4AYDC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 r106a mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
247
structure length
238
Chain Sequence
DIGAGLADALTAPLDHKDKGLQSLTLDQSVAKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEITLESGEFQVYKQSHSALTAFQTEQIQDGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 53
structure length 238
sequence length 247
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aydC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aydC01
2YPVA 3VE1A 4AYDC 4O4UA 2KC0A 3KVDD 4O3YA 2Y7SA 3UAQA 4AYMC 3HOLA 2LFUA 4O4XA 3V8UA 2W80C 4U9CA 4QQ1A 4O3WA 4AYID 4O49A 5T5FA 2W81C 3VE2A 3HOEA 4O3XB 4AYNA 5EE2A 3PQUA 4AYEC 1YS5A 2KDYA 3PQSA 4Z3TA 4O3ZA
chains in the Genus database with same CATH superfamily
4FMFA 3C2SA 3FU3A 4X6CF 5E4OA 3NCEB 1M6UA 5FV1L 1THCA 1DVFD 2I60H 4MTMA 2ZOLB 1J86A 1I85C 2ERJB 2Y7LA 3T04D 1PD6A 1SXAA 3LNGA 1BFVH 3KBFA 3O6KL 1A4CA 3LNIA 3O81A 4LK4A 4WUUB 3DSNA 5DQ9B 4XMTA 4W9HC 3QWOB 1XD1A 3LRSA 1T1LA 3QT2A 4EIZC 3APNA 3LPWA 4P3DB 3EOTH 4AK1A 2Q76A 1EHLL 4P59H 4XC1H 4XCCH 1HOCB 2DQTH 1A22B 4J3OD 5D8JH 5D5DA 1VADA 4BUHA 1K8IA 3EYVB 3I3DA 4TUKH 3E3QC 4B95C 3ARGB 2WK2A 2IH8A 2JKSA 3APFA 3VXRE 5MI0C 4OGXH 5D93B 4QRRA 1QTYT 2CBPA 3Q43A 3MRLB 4QF1A 4YPGB 5C0JB 1O75A 3RTQB 4BYHA 1RIHH 4L3EA 1BEXA 2Q9OA 4FFZA 2NDFA 1YYML 1MLCA 4L1DA 3KL3A 4XCYA 5GISL 3DMMA 3EJYC 5J12B 2AJYL 1W72B 3P3RA 5E00A 1DO5A 2GQHA 3NIFF 4NWTL 3NSFA 1QR1A 1HU8A 1G7HA 5H4YA 1AGDB 2DQEH 5L8JB 2QHLA 4N2BA 3NJIA 1B3IA 1T0MB 2DKUA 4N90D 2NY3D 4RWYH 2DL2A 4U7SA 2GCYB 3L3HB 4UMGA 5ES4B 4HMDA 5CLTA 1NTDA 1Q9KB 4J5VA 5E4EB 1I1AD 4TULL 1CXKA 1GGIH 3WHE0 4BH7A 1O7SA 2CQVA 1HXKA 1YNKH 3DJSA 1KSRA 1DJZA 2R59A 3Q6FB 4M1GH 2K4TA 5DDHA 2H3NA 4P5TD 3W39A 1SHWA 3P30L 2G3XA 4XNAA 1Z9NA 1W2KT 3U7YL 1DVFB 2B9AA 3BP7A 4XX1G 1WHOA 2DTMH 3QEGL 1P9MA 2P52A 2BDNH 1FI8C 1RZJL 4Z78B 4CN4A 3QIWD 3D07A 1NGWA 3CIAA 5FYKH 5EO9A 1G1YA 3I75B 2W9DL 3FN3A 5I1HL 3VFNB 4EQ2A 4S2SA 2BO0A 1TETL 2QPEB 4XO3A 5AAWC 3HC3H 4PJEB 3TO4D 2FEJA 3DC0A 3DPDA 4M7LH 3U9UA 4PJFE 2IDFA 2GJ6D 3JWDL 1KC5L 4WHCA 3A2SX 1ZHBB 5LG6A 2C34A 5H37A 4QCIB 3IJYA 4J8RB 1OGTA 3ZHKA 3O6FD 4G59C 3NFNB 1LMKA 5DFVC 5DVKA 1JZ4A 3QDJB 5AOMA 5FS5A 2ATPA 4AENB 2KBGA 4JFBA 4XNYL 5D6CB 1H3VA 2C3GA 1LL1A 3AABA 1G7HB 4PRHA 2RMNA 3ZKNC 5C0GB 5TE7L 1TVHB 5AB9A 3DUSB 3NSCA 3AAZB 3NJJA 2EDRA 5K5YA 2IDQA 4P9HC 4PLKD 2OYPA 3EDDA 4KXCA 1T0NB 4HFUH 3VSQA 2AXWA 1R5WA 1K5WA 4POYA 3KLHC 4FQJL 3LCYA 4YSQA 4AENA 5INCA 3OC8A 4PRAB 1ZT4A 3WD5H 5I66A 4E41E 4Z3EA 4LEOA 1JWSB 4OLXL 1GXEA 2V5MA 1ZHYA 3W0WB 4DP4X 1MM5A 3JYBA 4WSGA 2CKBH 2A74A 2Z65C 2EINB 3RPIB 5D72L 2XN9E 4IIQA 4ODTL 2DQHL 1GGCL 1EERB 1HILB 5DMIH 1EANA 3P0YL 3FCBA 4FFZL 5HYEA 1ZLDA 2VITB 1KJ2L 4I1RA 1Z3GH 5ELIA 2AQ3A 5DJCA 3ROLB 3QC5X 2HJFB 2BSEA 5DCCA 3QIUA 3OHMB 1EAPB 4JFDA 5GS0C 1TETH 2ITDA 2FATH 4WKXA 5GQBA 1E90A 3MMEB 1XGZA 3S5LA 2OR9L 4IU2B 3NEOA 4UINH 4X6FB 3C60C 1GJWA 3JT2A 4MD0A 4AYNA 3WMQA 4GOSA 5FYJL 1L0PA 3UJIH 3V0VB 4QHNB 4XODA 4JY5L 5LGKA 1RP8A 4I18B 3QFDB 3NJMA 2CHZA 1RZGB 5DHVH 5ABZA 4QRRE 5D7JC 1REIA 2W59A 1RIUH 5D2LA 4EOWL 7CGTA 3I50L 1OGAE 3RURA 4LVOB 4K55A 4AMXA 4GAJH 3WFZA 3IGUA 1OAQH 4TVPE 1FG2B 1C5BL 2BC4A 5L0QC 2G9HA 3QXAA 4MRCA 4C4VB 3BSZH 1M05B 5DHXB 2YD8A 3QI9A 3SBWC 2XA3A 2BSBA 1NBZB 4LPWA 5HHPA 1EFXD 2IPKB 3T20A 1QRND 2B8OT 4GXVL 4KHXH 4LSSL 4NQDE 1D5ZB 1FYTD 1RULH 1HHGB 35C8H 3VXOB 3OKDB 1K8DA 