA 1SBSL 1KB5A 2PWEA 3OKYA 1G9MH 3UU2A 4NQEE 2FJGA 3D85B 4YSDA 4AE1A 4YDKH 5T8IA 4FRWA 1NFIB 3PJLA 2LW3A 1ZLVH 1S3KL 5IB1B 1SY6H 3TEZA 1LO0L 1PLGH 3S8GB 4P04A 2XG6A 2VLLB 2ZX7A 3TASA 5I73C 3NGBB 2R4SL 5CZXD 1IJNA 3H53A 4CMHC 4EIUA 1LE5A 4PJXB 2O5XH 1J9QA 3IDIA 1C5CL 2F0CA 4JN1L 5IF0A 4XPFH 3LPFA 1A7NL 1QYGH 3ATFA 9PCYA 2WOBA 1UOKA 1ZK5A 3QDHA 1I1CA 4LCIH 4M48H 2X4PB 5B1BB 5KBKA 1ZIBA 3KYMB 1HINH 2MMXA 2MQ3A 3B7RL 5IWLA 3UOAB 2DQUL 3CXFA 5I8EB 3H54A 4I9WD 1E3XA 3AMLA 2Q20A 3HUJF 5A7BA 5FYLL 2VABB 3OKNA 5AVVB 1GFQA 1OHZA 1S9YB 2LFEA 1FG2B 4JQVC 1HHKB 4PQXA 3FTVA 4IOSA 4P48A 2EIMB 3FQUA 3QVAA 4G6FB 4PRIB 4TSBL 4G43B 2HX9A 3DX9A 4FFZL 4X4XA 2A73B 1WBZB 3GHPA 3STZB 5EZIL 3PWVB 2A9MH 2IO5A 7TAAA 1PLCA 2VZVA 2WINA 1KEML 2GJ6B 2XWZA 4HUMB 2R2HA 2WJQA 3DDFA 4W9FC 2D0GA 1BOGB 1K9TA 2NY7H 2F61A 4HA1A 3LK2B 1G7HB 1NBCA 3DRQB 1ZTXE 2CJSA 2FK9A 4P59H 4RMTA 5E70A 3UYPA 1PZSA 3WJLA 5E1GA 3RJOA 4LSQL 2GB2A 1Q9KA 5DL8A 5K1VA 3GHBL 5SWZE 1RZJL 4Z8FH 1T66C 2W59A 2WANA 3K5SA 3W56A 4RAVA 2QSQA 1H3PH 1SF5A 3OJMB 4WU5A 5CSZB 3V6ZB 1DDHA 1CFNA 1QSFB 3VUAA 2EYSA 2GUOA 5D1ZB 5GGUB 2VDOH 2AK4D 3E9UA 2M07A 4GLRI 3DGGA 2IADB 4AWJC 3HFFA 3CFDB 1CIDA 3VI4A 1NPUA 1W6WA 1KJ3H 3LK42 5J13B 4PWHA 3L1EA 3T8MA 4N68A 5E6IA 4P5TD 4XBPB 1HH6A 4O4YL 3J27A 3IFNL 2WJ7A 5DS8A 2BVQB 4DP1X 4MASA 4RJXA 4U6YA 2BRRH 4JR9H 4B7IA 3N6YA 2FGZA 4HXAH 2BH0A 1MY7A 2DQHL 1C12A 2AQPA 3QDME 5B8CA 2YD0A 3BH9A 3VGAB 2DYPB 5EWIL 3QJQB 3QH3A 5LAXA 3ESOA 4NLHA 4PJCB 1MZYA 2GTWA 4MTMA 2DQGH 1X5YA 4PRAA 4JKPL 3ESNA 3F62A 4XT1C 2GW5A 1CL7H 5HHQB 1AZNA 2X70B 4J3SA 3LRSA 4JM2D 4Z7UB 1FNHA 4XMZA 4ZTOH 4GW4A 3SDAC 4AG4H 1QR4A 3FFCE 1ULVA 5KJRL 1ADWA 2WYTA 1DTUA 3KPNA 1J0IA 3WFBL 1O9WA 4XCYA 4XRCB 2WKGA 3TWYA 5CBAB 2W07A 2YUVA 1MG3C 4KKAC 4K7PY 1OK0A 2CO3A 2NX5D 4GP4B 1YYLL 5LWYH 2YLHA 4X5PA 4ENED 4F8OA 2NQCA 4RMWA 5KYNA 3D1MC 3SE4C 2C3VB 5FF6A 2P26A 3H3PL 4PH8A 1DZ0A 5E0QA 5IJCC 4A6YH 4OF0A 5F7UA 1E4XL 4Y4KB 1BIIA 5KWYC 2RFXB 4JZNB 3PXHA 2NTFA 1DQML 5CAYB 4P4KD 1MSPA 3R4DA 3HEIB 1FNGB 5HGGS 4NO0A 4TLTA 3WD5H 4EIGB 5C08A 4QMEA 2MCPL 4JFOB 1J8HB 1ORQA 4OCSL 1E8XA 1QA9B 2R29L 2HVBA 1Q38A 1DBAL 2X4OA 4LLMB 4R7XA 3B5GA 3TEXA 3HRPA 4YOKA 3IJSB 3RB5A 2DQMA 3ZTNL 4WHYH 2ESVB 1FZMB 3KJ4B 5FHBL 5IUCA 3MTRA 2DBLH 1AHKA 5HGBA 1ETZA 1ACZA 5ANME 3IF1B 1P1ZA 4GO8A 2FH8A 3PXLA 4LKXB 3MRQB 1QWNA 1BD2D 1T0MB 2C3HA 2WTPA 4QYAA 3R4RA 2P5WA 3BKJL 2A74C 1NGZB 3OKEB 5DFVD 4OW6A 2DV6A 4AQ1B 4HX1B 3A0HO 1U3YA 3POQA 3MUGA 3IT8D 5LBGA 1ZLUH 1ZS8B 1K5NA 4ZNCD 5T3XD 4CC4A 1SGKA 2NY3D 5KOMC 5IFAL 2NY5L 4Z95L 1X9LA 4NKDB 2LTQC 3LKSA 3DSFL 3W9DA 2CAKA 4X50A 2I25N 4ADGA 1CLYL 1XGRA 4FG4A 3IGLA 1IVLA 2R0KL 1NZRA 1NBZB 3IDUA 4KH9A 2W38A 3GFUA 4N1EA 4UI2A 3FB6B 4Q9RL 4WGKA 4HSAC 2BIIA 5C0DA 4FXKA 4FABL 2BWDA 2JB5H 3D4CA 3F64A 3P4OA 1TVBB 3NH7H 4OJFH 3TVMC 5KYUB 5GRWA 4U1HB 5IW1A 3D8MA 4AM0A 2CGZA 4UMGA 1RI8A 1QLRA 4AXWA 3O3BA 4PN6A 2DM4A 3OZLA 1T0OA 2AMUA 1LEIB 2OZ4A 1D9KC 4OZHE 5C2UB 4XC1L 4Z0BH 1SF3A 5ALCL 4D0BA 2LABA 3OGOE 3SYAA 3ABZA 3UZEC 1TQSA 3IKKA 4WU7B 1WHOA 4X8GA 4Z6AT 3DDGA 4R97B 4WFGD 4XNZC 5JIPA 1GYAA 3QFJA 3NZ8B 3BQUB 4B9KC 1T6BX 4MNQA 3UJTH 4JUSA 3DJTA 2NXZC 1ZDSA 4G9FE 3LN9A 4XWGH 1UM5H 3TFBA 4ZAKC 3ULVD 3IKCA 3ZUCA 3QHFH 4EEEA 2K0RA 3A6CH 1RZ7H 4UDTB 5DFTA 4LVEA 1INEH 4L4VA 5C70A 2WIMA 2DIBA 4FZMA 1JMZA 2XV3A 3CVHA 3HN8A 4PJEA 1E9PA 1FNEA 4P9ML 5I2IA 1KGWA 1IGJA 35C8L 4GB9A 2NW2B 3WY4A 1OWWA 1DQDL 1E4KC 4E0RA 3ESUF 1XGQA 1B2WH 5JW4R 3IFLL 4E9QA 2AGJH 3WNMA 3JTBA 2F7IA 3VGDA 2ICEA 1ZHKB 4ABWA 2BJML 3EO1A 2KQMA 4U7KA 5I17A 3CXDH 4MQ7B 1YY9D 1EHXA 1H6UA 4TNGA 4PVMA 3C87A 4WGWB 2DD8H 2FLMA 3ECUA 5DYOA 2VR8A 1EBAA 4X7DC 4ZS6C 