3RY4A 1XCTA 4GSUA 4PGBA 5EU5B 3ZR6A 2W95A 4P8QA 3CN2A 4P2RE 4XPFL 2EILB 3L5IA 1DBKL 2HZHA 2VABA 4GCSA 1UM6H 4KGJA 5KYNA 5HHQA 1YNKL 2A6DA 2VM9A 1U3HA 4FG4A 4LIQE 2MCPH 1CFTA 3KR3L 3LRSB 2F8VA 2H6PA 4XNUL 4AZUA 4BFKA 1DBAH 1JZ7A 1M9WA 4FKKA 1EGJH 1PZ5B 2FGRA 1GVIA 3HTLX 3QE5A 4ZO6A 3VYPA 1FWXA 1RZQA 2OXHB 4DQAA 4E5XB 1E7VA 4A6YH 4EVNB 2XPYA 4PV9A 3BCDA 4WCYH 2CMRH 2H0JA 4YQXL 3GQFA 4RLBA 5F7BA 1XAKA 4A7QA 4DHLA 5KS9E 4JFZL 1Q9LA 2XXFA 5IBLD 3OVUB 5KYXB 1U8KB 2Q3XA 3LPPA 3W5NA 3RWHB 2WXJA 1XCWA 4JRYA 3B2UD 2NY1D 5CSZA 2IGFH 5ETUA 4HUCA 1QSFB 2ZWSA 1HT6A 3NAAL 3R19A 5E5RB 5MHSE 5ESAA 4XVSL 5FCSH 3W82A 4AKPA 4KKBD 3HIZA 1WJ3A 4MCZA 4UCFA 2FGWL 2W88A 1PRNA 5CINL 3T3PB 2XZCH 4JFXA 1ND0B 3WFHA 2VXVL 2BVQB 2JE8A 2VXVH 1N2RA 1T0MA 2F53E 3S97C 4ZX4A 3GMPA 3FBQA 2XZCL 1RMFH 3QNXA 4Y19B 3SDXF 5JW4M 3VWKD 2YPKB 2VXSH 2FWUA 3W57A 4QY8A 2D7QA 3SJVB 3HRPA 1ET7A 1NGZB 5I1KL 3NA4A 2GSGB 2ZWLT 4A7GA 2CRYA 1IT9L 4AE0A 2XRAH 3I2CH 1CGYA 3L5XH 4GO8A 1A47A 4X8JB 4XO4A 1YNLL 2NRDA 1B0WA 1U6AL 4MJIA 3RNQB 2HKHL 5DUBA 5HDLA 4X4ZA 3UJJL 4H1LG 3H7LA 4I2XA 4L8SC 2L0DA 2BS8A 1EDHA 2Z0UA 2RALA 2X4SB 2WWKT 1QR4A 1GY1A 4GEJA 2LFEA 3NJFA 4YE4L 4PCKA 1GZHA 2IWVA 3QR2A 3OR7A 1MAMH 1UZ8A 2A2QT 5L2KE 2ZUQC 5DK0B 5AOIA 3VI3A 5J57B 3NH7H 4WJKB 1QSFA 1O9ZA 2UVEA 3LQAL 4NQEB 2QKIA 2ZSWB 3ZMRA 4X5RA 1L7TL 1GFQA 3NCYP 1SFHA 4AVHA 4C4UA 2BIMA 4PCTA 4PREA 2E75C 3BX7C 4RZCA 1TQCB 1YYLH 1XSJA 4LHJB 2XIDA 3LZNA 2OZNA 4MNGE 5IKCA 5ADOL 1NCJA 2WZ6A 3RL2B 4EXPX 4CVZB 2TSAA 2YAFA 4FQXC 3UTTE 4FZLA 1WH0A 5DZOA 5KBNC 1N67A 4HLZH 1XGPB 1FRGH 2OZ4L 4M7JH 4UBDC 3UYPB 2LU3A 3O2DA 1MWAL 4ETQA 1MCNA 2VQ1A 1KN2H 5BJTB 2WYIA 4FCHA 4F7KA 5T3XH 4PGBB 4Y1TA 5DJ8A 4PW3A 3UTOA 4OV6F 3EO1B 5E2TL 4GQPH 3IFNL 4KNQA 1SBSH 2A77L 1I1RA 2XN9A 3K0WA 3T4AC 2EEAA 3GMNB 3M6DA 5AKTA 3K4DA 1CC3A 4KU1A 3UOAB 1I4FA 2PR9A 2ADIA 3JWOH 4HVBA 2GUOB 4Z7UF 1CJYA 1RPQA 4OCNC 5ERWA 3ZDZE 3QZBA 4J4PC 1HXXA 2HFEA 3E7JA 2J8UA 3VXUE 5FUCC 5JUEL 4BSVB 3Q6GH 5D2LB 3SIKA 3OGOE 4BZ1A 1FSKB 3LNDA 3L7FB 3ZTEA 1JK9B 5L2KA 3UYRL 5IWLA 2C3VB 4GMTL 4F9LC 4MWFA 3KDMB 5JXEA 1BBDL 2YPLB 4MD5B 4KROD 2D3LA 3QG6B 2HFEB 1YDPA 3WTSA 3QNYA 4G8EB 3QQDB 5A40E 4WFED 32C2B 1ZPLA 3TVMD 1IFGA 4NNYA 4NOBA 4HKZA 1FNAA 4H0LC 3D39A 5HJGA 4CSTA 4XHJC 3MV8A 3FQWA 1YEEH 1R3JB 2AK4B 4YGAB 3QQ4A 1NOAA 3GGWB 3FUMA 2OMXB 3ECWA 1EEYB 3QCUL 1DE4B 2AXTO 4F8OA 3AMLA 4AL8H 3Q5TA 3MROB 4AM0Q 3TH2T 2FX7H 5CJQL 3PQSA 1HYRC 5F7EL 4E9RA 2YSSA 4FC3E 2XTJD 3OXSB 4HJGA 3KGRA 3HI5L 5E5MA 4XRCA 3X1NA 1KTLB 1YY9D 4YX2L 5G26A 4BQCA 1P5VA 1KENL 3K6SB 5EUOB 1T2XA 4TSAL 1KIRB 4UUJB 1F1DA 2D9QB 2IALB 3VH8A 2NNRA 3KXFE 5HHMD 1U6AH 2EZ0D 3FRUB 4A04A 12E8H 4NZRH 4HUWA 1A6UL 1ACXA 3VNYA 3AQXA 3OKKB 4HV8A 4EN3C 3QRGH 4R26L 1PLGH 1Z5HA 4XMUA 3FB6A 1YYMH 4S0HA 2DIJA 3RKDD 1HEZA 4GBXD 1YEJL 4P2QB 2B2XH 2VYRE 3TBBA 4Y8DC 4Z3HA 1FFPB 1BX2B 1AH1A 5C7XH 4RL9A 2Z3FA 3EDFA 3FT1A 1SXBA 2JB5H 1J9QA 3W0WD 2O6FA 1GMIA 3LSOB 4FFWC 2LLGA 2CNYA 1PL3A 5I1IL 4WWOA 4NC0B 5E9DE 3T0SA 1HSAB 1UD4A 2FZ3A 2IH9A 2VDQB 4PCYA 4DKDC 1FNEA 1B3JA 1MG2C 1GYCA 1E40A 2CIKA 2BXYA 4MNHB 1GOHA 2R1XB 2XCMC 3H8NA 3OKOA 1RZ7L 1DJSA 4XNBA 1BQKA 1L9TA 2WKLA 3OLDA 4RFNC 1HXTA 4K7FB 4UNTA 2ZX8A 5F2FA 2XIIA 2L7EA 3MNVA 3UTSD 4QNPE 3NSJA 5FW6A 3QRFM 1EXHA 4HSQA 2A9NH 3S5LG 2DJSA 5K1JA 1OAXH 3S5ZA 5EF2A 1QI5A 4JB9H 4F8NA 4ODHH 3FTSA 1XR9B 4NQEE 2R4RH 2Z7UA 2J8HA 3D1MC 3V0EA 1M6OB 1OW0C 1TO4A 5CD3A 3KYMA 1IQDB 