1JRHL 3Q13A 5JW4M 1UUSA 4OF3A 3UL4A 2IWKA 5J56B 5GRVL 1V10A 5B3SB 4KRPD 3N44F 1KGCE 5ACLA 5K69A 5EB9A 5E1IA 2HJLB 5I6XB 43CAA 3GMOB 1KLGA 3OAZK 2IAMC 2K8QA 5IMMB 3UTPE 2NCMA 3NFPB 3QNYB 4OZIA 4PJIA 3VWKB 5ICYA 3IGAA 1YCSA 5FCSH 4BINA 1F4YL 3KGSA 2BWQA 3ZYOA 2YA0A 5JHDE 4IGBC 4RETB 1MREH 5EFIB 4OLYH 2BZ7A 3RAJH 3U4EB 2Y6SD 4KKZA 1CD9B 3D50A 2XG5A 5EBMA 5HPMA 1T1XA 2VXUL 2NCEA 5DHYB 2OTWA 4F9LC 1B3JA 2NY1C 2ROYA 4ZPTB 4YHYC 5FVNA 4OV5B 1OTUC 4K94H 3QIBA 2QGCA 3F7PC 2C34A 3VFUB 3SBQA 3KPQA 4OU3A 5FA4A 3MXWL 1R3JB 1ZVHA 4HLZG 3D3VD 1TJIL 1AO7E 5I71B 2A83A 1SLXA 3WU2O 5I73B 3NIFE 3JTTB 4CMHB 2VQ4A 5IB4A 2M8XA 5KS9F 2FJUB 3US9A 4FQXA 5DMYA 3BDYL 2IV9A 4GBXC 4NPYB 1HSAB 2EXWD 1RFDH 5FECA 3QZNA 2OCCB 3F12A 4HMCA 4HF5H 5ILTL 3EYOA 4OSUH 3WUWB 5LLIC 1IFGA 1U8KA 2I9LA 2IPUG 3AXHA 4IKLA 5GRJH 2YA1A 3RE0A 3QI9A 1KELH 4FG6D 4PLKD 5CD5D 3LJ3A 4G7YL 3OPZH 1PD1A 4LL4A 1S7VB 3VD2A 1LWJA 3QJVB 4WW1B 4AKOA 3I02B 1ASPA 4MD4B 4QJ4B 2X0UA 1FIEA 3GMLA 1R3IL 3NZUA 4DQAA 4K07A 5F7KC 5C07D 3G7GA 3JTYA 3QJXA 4R4FH 5F7YC 4M7LH 5EOCL 3BKYL 4Y9BA 5HYEA 2M83A 1NLDL 1UACL 4GMTH 3PV7A 1ZLSL 5IESH 4KUCF 5LGHL 1K4CA 4LGRB 3THML 5AFAA 4ODXA 1G7MA 2IG2H 4RFOL 2PPCA 1YNLH 1P4LB 3B9VA 3B7UX 1G6RH 3PU7A 3BPLC 2O6EA 4KJWC 4U0RC 2NR6A 1EQWA 1F4HA 3UBXA 3ASNB 3OLGA 3MLXL 4PRNA 2XQYG 5HYJA 4EAEA 3ILQC 4HH8A 1OALA 2XPYA 5FYLE 4J8RB 4AMXA 4KTDH 1B2YA 1BQHA 3TESA 1TT6A 3LQZB 1BT9A 5AB2A 3QQNA 2XLLA 1XZWA 4MJJA 2K4TA 2VR7A 4D0CA 3GUTB 1QFUL 1MIML 2G9HA 4GKSA 4XNAA 3U1PA 2YJLA 1NJ9A 4NUGH 5C86A 3CQQA 1BVLB 3B9AA 2GSGA 3CDGA 1W0WB 1G5GA 2DJSA 4HUXA 1FIGH 1MCDA 1MW0A 5D7HA 5FO9B 4WI0A 1H8OA 3WAJA 3TCLA 4J5VA 4P46C 4FFWC 3FTXA 2FVNA 5GRYA 1XZ0B 2HCZX 1CXIA 4NZTL 1J18A 1KB5H 2FWSA 1QVOA 3A3YB 1YPZA 3WKNA 4C4KT 1NCNA 4PTTA 4EO5A 1AXTH 2V37A 4U7SA 4NCC2 2EDLA 2YD2A 5IR1B 4AITA 1RJZB 3LEXB 4WUKH 2QLVB 2GSIA 1TFHA 4O9HL 1WEJL 1Y0LA 1AQ8A 1BM3L 4HIHB 4DKTA 3S5LA 3QCTL 1A66A 4F7MB 3NQIA 3UTQB 1BZ9A 3D2UB 5EDSA 3ZBMA 5EZJA 4IYKA 2Y69B 5HDWA 4G80B 3VYOA 1NKOA 1GFNA 3AAZA 3MLWH 4YSEA 3RBHA 5E2UL 2X4QB 4U05A 5LCVL 1REIA 3RY6A 2CLRA 1DEDA 1DYZA 4Y16C 2UZXB 3QR0A 1YEDA 3TEUA 1D5ZB 2ZT9C 4JGNA 2D31B 4XP1L 4DWHA 5KW9L 4KKRA 4OAWB 5T3XL 1E28A 5AYQA 2YSSB 2F1TA 4MX7A 3C6LA 2QSVA 5JW5B 2R7EB 2GPZA 1QFWI 4WTZG 3DGCR 4UT9H 4XH2A 2GJZB 2E86A 4FQ1H 1A3ZA 3IXAB 4BIKA 3DHUA 1MI5E 2AITA 3MR9B 2H2PC 4A7SA 3G6JA 4TUKL 2DBJA 2C3GA 3FTYA 1L5GA 3A0OA 3U1SH 2QLYA 4JFED 4MDRA 3CGTA 1JGUH 1F4XH 4NZFA 1G9NL 5K39A 1H3XA 5EU3A 3O2WL 4WCYL 4DP2X 4NQTA 2DJ4A 3WG7B 1WFMA 2XQYK 4FA7B 1AGEB 1KTKE 2VLMD 2J8UA 1P4TA 4N0FB 3PWUA 4DGYH 3BUYB 4G6JH 3LHAA 4JQIL 4XP6L 5HHXH 1ICTA 3OQRA 3RX8A 5GZOD 1S7RA 4QHMB 1INDL 1DLFH 3EGSA 1HHHA 2JJUA 2Z8SA 2CHZA 3IDGA 3MLSL 1DUZA 3BCDA 4E41E 5I1HL 4QRTA 1LGVA 4HWZB 4RRPM 3RIAF 2LTQB 3NACL 5CU9A 4AE0A 5L2KE 4ERSH 1J5HA 3FQNB 3TJHC 3SD2A 1S7QA 1U8OB 1XEUA 3OBAA 5DTFA 5LGJA 1T04B 3BWZA 5EO0B 1BVNT 3EYVA 2B2XL 3VAEA 3CBJB 3MOBH 3X1FA 3V0WL 1EHLL 1KJ2B 3MXVL 2ARWA 4LOEA 3I50L 3OF6A 4IU3A 4X4ME 5KANG 4N75A 3DJRA 3UTTB 1ID5I 3VACA 3NEXA 4LLWB 4NUPA 3CHRA 3DX1A 4PV8B 5F7EL 3SGDI 3V0IA 4AUJA 3VDCA 4KI5F 2V2WB 1NBVL 5E2JA 2ZWSA 3QO1B 4U6XA 2X41A 4J39A 1HZKA 4MMXC 4NP4L 3KPLA 1XD0A 2Y06H 3DOSA 3O4LE 2RQEA 4YGVA 4D9RD 1YQVH 3Q44A 4AM0Q 1MJ7H 2J6WA 5JDPA 3Q2NA 3RGBA 3V4PB 4Y89A 1VAHA 2R56L 3HPLA 5IOPA 1NICA 5C07B 4D94A 3ULUD 3E3QC 4FMKA 3F2LA 1IBYA 3P3TA 3MGAA 1FAIL 5JZ7C 3ELAT 2YEZA 3C5ZA 3FQWA 3MRGB 4FTVD 1ZLDA 1L9NA 4PRPD 4WENB 5CJXA 5FXCH 5HDQL 2WZ6A 4LEXL 5CR8A 4JO3L 3HCVB 3BUBA 1P7KA 1ZSDA 1JV5A 1MFDH 2P5EA 3UBHA 4PS8A 2UZIH 1VCAA 2NXZB 3BSHA 5F89A 3OXSA 5JMRA 2EVGA 4BZ2A 2RHEA 1IBBA 3KWXA 3LQAH 4IBYA 