1PQZA 4MA7H 2IF7A 3PRNA 4J27A 4Z3IA 5IQ9B 2VISB 1NUNB 4MJJA 1UC6A 3NRQA 4R4ND 5C09E 3QNYB 1KOAA 1V27A 2VIRB 1LP9A 1V3MA 3WEBA 5GZOA 1XBRA 1P1ZA 2I69A 3EGSA 3X14A 5BW7A 2EVJA 1IEAA 3QWRA 2MHAB 3UABA 3KDMA 4LFHG 3KM1A 4UZGA 3LK3B 3R0NA 5EA0H 4E0RB 3KXFB 1UADC 4X6DE 2PUQT 3FU6A 1PLGL 1VADB 3NJXA 4LCCB 2WLZA 4U3XA 1J10A 2A9AA 3DUUA 3LZLA 4MD4B 1HXMA 2EVGA 3CPUA 4AW4A 4R84A 2NY3B 4KOBA 2X1OA 4N86A 3RWJA 4F7CB 5FDYA 3GTNA 3QJXA 4W81A 3WLWC 2H6OA 5ANME 5E9DA 1FAKT 2VZOA 5K39B 2HJLA 4XOCA 3HEIB 2Q6WA 4MKTA 2OLDA 2Q5BA 4EUPA 4G70B 4A7SA 2ITEA 5C6TH 5CEYB 1JGLL 2QSCH 3QUXA 5BXFA 2OSLA 3H7BB 4I77H 3UTZA 2K6YA 2IWGA 5CJQH 2R89A 4LKXB 1WS8A 2P5WA 5L9DH 4FQLL 3X11B 2X4TB 3LIZL 1RL1A 1UJ3C 2KLRA 2KYIA 1C9SA 1SY6L 2PW2A 4RMVA 1GS6X 3VM5A 4G3YL 3ZT5A 1AZBA 1SDDB 1KIUB 4NUGH 3O9WD 3BW9A 2NTFA 5I0XA 4GHBA 1E4XL 3MUGA 4GMSH 3U0TB 4IRSD 1YMHA 2P44B 4P0DA 2GE4A 4N5UA 1B2YA 3WIIL 4ZFGH 2AC0A 2PPCA 4EI5D 4ZMXA 3V6BR 4Z76A 3K74B 1NKGA 3RUGE 5JHMA 1VGKB 1DQLL 3C9NA 4KO7A 5B3NA 1YYCA 4LOUD 4IGBB 3SDAD 1X4YA 3P69A 4PJFF 3ZDXF 2VAAB 2LVCA 5J6HB 2Y9RT 4DZ8B 1HWHB 3QYNA 1S7TA 4LLWA 3QQ3B 1GSKA 5AKRA 2AEQL 2WB1A 1U2CA 4PBDA 4DP1X 2CRIA 4OSUH 4R7VA 4Y5YB 5FKAA 5JQ6L 1GZQA 5DZ9A 1E5BA 1QA9A 1JWUA 3EH2A 4LHUG 5HPMB 2ROYA 2VDKB 4AEHL 1G7QB 2AEOA 2HG5B 2YA2A 5LNEA 3WFCL 3U0WL 4HBCL 1ERNA 1IGFH 2JQZA 4JFPB 4KNUA 2ZP0T 1FE8L 3QDME 3H54A 3CG8A 4OIFA 4L4VB 4HLEA 1KGIA 1CK0H 2OTUB 1F41A 4DQOH 3AY4C 4B9YA 2JI2A 5DQDH 4ELKB 4TQ8A 4TUJB 4ODSH 3GBDA 4UM8A 4XXWC 3WUZA 3NGBC 4BK4A 1UM4L 4FYTA 5IVXE 4UOJA 2BCKB 5ISZE 2FQEA 4OUOA 2O5YL 4Y4KB 1FNFA 1NSNL 2ZP8A 4FXGC 3UG4A 5J6GB 2YPKA 1IC7L 2HTKC 1EFXB 4IOFD 4ZOEA 3VXQB 5FLUA 5LB1A 3BGFC 4PJIF 4RQQB 4GRLB 4UM8B 3I6KB 4CADB 1WBXB 1ID2A 1RI8A 4BXVA 4ZRGA 1XZWA 5JA8B 1T5WB 2AJSL 3HFFA 2PCFB 1NIAA 1AI1H 3A6CH 3CHSA 4JRWA 5JHDE 3SYPA 3S37X 4AV5A 1FV1B 2N56A 2NNAB 5EOQH 3OKYA 4HPYH 2OBGA 5DUPH 4EEEA 2I24N 2RQEA 3WXVH 3JTBA 5D6DA 1YJDH 1INQA 1WVZA 2B1AL 4P3CH 3WO3B 1S7SB 3FF8A 4YIQB 3GMMA 5L4MA 3W2DL 4QYOA 4KV5F 4PWJA 3CSYA 2UXTA 1OTSD 1PZAA 2AJVL 4KTDH 2CH8A 1KJVB 1TZIA 4N26A 5E6ID 1U8PA 1PEWA 2DMCA 3GXMA 2F58L 3MYJA 1C16A 1L9PA 1I9JH 1IGYA 2WNWA 3KAAA 4JFPA 4TSCL 3WI9A 1W72H 4D2NA 3EXLA 1IC1A 2HPOA 1OE3A 1SHXA 1HS6A 2G5RA 2G3ZA 3L1OH 1UWEH 2YLKA 1FNGB 2Y7QB 1ZHLB 4YHYB 4OTXL 1EFQA 1S5HB 1IBGH 3PXJA 2Y24A 1YA5A 1XSOA 2XETA 4YFLF 2N59A 2FLMA 3CGTA 3QHTC 4IS6B 4IIZA 4OM0L 2XACC 5D7KD 3PGUA 2Y5QA 1K4DA 1CQKA 2WAQA 1YEKL 2ZWKA 3QR0A 5T3ZH 1RZPA 3ARFC 1DLHB 4DGWC 3GFUA 2EH7H 5IBTL 3D2UA 4DT2A 1NGPH 3MFFB 3MOAL 3BPOC 4J23A 2CLZA 1LDSA 5IWLC 1X9RA 3RKPA 1T80A 2UYLA 1AIZA 3ASWA 3D4GA 1C12A 1NC4A 2GITA 1T89C 3MQIA 4QRRB 1ZIAA 3ATBA 3M8OH 4K3EL 4BKLA 2WWMC 2FGWH 1PJ9A 3BSHA 2ICWJ 5T8IA 4B9ZA 4UQDA 5GRUL 5F1IB 2XWZA 4KO9A 1TFPA 1II4E 4OH2A 1OP5K 4N2FA 4PU2A 1QBLH 2HJLB 3VD9A 1UFUA 5DVMA 3V4PH 2ZOKB 1MFAL 4D0BB 4N25A 5EG6C 1W0YT 3RPKA 1IIKA 5DYOB 1R34A 3NUKA 4A6YL 1A2YA 5AW9B 3OXRB 1ONQA 4KRPB 5EWIH 2Z93A 3R4DA 4L2LA 1NUDA 4I9WD 1U8JA 1NBCA 2RACA 3G3LA 5L2JB 1PMYA 3JWOC 2N7AA 5C8JA 1WUNT 2NQCA 3V9CA 5JOFB 5KW9H 4YK4B 2A0LC 1F8TL 3DHJA 4JQIH 4ONHA 4BFIA 1CLVA 2DOCA 1B88A 1PZCA 5AFAA 3KXFA 2H2SD 4Z18A 1AQDB 4OF3A 4XE0A 2IQ9L 5GRYA 5J6SA 3X17A 3ILQC 3PLYA 5HBBA 4N5EC 4GSDH 4PGDA 1MRDH 3CU1A 4CADA 4F92B 5AZUA 2ZAHA 4UV7H 2XE2A 1OCRB 3B1UA 3T1WA 1GH7A 1NANH 1NCTA 2IG2H 4A7UA 2BZCA 4TV3A 1NWOA 2ICEA 2XKSA 2HFFA 3MCKB 1DQDH 3QJUB 2RFXA 4UOW0 3TA3C 1AGFB 4QXTB 3TL5A 4HPOH 5FGRA 3NABL 3JWNG 3DGGA 2AHIA 4KK5C 4QHKI 4LSTH 4PVNA 4XP4L 5SWZE 5AOLA 1NKOA 3AJ7A 4PRPA 2PRNA 3MJ7A 3WN6A 1CDJA 3FUDA 1JZ2A 2ZIDA 1EVUA 4YSCA 1OCWL 4LU5H 2WVUA 1P7QA 2WXKA 1RSFA 2JELL 4LRIC 1OQOA 2AJ3A 1FAIH 1IE4A 1Y1UA 2YGPA 2WGNB 5CJBA 5DVNA 1C5BH 3ZL4H 5L4FA 3C8DA 4QRTB 3ZE0B 4L0ZA 4K8RD 1IB5A 4YEEA 3DV4B 2XMXA 4NQTA 5E2UH 4PREB 3BP5A 3VMOA 1E6OL 5HD8D 2XYCA 3ZTJG 4HBQA 3L4YA 5C9KA 4DAGH 1AZNA 2EDBA 1WLHA 1AC0A 4WWKC 4YBQC 1EVTC 4HBCH 5A6LA 3O9WB 4ODTH 1D5BB 1UXWA 3G6AA 4M3JA 1YPZB 3LH9A 4S1SH 1G94A 2ZFGA 3FZUD 4FL4B 1M7IA 4KVNL 1EPFA 4HALA 1H8LA 5B7EA 5I1JL 4L18A 43C9B 3L3DA 4RLDA 4X6CA 1EJOH 4AQ8C 4UUJA 2A6KB 1TDQA 4XP1L 1JRHL 2G2RB 4O9HL 2QJDA 2N7SA 3LDBB 3A4AA 3K2KA 1J1XL 3C5ZB 3IDUA 5HVHC 4LCIL 4XOBA 1QFPA 3BGAA 4GI8A 3LQAC 4I8DA 1U8CB 4HS6B 4O9HH 4OF8A 4P23C 3O3BA 4EI6B 1DP0A 4KXDA 4JNXA 1DVUA 3SGJA 4M7JL 4U1GC 5FHBH 5B39B 3RYMA 5IF0B 3NTCH 1LDPH 4APXA 5I15L 3EDEA 2Q86B 1G5GA 3MA7B 2MH4A 3G5ZA 4ZAKA 4XVTH 5TFSL 4QJ4B 3CC5B 4KVNH 4E41A 3ZE1B 3RZCB 2UXGA 3LK41 4OZHE 1SBSL 5FFLA 5IROC 3OJDB 2LAGB 4TVPL 2EDFA 4RLCA 1E4KA 3LV3A 4XOAA 4PS8A 1QUPA 4GRLC 3MRFA 4PG2A 4EXKA 1U3YA 2X28A 1E54A 1S6NA 3CJJA 3F01A 4XN5A 5F8QC 3FO1B 3U36A 3V52L 3ZSTA 4G9DB 2XG4B 4GRWB 8PRNA 1ET5A 3POXA 3PDOA 1JF5A 1TJXA 2GEEA 2KUTA 4NOFA 5B22A 4FXKA 3US9A 4XAKE 4NSKB 4YC2C 2JCCE 1TITA 2I7OA 4NN5C 1EX0A 4ZK8A 1KTDB 2YZ8A 4U4IA 1Z3RA 3DNKA 4D8OA 1BW8A 5MP6L 1IRAY 1YNLH 4PJBB 3QJRB 3VVVA 5JHLH 4JM2A 4ANUA 4R97C 4G8FB 4YGVB 1N0LB 5F9OL 1LE5B 5TQ2H 4D9LH 3FCSA 1SLXA 1HAWA 2A38A 4AYSA 1N6UA 3HE7C 4JW3A 1AIFB 2FO4A 5GGSY 3EHBB 2WSDA 1Q9OA 1UTDA 4V11A 1B90A 3G5ZB 4MCNA 4G6JH 1AQHA 5CS7A 4BA0A 2FHFA 3OF6D 3ROOA 1LNUB 2K8QA 4J6IA 1YUHA 2B77A 3E9TA 2YRZA 1DL7L 3D48R 4GCQA 3LHAA 3OKLB 3BESR 3VGHA 4A39A 5KBLA 5BJTA 4UF7C 2DQTL 5D8JL 4KRAA 1FFRA 4KUCD 4KMTL 4RZCB 5ITFA 1WTGT 3QISA 4QOKA 2VAJA 4BHUA 2WKOA 2XTJE 4GG8B 4OLYL 3FO9A 1PLAA 4MAUL 3IKCB 3WJMB 2J2ZB 3MV9B 4EIGB 1MCRA 4NUJB 4HOZA 3EJZD 3N42B 4LP8A 1UB5B 3FTXA 1T22A 3F8UB 4MGXA 3OAYK 3QIBC 4U6XA 1WP6A 4TN9A 4X6FA 1DVQA 1YMME 4JRXB 2BNQD 1K5NA 2UX6A 1A7NH 2P43B 2AJUL 2DN7A 3EHBD 2JQYA 3L81A 4I0PA 1SOSA 4HD9A 4W9JC 2BNRD 3MYJB 3MSPA 1T20A 4PJCA 3V4PL 1XH0A 3EGDB 1WCQA 4Z7QF 3D3VB 3EMNX 4PGJA 4B96A 2X70B 2VN3A 2AQRA 5HI4D 3VGAB 2R1YB 4U7KA 4X99A 3DSFL 4IRZA 4LLAA 2OJEA 2NT0A 2O4EA 3DBXA 3V6FA 1KXQA 2N4IA 4K9EC 4PRNB 1WHPA 1MVYA 1MY7A 3OG4B 3GP6A 3QZLA 3N85H 4TVPD 3TCTA 3RPIA 4OQTL 2ADGB 3Q2NA 4ABVA 3TC9A 3O41A 5B1CA 3DBXB 2GBAA 4DJMA 3GSXB 1WBXA 2OMXA 5E99H 3MCYA 4FNQA 4KKZA 5T3ZE 4XBGB 3E0GA 5GGRB 5LKNA 1ROCA 1IGTA 3WSQH 5TPWH 1YNTF 1H6TA 2ZP9A 3A6BL 3MZGB 4JM4H 3GJEA 5T33L 3P77B 3RL1A 3O9WA 4UQCA 2OX5B 1TSHA 5I8OL 3QDJA 4IRSB 3QS3A 3BKYH 3T3MB 1S7VA 4P23A 4PJDA 1A4KA 4PJHF 5AEAA 3MGAA 4ZQKB 4BRJA 2FUQA 4X8GA 1JGUH 4GS7C 1OAKH 2AK1H 3KLSA 4BSVA 2AKRA 4X4XA 3U25A 5IQ7H 3RWDA 1MCIA 1HL9A 5JYMA 2IQAB 3V6ZB 1E5YA 1FFNA 2FGQX 5CILH 5BS0E 5FO8A 4QGTA 1P0SE 5C6PB 1L0YA 2MFNA 4HPYL 5AB1A 2CO6A 3DYOA 3FTGA 4JFHD 4X2UA 5LN4A 1JYWA 2IANA 5C1MB 3FONA 3QUMA 1IGML 2AMGA 2BIIA 3W81A 5EE2A 2GAZA 3UGEA 4JFDE 1VGKA 2K3HA 1SPDA 2J8UF 4XCEA 3H2QA 4LIQH 5C0EB 3WHXB 1TTRA 3FTVA 4I0PC 1KT2A 2QSTA 4P3WA 4C4KO 5GGQH 5B1AB 1Q1JH 5CJ5A 1AYRA 5JQ6H 2MQCA 4HJ0D 5T5FH 1F56A 3D85A 3RL2A 4F2EA 4OZFH 2V2WB 5D1QA 4ORGB 1YQVH 3PWPE 2D3NA 5EN3A 8PAZA 1ZGLP 1GZHC 5I1LA 1NOLA 3I6LE 4YH6A 3C87A 