2XWTA 1HIMH 4KKNA 3PRZA 4BFNA 2WLNA 1XR9B 2CRIA 4DPAX 2WNGA 4A2HA 1F86A 1F6AB 4YQXH 4J3UA 5CCJA 1IARB 2YR3A 4XN1A 4OLVH 5E5MA 1MVYA 1QQDA 3TIDB 1T5KA 1CZ8L 2WLZA 2BVPB 2FQDA 3NSFA 1EBPA 2R9HD 3V0GA 1KLUA 3ZYIA 4W93A 1GZQA 1NDTA 1F00I 5E00A 3R1GL 4XXWC 5FOBA 1BVOA 3VZUX 2DB8A 4MQXD 3MX0A 4R2GC 3S6CA 4BWUA 1HAUA 1A02N 4HBCL 4OQTL 4IJTA 1N0XL 1G7JB 4PV9A 4XN8A 3WLWC 4BDVA 1VADB 2BMKA 1PHOA 1ZK9A 1E5AA 5G4MA 3MV8A 3VW3L 4IMLB 3U7WL 5TDOA 2R0ZH 4JPWL 1IKFH 1HWGB 1LDPH 2W1NA 2Z34A 4F24A 1KCSH 2R1XA 4LL9A 2EDKA 4J1UB 3KXFE 3QZWA 5I5MA 1GIGH 1F3DJ 3QUZD 3W0WD 1SDYA 1AJ7L 2YOAA 2DLHA 3W39B 5GS1A 4PU2A 2TRHA 1SMOA 4IGBB 4K9EH 5GGSY 3VD7A 1JK9B 3A0BO 2CMRL 3PWJA 4MB1A 4PJFB 4P3WA 2ICWA 2WUBL 1GFPA 4F27A 5K5YA 3LPWA 2NZ9C 1YUHB 2Y1VA 3FO2B 3LKQA 4Y19E 4HJTA 3RDTA 2NY1B 1IM3A 1NTDA 3DA4A 3K71A 1L6ZA 1S6NA 2OZ4H 5I1JH 2UXTA 4WO4A 2M26A 3B2UD 5EF2A 3F65A 3IN0A 5C0FB 2QGEA 1FLRL 1FNFA 3HS0A 5DC0A 5EO1A 4KRMB 3ARBD 1KXHA 5GJTL 4XBGA 3EKCA 1CBVL 5I1GH 4N86A 2IALA 3NFSH 4GBXB 4PJEF 4DAGL 1KIRB 5IEHB 1T03H 5D5ME 3RIFK 1RZKH 3CX2A 1F58H 2LT9A 4MRCA 3WLBB 1JDCA 3WFDH 4PGEB 5E79O 2L7QA 3Q2WA 4N6RA 4NAMA 4OGZA 5AKRA 3SBWC 3WMQA 4MNGB 4ZXBC 2VC2L 3AG4B 2IWGA 1KDIA 3GMNA 3L54A 4H0IA 2FECI 1PX3A 3GLZA 2Z0BA 1JDAA 1OY3B 2QQNH 3JWDH 4FNRA 4M3HA 4PJ5D 4XB8A 3CVHH 4KITB 2V2TB 4BK8A 4HFWA 4N0UB 5CP3A 1BJ1J 1B0IA 2VQUA 2XI9A 4D5UA 1I1RA 4LU5L 4C4VB 1Q9WB 1S3RA 3EH3B 4YDIL 4CBZA 3ILPA 1WS7A 4HZAA 1UZ8B 4PJ7B 3DOHA 5DEFB 1IQWL 5IT2H 3I6KB 3BC9A 3FUIA 4BFIA 4UOW0 4BHUI 2R2BA 1HXKA 1EVTC 2WXFA 2WVSA 4OZIF 2ADGB 2Y0HA 4P3DB 4Q52A 4U0RB 5BUPA 4TL5A 3C5XA 1FSKC 3LDBC 4GSRA 1CLCA 2XWJA 1TZGH 4S1SL 1XGTB 4DQOL 2YKLL 3TX4A 2WXGA 3WU1A 3EUUA 1E27B 2EADA 2GE4A 4LSEA 2DWEB 5J1TC 1UWFA 5HDBE 2MNUA 3MZTA 5DMJB 2O5YL 4U1MB 5CS7A 4YXLL 1T1WB 2I7SA 1NEPA 4KVNL 4HHWA 