4J8QA 5AG8A 2HUEA 1A6WH 3KLLA 2LHFA 4QAMB 5J7CC 9PCYA 3PUUA 1AY1L 3HE7A 4P5RA 3O2WH 3UEZA 1HJCA 2MCG1 4CA4A 5DD3L 1QHPA 3ZT6A 1QUNB 2BFGA 3P3YA 2OYLA 1K4DB 2ZYRA 2DQDL 2Z93B 2X5PA 5T1DH 4PB9L 3KPRB 2HYMA 3ZE0F 2V9QA 3L9EA 2XZAL 4CC4A 5DD0H 3TN0C 1J8HA 4JREB 4Z7OE 1NCUA 5D7KE 5F7LB 4F5CA 5B8CA 1FH5H 3KPMA 4UU9B 5F0LB 1W0WB 4XN8A 4H8WC 1XF4A 1SOKA 4ZFGL 4E36A 2VR9A 4BEIA 2Q7AA 5EC2B 1PGRB 4P5KA 2B7DT 3EBHA 4Z7UE 4CN1A 5MENA 3D87B 3ULVH 1FL5A 4J3VA 3KPPA 4KDTA 4FZEH 4YO0B 3BH8B 3EJSA 4ETYA 5HI5C 3T3PF 3OAWA 1IKNA 3N40F 1A66A 2XTJC 3QPKA 1FGNH 3DJZA 1WWBX 4M8VA 3K6DA 4JEGB 3S8WA 4JO4L 1RUQL 2W80C 1I7UA 4N74A 5JORA 3CDGA 2PCFA 3EBIA 1UD8A 4W9IC 1AKJB 2G75A 3L2LA 3FSAA 1URLA 2G2RA 2HH0H 4R97B 1CFSB 4HCRH 3SN6N 1GYUA 4HXBL 5SWQB 2UX7A 2W65A 1R9FA 5J1AA 1BLIA 3NYKA 1PZUB 4JY4A 4D9RE 3RX5A 3MNWB 3MNVB 4N3UA 3P4MB 2TRYA 1ZK5A 3AZUA 1AHWA 1R3HB 2QTKA 1G9NH 3GHEH 1AO7E 1HCZA 2BWIA 4QTHA 1A6VL 3D52A 3IBOA 5KOMC 3HI6L 3B8SA 4DK3A 3IJ9A 3RZCC 4L3EE 2PCPB 1DBBL 3F3HA 2IQAA 3PNWB 1XF4B 4F57L 3VY9X 1SM3L 5JHDB 4JDZA 4D9RD 4YHZL 3S8GB 1XMEB 4RFOL 5DMJB 1EEUA 3PFUA 3RA7L 2YK1H 1P7KB 5DEGA 3IWUA 4LCVA 2DY2A 3FT2B 1EHLH 1NCWL 1HQRA 1QOKA 3DXAE 2UZIL 4RSVA 1BD2E 5DJAA 1YO4A 4JN1L 4Z7OB 2DYPA 3CVHB 1VPOL 3GK8L 1PW3A 2ICES 2EDQA 3HHMA 3QO1B 2ZUYA 3CQPA 4DKFL 1DBAL 2WIIB 5JYLA 4OV5B 1FDLL 1DVZA 4BH7B 4J3XA 1KGWA 4MCMA 4QRQB 1HZLA 3O8XA 3FFCB 4KKLC 1RZKH 1M9SA 4O00A 2GYSA 2R0KH 3WU1A 4WVRA 5JXAH 2G9HB 3QXAB 1U42A 4HS3B 3QDGA 2VUOA 4PRPD 4UT7H 3HUJA 4QIRA 1E4XI 1N5YL 2VLJE 4ES9A 2ODIA 3GI9H 5FM4A 4FP8L 1S9YA 4ZUVB 1WAPA 3DTUB 1OPFA 5E8DL 1Z7JA 1HCFX 3IVKB 4RFEA 4KJQD 4XP6H 2R51A 4QTIH 4DZBB 4GG6F 1GTFA 1X3DA 1A7BA 2GIXA 3B8YA 4DP6X 1XL6A 4G6FB 5TDOA 5HTSA 1A1MA 4WO4B 3Q05A 1HHIB 1EHXA 3MV7E 1BWWA 2GK0A 4EUPH 3T4YB 3OZKA 3FCGA 3FOMA 3KPOB 1KN4L 4N9GA 4Q74A 3MGTA 5G4OA 5D2LF 3R4RA 3U48A 1FQ9C 1Q38A 3CHRA 1TOXA 5LAXB 4UU9A 3MBEA 5BQ7B 2EH8H 5I8KL 1BLNB 1IJNA 4YXKH 3BIKA 4LF3B 4L4JA 4XNMB 2CBTA 5C0FB 1T6WA 1UA6H 1BXXA 4WEBL 3QUGA 5H37H 4YXLL 5ITBL 2CXKA 1TNMA 4JG0L 2EEXA 3QIWC 4QXVA 4KK5D 1CD9B 3WJJC 2E3VA 4RMTA 5KVMC 1KF9B 1H3GA 1ZHZA 3AS1A 4ZAKD 4URTB 1OM3L 1FGNL 3DIVA 2MPAL 3V0IA 3SDAB 1WBZA 3A0BO 1HNYA 2J1XA 4A7GF 5IESL 1ROWA 4PRIE 3VA2C 4X42A 2PETA 3BSZL 1Z9LA 3ULAB 3IDNA 4DEPB 3L8QA 5DFAA 1JZ3A 4L1HA 1MPAH 1MWAB 3Q2WA 4LPYA 2XE5A 4V33A 1BAFL 3N1PC 3TONA 3IGFA 5IB2A 1FA4A 2NQ3A 4FNPA 2E6QA 4HH9A 1FZMA 4NRZA 4PLJD 4W4OA 5AZEH 3DXAB 3CFDA 4DP7X 4BSWB 2F1VA 1NLDH 2CCLA 3BLKA 1QKZH 1UWGL 4L1LA 3ARPA 1G5AA 3LPFA 5LNGA 3H2WA 5EU7C 5BOPA 5JPMB 2ZTBA 1OCZB 2WINA 2YJLA 2YS4A 5GSVB 1SMDA 3MRPA 3FFCE 3TCLA 5E95B 2YHGA 3SE9H 5F1NA 1FBIH 5IYUA 1JV5B 2R8AA 1TJMA 3O2WL 3GUTB 1BF2A 1T5XA 2DQCH 5DEGB 2IV8A 3NEEA 5MENE 5J9PA 5CNHA 5EBWB 2H0EA 1BH3A 2CJUH 3IPFA 4M5ZL 1YG9A 1QSEB 3B7TA 2UWEF 1NFIA 1ZSDB 3CSFA 3QJTB 5DU7A 2OK0L 1CR9L 3MNZA 4PJAE 4F5CE 4FFYA 2WVSA 2VERA 2VR4A 1PG7L 3T0AA 2HJKA 4APQC 4YIQA 1CD1B 1QPXA 4JCHA 4LSVH 3Q8CA 4N3TA 4GMSL 3E3QE 3O2VL 4JFOB 4OZFG 3ZMNA 1ZDSA 1EMTH 1XIWD 1NCAL 2ITFA 4HUXA 4P4KC 3KVDD 1IZNB 2MPAH 1Z9SA 3BVTA 4HX1A 4OZHA 2AXFB 2VDPB 2ZOTA 1CGUA 1RUPL 3JWOL 5I1JH 4PRHE 1FZOA 4JKNA 5ADOH 5HYQB 1JHLH 4JM0A 3G9AB 4NAMA 4AZ8A 5I5IA 3EF7A 2NY1B 2FNWA 1JDAA 2HKFH 3KHOA 5DD5L 3BHBB 2X3AA 1IAKB 4YZFF 4Y4HC 3TNMA 1YEDA 2CGRH 1E6OH 4YPJA 2WUBL 1GA2A 1T2QL 2JB6A 1CFQB 1KN2L 1YHPA 2YRLA 1OAZH 5ANMA 2ARWA 4PJEE 5J4MA 1NEPA 1K6QH 2Y23A 3FHQA 3Q0HA 4KC3B 3TJPA 3WL9B 4X6CE 3THML 2W9EH 4XAKD 3FT3B 3WN5B 1PSKL 4OQTA 1U2YA 3MRGA 3U2SA 4K5MA 1U8OB 4ZUTA 2Z7YA 4FNLL 1ZT7A 3LEVL 4Y5YA 1AOZA 4P2RB 4X4KA 2WJ5A 2H26A 1OO2A 5EIIA 3NH7L 1QPPA 1HEHC 1JD7A 2CDGA 4GW1B 2BY1A 4LB8A 2C7UA 4Q7DA 3REVB 2JTYA 2J12B 3RIFK 3QXUA 1XF2B 1L5GB 5H37G 4WI4A 4HWNA 4KKQA 3EH5B 1QG3A 4EN2A 2C9QA 3VDAA 1JFQH 2ZCLH 4YSUA 3UFIA 4K94C 4UT6H 4HK0B 3ES6A 5F6IC 3U36B 5A7EA 4BINA 1RURH 4KQ0A 1QHOA 3CDFA 1RZFH 1DJGA 3E38A 3QUHA 4MJIE 1EBAA 1JIBA 3TZVD 1AR2A 1NFKA 1E6JL 2PR4L 4F33B 2VO8A 3T0ED 2GY5A 3VXRB 1UVQB 4XCEB 1PY4A 4H0HB 2C9SA 5IOPA 5EZLA 1YMMA 1SY6A 2ZOOA 1PAMA 3F5WB 5D55A 4YHPA 1UACL 4LLQB 3P4OB 5DRNB 2HP4A 4WU5A 3UJTL 5CD5C 3RWGA 3MCKA 1KZYA 4ZW6A 5F7YC 3BAEL 3O3BB 1UYWL 4KMQA 1BQSA 4Y7OC 3COOA 3SYOA 4KK8C 1KEGL 4Z7NF 5DF0A 4ILDA 2XBDA 4YGVA 3RWDB 3KLAB 1S78D 4NT6B 4UAOB 2HPTA 4BELD 4X8CA 3GRWA 1J87A 2Z7ZA 1URZA 3S4SG 5FEBA 3C6LD 3HBPA 3QUXD 3MACH 3K3QA 3MLRL 3UP1A 2CDFB 3HMXH 4JRYE 3UC2A 2NY2D 3L3KA 5E8EA 2R4LA 4K8RL 1CCZA 1N3NA 2WLNA 3FYEB 4J4PA 4M8QA 4L2YA 4NM8L 4WI6A 4DF9A 1BFSA 3WKNA 4HS8L 1OD9A 1UJ3B 3O6FA 5CP3A 3V6OE 5IM7B 3T6WA 4PGEB 2HVBA 4YDJB 3O6MH 1A9BB 4U1MB 3NJKA 3CZFB 4EMZA 1RVFH 4LSQH 2J4UP 5I19L 3POQA 4K3CA 2YFNA 5CZVH 4KNTA 5HYSB 1PZ3A 2KZ7B 3MI6A 3ARBA 3H9SB 5DD6B 4UQ3B 1YRKA 1YMMB 3RFZC 5E1HB 4MNQA 5AENA 4R4FL 5IHZA 3SSGA 4HIXL 2XKNA 1SN5A 2H45A 5GZOD 2ENSA 2HWZH 2XZAH 4X8JA 1OAUL 1KENH 5JQHC 4AJYV 2PYFA 1KEGH 4WV1C 1MZYA 1R24B 5DUMH 4A2LA 5E0FA 1C12B 4AW7A 4Z0BL 3O4LA 4C00A 2EE2A 4HIJB 4XT1C 1IMHC 4KUCF 3KPNA 2F5BL 4QKXB 1LK3H 4P2OD 2AQQA 1A7PH 3MJ9L 3OHXB 5H94A 2GI0A 1PZSA 5HI3C 4D5UA 5GRXG 3U9PH 1F2XK 4IBZA 2CPCA 1ZHWA 1XF2A 4FQEA 2GTZB 3E6FB 2X6VA 3R06B 4LNRA 4TNFA 3HZVA 2AANA 4L8BA 4GCPA 3VXUA 3VDCA 2H47C 4PH8A 3BPNB 4GW1A 1N3NB 4JFXB 3WFHB 5JPMC 2P8MB 3OKEA 3TA3D 3I9IA 2BH0A 1HX0A 2G4EA 5CN1A 4KJPC 1BZ9B 4WFHE 1YN6A 1SLVA 5EOCJ 4A2MA 2Y06H 3OGCA 3AA6B 3VXUB 1UWXH 5F89A 2V2TB 4MQXC 2KI6A 2FR4B 3VI4F 2AJ3B 5LVEA 5AVTB 5KTEL 4Z7UA 4M5TA 4Z7WE 4PI2A 2BNUB 3UACA 3CZSA 1JZJA 1SZNA 2WCPA 3R7QA 1ZSDA 3CVHL 5HHNA 3FHAA 3MJ9A 3L7EB 3V4PB 5IIEA 4HC1L 1E3ZA 1HCYA 3RHWF 4JPIA 2AXGA 1VEMA 3ZJAA 3KH3A 4K2UL 1QVOB 2JJVA 3B7RL 4AI7A 2Y7SA 5D7IF 3EO0A 3CDYA 4G6JL 4XP5H 1KGYE 3RHWK 5HDQH 3FQRA 4XVJL 3H9SE 5GTIO 2KMWA 4NDMA 4QLRA 3DYPA 1EAJA 4LHUA 1FGVL 3GSVB 3K5RA 5JHLL 3QJHA 4H8HA 3GSNB 4LCUB 4QXUH 4IBWA 2B15A 2X9ZA 3CH1B 4RZKA 2BCKA 2DQUL 3H85A 2VR8A 5IQMA 1UCBL 2X4NA 1L5GA 4ZBJA 1A1NA 3ULSB 3RU8L 4M61B 3VRJA 2KL6A 1KDIA 3T65A 3M45A 1FO0B 1SFDA 2UY7B 1QNZH 1KPRB 3NJNA 4HHAB 4M29A 3K2MC 5DWUL 1FL5B 2ZPKL 4YO0A 4AX3A 5IB5A 5L2KB 3DX9B 2BDNL 4U1IA 4WGVB 3X3GL 1CMOA 2P3YA 3OPZH 3ZTNL 4Y9EA 4FLHA 3C5JA 5I9QC 5CMAB 3ARFB 5HHXH 2BVTA 2R0WH 2EDNA 4LSEA 3ISRA 4NWTH 1IC4H 1M3IA 4LESA 4XNMA 1QA9B 3CK0H 2YFOA 1RVFL 2F1AA 2M1KA 1U3HB 3BP6B 4GNKB 2HKAA 3FK3A 4HA1A 3LKOB 2W9EL 2X4PB 4N85A 3L1GA 3ZE2F 2YEVB 4N4YB 2X38A 4JLRA 1WA1X 2BSTB 4HIIB 1GGIL 3QXVA 4YHPB 3C60B 4KXZH 1H6S1 1DQJB 3ZHFA 4NUPA 3UCQA 1BD2B 2ZONA 4S1DC 1NCOA 1WITA 2VLKE 4ZSOB 3RKDC 1DBML 1YEHH 5DZPA 3DIFB 1LHZA 1JPFA 2AI0L 2QPUA 4MMYA 1OT2A 1ADWA 5I8CA 1BZQK 2IFGA 4PRAA 1GFNA 2XN9D 3SPIA 1A6AA 1QEWA 5DSCA 1QD0A 3PGFH 4MJHA 1BQHA 1U8NA 2FWOA 3FB8A 4EDXA 1VEPA 1OT1A 2FT8A 3VTTA 4N1CA 3US1A 2XY2A 1S3RA 2CA3A 4DUXA 3RFZA 4AYID 1EGJL 4G8AC 3ARWA 4Q0XL 4OJYA 1J12A 4LE8A 5DJAB 4GBXA 4AH2B 4Z23A 2YPLE 3IJYB 4N2OA 1DEEA 1AXSA 