4YX2L 2VSMB 5HHOA 2FIKB 1KDJA 3SOBL 4M8QA 1IAIH 2EABA 4LPVA 2ZSVA 4B9YA 5FLVA 3CFEA 2AMGA 4KROC 2OSWA 5CN3A 2WGXA 1HQRA 5FCUH 5ADPL 5EOTB 3GI9H 1PY0A 1T5XB 4JPSA 4P46B 4QRPD 4MCZA 5CEYA 4PP2B 4JL2A 4GG6A 4FNSA 4M1DL 1DLHA 4XNDA 1FGNH 3QRCA 1PKQA 2AABH 3A4FA 1JZ8A 2Y1ZA 3SDYL 3VFVA 3WN5A 4EZMA 2WQVA 3FO0L 2PXYA 1I1AA 1I7UA 2ZX9A 4IBSA 4J3VA 1DSWA 2CWRA 3SB3A 5CN1A 3KPRA 5IJVB 4PRPB 2BXYA 2VB5A 4M29A 1M2VA 2OP4L 4UIKL 4JB9L 5JIQA 4QUOA 1JPGA 2WLIA 3BI9X 3ZL2A 3CVBA 4CBPA 3V5DA 2J1YA 2C1PB 3WY2A 2EAEA 1UYWL 4FXGA 4HUUB 3W5NA 1DBJL 4PIBA 2X89A 3S3PA 4P2OD 2ETWA 3CZJA 2ROXA 4HHAA 4LQFL 4OGYH 1P4BH 1WWBX 1J5DA 3GWJA 1NCWH 4DN4H 3NSYA 5SWSD 1HT6A 2EC9U 2PCFA 1MLCA 4WFHD 2HP4A 4HKZB 2F54E 4QEGA 2OMTB 1YZZA 1XF5B 2FSEB 4E9YA 2FX9L 1TVHA 4JHWH 3RKPA 1HEJC 2GIXA 1T5WB 3GSRA 2ATKB 5F3HA 1ZA3B 3IVKB 4XMUA 5I9QB 1UB5A 1TFPA 5C0CA 3APCA 4YC2C 5IVOA 4YHPB 1KMGA 3OLDA 4LOUC 4M8UA 5C08E 3AREC 4FOZA 1BW8A 2E7LC 5H8DA 1N59A 3G3LA 3E6HA 3TJEH 5IB3B 1N5YL 1IGCH 4NQQA 2EIJB 4IDLA 1JZIA 3JQOB 2OYPA 2SEBA 4GO9A 1FZOB 4GW1B 3QG7H 4I3SL 4B9FA 1DFXA 3MOAH 1EFXD 5CNHA 2HUHA 4XZ4A 4RWYL 5ECJE 4NYLA 3VWJD 2FQEA 1KACB 3QUZB 2J1KA 3T6XA 3W0WB 5FUZH 1YPZF 2X38A 4YFEA 4Y1AE 1TTFA 5A43C 5L88H 2ZWZA 1I9IH 3FO9B 5L9DH 1FFQA 1MRCL 1JPTL 4JFYB 3RWCA 1RHFA 3UPCA 1K72A 3M1CA 3ZQ9A 1NFDA 4MJ5B 3K2UL 1CS6A 3MUY1 4YJZL 3O8XC 5F70A 1PG7H 5ELIA 4PWFA 1OB0A 4KV5F 5HD8C 1QEXA 5HVFB 4JHBA 3GSUB 1D5BB 1ACYL 3RVTD 1ZLVK 3ZE2E 3QQ3B 4PGCB 1N6UA 2GJPA 2WNKA 4NZRL 2EVHA 4KGLA 5KTEH 1PBYA 3QO0B 1OW0C 4LMQI 4N8UA 2E6QA 3GD1C 5F1NA 1KTDA 5EORL 1KTLB 5D93C 3NJKA 1CF8H 4NN7C 5H2BB 4YFLF 4YHKL 5CZVH 5BPPA 3U48A 1BF2A 1XH2A 4HEPG 2QR0B 1QTYT 4B50A 2FR4A 4KDWA 3T0AA 4ODSL 2EYTA 4XTRC 2XE5A 3PQYE 2JKNA 4L4TD 5MERA 2F7PA 4GT0A 1UM4L 3S3DB 3EG9B 4GI8A 4OF6A 5DC9B 1JPFB 3G6JF 2EDEA 1RZGA