3D51A 4JB9L 1BFVL 3O6KH 5KSVA 3HC2A 4QRPD 1MH5A 1ZLVK 2JH2A 4RGOH 2ETWA 5D4JA 1ZK9A 3APDA 3EAKA 5DR5H 5AOJA 4J3OH 5FOBB 5FYLL 1LD9A 4NO5B 3PHQB 2VLJA 1S7SA 2XXCB 4H88L 4MMZC 3WFEL 2CCVA 1U92A 5DUBB 3WFBL 3AA7A 2V5TA 2XWCA 4W1TA 3MRCB 5DD1L 4NBXB 4QQ1A 1IZJA 1KJVA 1IBGL 2YRBA 2BERA 2GJ6B 1EDQA 5EIVA 1BM7A 1CYGA 2UXVA 1XH3A 1A4KB 3TBVB 3BZEA 1SXCA 2YA1A 1IAII 2WINB 5CJXA 4R6UA 1L6XA 2PYED 2BZ7A 1NDTA 4AC2A 4GW4B 5LNDA 1NGQL 3D2UD 5C3LD 2HTLC 3CH1A 2XOTA 4J1UA 2BIOA 3GHBL 2OCCB 4RRPG 4YUEL 1N4XL 4RWHA 5AAMA 1LGVA 3KYMB 1DQDL 5CGBA 4OZIE 2AQ2A 4M7KL 2DQGH 3EYOB 1FGVH 1MCOH 4UNVA 4F1SA 4CGTA 4KJYB 1B2WH 1GS8A 2R27A 1XGQB 2A6JB 3AB0B 5IFJA 3TVMA 2V37A 3PWVB 2APVA 3D33A 3QJVB 3MJGX 3RAJL 3GSQB 2EE3A 4EI5C 1R33A 1QPKA 2NUTB 3J27A 3DKHA 4M1DH 1ZEAH 3WXVL 2DLGA 4FQQA 3VWKA 5D9SA 3FH8A 4ZDHB 1RUQH 3DVFA 3Q8AA 5DRWA 3BH8A 1U8KA 4EE2A 4MNHA 4KRMB 2E7DA 4L4VA 1X5MA 2HKFL 2Q3AA 1AG0A 4PRHD 3TO4B 4FFYL 1HSAA 2FZ3B 5KAQG 4L3CB 3CDCA 3HS8A 2C4FT 1X9QA 4QTHB 5BCAA 5KSAA 5E9DB 4ALAC 1XIWB 4X50A 1MPFA 1AZCA 3BT2L 3LQZB 3WD5L 2B5IB 4DUVA 3BVDB 2ROXA 2J5WA 4OT1L 3UPRA 3SE6A 1XVSA 5TDOB 3DUHA 1EBPA 4OLUH 2BY2A 3ARDA 1SXZA 3U4AA 3OKEB 3E80A 5EU5A 4FP8H 3NCJL 4IKIA 3PWUB 1BA9A 3H9SD 3NZ8B 1G6RL 5GRUH 2BIQA 3P0YH 3PG2A 4WTXA 1QSED 3FOLB 1ETA1 2ZOWA 5DRXA 2EYTB 2F9BT 2X1QA 2VLME 1G6RB 3BW9B 5KS9F 4XOEA 2AEQH 1O9WA 2OK0H 4G2AA 1SDDA 1IIIA 4EIUA 3MLSL 2XWBA 3F6JA 2FL5A 3CHXA 4LRNL 3STZA 2EKJA 5E2UL 1IQDA 3HN5A 2FJFB 7FABL 4CVXA 4OGAC 4BHUI 1TQCC 2VKWA 4NQUA 2VSCA 4KKCC 2X7LA 5CWSA 4LPUA 4NKOB 5J3HD 4JANB 5DUML 1NCWH 4R83A 3V4LA 2CLVB 1JPEA 4MXVF 3WAKA 2FSDA 3MROA 4N8UA 3G6JF 1HIML 1Z5LB 1HL8A 1QI3A 1Z0MA 2AP2A 3EO0B 4H4NA 4MD0B 2F54E 4GG6B 4JFYA 2JKRM 2XG6A 3S5LB 3VYOA 3DX4A 1PX3A 4GIOA 3FFDB 5JIPA 2X6UA 1AGCB 1BDYA 3FTYA 5AB0A 4B9IA 5DO2D 4O4YH 3DX6A 4HZ1A 4N0CC 1VKXB 4TNVK 4R7DB 5FIEA 3GZPA 4KK9C 3HN8A 5C0BA 2E76C 1O9VA 5IM7A 3P4LA 4QO1A 1K6QL 5DL6A 5T1KB 4EI5A 4QXUL 4A55A 3QK0A 2C3VA 2H7WA 5JIKA 1BPVA 1PQZB 2EXYD 4DPAX 4DCQB 1ZTXL 3FB6B 4U1KA 1O6SA 3JWDC 1ZT4B 5FGCE 4ICXA 5EDXA 1RP9A 3E8VA 4PRBB 4YNYA 1LMIA 3G7GA 3G5WA 1ZTXH 4DW2L 1UT9A 1HNFA 5IZ7A 5DC2A 1CLYL 1I7ZB 3ZYJA 1VAHA 1QZ1A 1UXSB 1WFMA 4Z95L 4Z7AA 1A7OL 1LDPL 2NSQA 4BFRA 2LLLA 2WTRA 3C6LC 3FN0H 1GS7A 3H4FA 1FVDA 2XVBA 5B1BB 1RZIB 4C56B 2JK5A 3FUFA 5I23A 2TRHA 4G8GB 4J8RA 2CNZA 2QKSA 4UTAL 4HJGB 2WCSA 5D7LD 2H9GB 3FU7B 3AA0A 3NCYS 3TZVB 2X41A 4RCAA 4EDWL 1WA2X 3TS8A 2IIJA 2P47B 2VDPH 2Z35B 4O02H 2OMBA 5C70A 2X53A 1MQ8A 5T5NF 4HUNB 1MFUA 3CFEB 4KK9D 5FW8A 3E1F1 2CBMA 4OLWH 1E9QA 4R90H 3CFBA 2V4LA 2P8LB 4JUTA 4QWWD 1OP3K 3WXWL 3GT6A 4F15C 4OZHB 5DR5L 2F54B 1PY0A 4GG6E 2VWEC 1OGSA 1Y6KR 4P2QD 1KCSH 1NAML 2F08A 2K4WA 4YBLC 4EZLA 3E6HB 2D2CC 1R3HA 2YOCA 1NAMB 1FORL 2R2EA 1BX2A 3NVQA 1LK3L 3TTSA 4ENED 4U2YA 1DFBL 5EU6B 5L0QB 1TR7A 2EXWD 1VIWA 2R83A 1UB5A 4YSAA 3FQTA 5KVFL 5IROD 3VG0L 5ADXL 4X98A 4XBGA 1PYWA 4PLKC 2W94A 3ZL1A 1HHHB 2VDPL 2J1YA 2ZZUT 2EIEA 2J6EH 2QPFA 3D85B 2HMID 1T1YB 4IU3A 3LNFA 2CRMA 1MAJA 2K6ZA 1P4LB 1C5DA 5D2NB 4ATTA 4X4YB 3WL9A 4HEPA 2NUPA 4Z7NE 4LNVA 2MQ3A 1Q9WB 3PIQB 4CJ1A 3BEWA 2BP0B 4ZFZA 2CK2A 3RVWD 2R1YA 4X99B 1JNLL 3MX0B 3T1FA 5C7XL 4WFEE 4PRIB 1R3IL 2HRPH 4PLOB 2QHRL 1JVOA 5KN5B 1TMQA 1NA8A 2YPVA 1IAKA 2ICEB 2I26N 5CILL 3RILA 5TDNA 3GIVB 4N58A 4WI0B 2AV1A 4LQ1A 5BRZD 2EADA 4WTWA 1YEFH 4UOQA 3IMRA 1C7SA 3N0PB 1MAKA 5HYQA 3CXFA 5AAPA 3V10A 1MJ7H 3BKCL 4YZWA 1LEGA 1NFDB 2WZAA 3MV8B 4OCYH 4W70A 3INOA 4YE0A 1N10A 2F68X 2BSED 3QS2A 3NT0A 3QZPA 3SO3C 3VZTX 4Q6IA 4AGPA 3NIFE 3CFNA 4FQIH 4WGWB 1KV7A 1JYVA 1WS7A 3OX8B 4RMBA 4QJ5B 4GXFA 5FM5O 2WZPD 4O2CA 4UNUA 3SODB 4NSKA 2Y1VA 4Z5RB 3MV9E 3GI9L 4IRSA 5C92A 1CFBA 3WTUA 3GI8H 3RBHA 2AFNA 4CNIA 3MNZB 4R2GB 4MB4A 3D69B 4BE6A 3O8XC 2YPVL 4Q6IB 4DFHA 4DESA 1H6EA 1O7VA 2DQUH 2HT4D 3L4WA 3MGTB 4BZYA 1KB5H 5C0RH 4LHUB 3GINA 1EWHA 5JOPD 1LK2B 1XAUA 1N8ZB 4NHCL 1M57B 2DLFL 2P4AB 2WQAA 4RBPK 2WVTA 1PX4A 3G6JA 4A63A 1F4HA 3ESOA 1IAIL 2KZBA 2NNFA 3ISWA 5KJ4A 3P2TA 4CC0A 4DVBB 1I4FB 3X2QB 3BZDA 5F21B 1JF6A 2HUHA 5LBSH 4MDRA 3VE1A 4G43B 2FATL 5GS1A 2A9NL 5JMRA 4F58H 4KAQL 1R5VA 5I5MA 1MRFH 4MMZA 4XVTL 1SQMA 2R29L 1XGUB 5B39A 3FTGB 5IMKB 4WHYG 2B39A 4G42B 3RI5F 3MXWL 1L3WA 3TNMB 1HYSC 1R3LB 4KV5E 4ODWA 3ILQD 1TVBB 1MJUH 1JDDA 5I73C 1ETZB 2ZUQB 2MKWA 3V8OA 3CSGA 3LSOA 2G2NA 1NAMA 4HJUA 1AE6H 2XZZA 1MPAL 4OM1H 4H20H 1Z9MA 2Y5TB 1J1XH 3OLIA 4KZEH 3AG2B 3LOWA 3OX8A 1W9XA 3L9RA 4HSAC 3PL6B 1MWAH 2BIHA 4Y8AA 1TQBC 3WNPA 1DQML 4F7TA 1CT8B 1M7IB 1EIBA 1MCHA 1UWFA 1MCSA 4LLUB 1M7XA 1WWCA 5AVYB 2GTQA 4LF3A 1MRCH 3RWEA 4Q2ZB 1M1SA 1OARH 3OR7B 1I1AA 1U58B 4B9GA 4CAGA 4UANA 3RWHA 3MV9D 2NR6C 3F7KA 1YEIL 1N64L 1XCXA 3MV01 2AV7A 2VDRH 2XN1A 4P9HH 3T4AA 1NFIB 1ZPUA 3VMNA 5CFAA 3NA9L 2X4SA 1G0XA 1ZVSB 2N7BA 4WNQB 2XYBA 4P9HL 4DW2H 2R0LL 4BZ2A 3VFTA 4ERSH 4RX4D 2IDSA 4DEUA 1GFMA 4PJAA 2R1WB 4EI6A 3BKJH 5LAPA 5T5NG 3HLAB 4K4KA 1R6VA 4ZFOB 2NTSP 5KJRL 1RJZA 2NMSA 3UTQA 5T1MA 2FBOJ 4QRRD 4UQ3A 5EU3B 2FHCA 2DQFA 3QNZA 4BIKA 1IC7H 1V8HA 2E59A 1R3JA 1OP5H 4NZUL 4HJ1A 3AXLA 4L9LC 4XNQB 2ZCZA 1KDJA 5EBMA 2VQUA 3D06A 1AS7A 1AE6L 4GKZB 4YDJA 3G6AB 1HIMH 3ZE0E 2M2DA 2AQNA 1NDMA 4PUBL 3EJJX 5FHAH 1KLFA 1CPUA 2N0KA 4PJDE 2JKTM 4OQTH 2BHUA 5E4IA 3ASOB 3NCWA 5HJ3A 2VSKB 2IWFA 4HFWB 1EEQA 2DI8A 1N6QH 3MKKA 2OMUB 5ANHA 4FNRA 5E6IC 3MV9A 4LEEA 4I1PA 5HYJD 2P80D 4N8VB 5E7FA 4N2EA 4YFLI 3FTWA 1Q9LB 4YHZH 4JQVC 1ONQB 3RQ3A 4ZUUA 5GGTH 2EKSB 3KPRA 1SMAA 4HEPG 2BVPB 1KIQA 2DI7A 5E56A 1RFDH 2XTSA 3MRNA 4OUUB 1WYJA 4GAAA 4TUKL 2YZ1A 3T0VA 4PRIA 4WRLA 3UDWA 1LEIA 3ROOB 5FGBA 4GXUN 5I75B 5IF0A 5D7SH 4YHYC 1BJ1H 1GW6A 1S5LO 1D7FA 1A4JA 2P5WE 2VRQA 5KYWA 1K8DB 1TENA 1F3RB 1HL5A 5A2LH 1CGXA 2F54D 4PRBA 3ZY7A 2I60L 2E4TA 2ZJSL 3AG3B 1P4IH 3QJFB 4LSRL 4K3EH 4ODUB 5JLZA 5FK9A 2EIMB 2D9CA 3ZT7A 1TZAA 4YSRA 4K7PH 2HCZX 3VWJA 3EDJA 4ZSOA 3CXHK 4U1HA 1DJYA 1M2VA 2EXSA 4M5YL 2XLLA 1DQJA 1Q9GA 1G7PB 4OJAA 4PJCF 3GMRB 3FO2A 1HZHH 2P1YA 2PTVA 5CEYA 1A8ZA 1TYEB 1ZA6B 2IBZY 2CO6B 3O3EB 4PD4J 2OYKA 5LWYH 3IM1A 4P4KD 5EIIB 3CFMA 2MNHA 1J9RA 2H41A 4O4XA 4TYUA 2W07A 2Z34A 3NN8B 5TE4L 1I8MA 4KHXL 2GPZA 5DMKA 5E94B 4U4BA 3CFEA 3W3BA 5GRVL 4HULB 3QBTB 3U4KA 2N0MA 3P73B 4MS8C 2DDQL 1VFMA 3LKNA 2VLJD 3GMQB 2PW1B 1GGYA 2YAMA 1MCBA 4KPHH 2RHEA 3EZJB 3B9DA 1F4YH 4H2AA 3ELQA 2JCCF 3VD2A 4BQ6A 4YOKA 2VDLH 4GKNA 3FQUA 2WLLB 3PHSA 4MQTB 1H8NA 3CV5A 1SVCP 3L5HA 2VCOA 2ESVB 2JQAA 1L9MA 3KWXA 5GZOC 1FV1A 1UXLA 4GMTH 1I85A 4ORGA 1Q0EA 4NERA 1JV2A 1IGTB 2XJKA 1OE1A 3L08A 1HSBA 1E2WA 2VM3A 3FU8A 4X5QA 3LKPA 3GPEA 3GBNL 3LD8B 1DJWA 4FXLA 4BJLA 2OMZA 2HT3D 1RJLA 4MA1B 5BZDB 2XTQA 4TL5A 2ARJQ 2CIIA 1OVZA 2V33A 4NCC2 4PS4H 1HHJA 5I30L 4N2KA 1XH3B 1IZNA 3CZEA 3GXIA 1OE2A 5C0GA 5JHBA 1AHMA 1E8YA 4BZ2L 3WOVA 1LM8V 1X9LA 2B9BA 4JZJC 3NK4A 1CIDA 4WHTA 3UPRB 4GQRA 3VQ2C 3MCLL 2O26U 1ZJBA 3AXHA 2VLJB 3IFPA 4KY1H 1ZANL 1G84A 1UM4H 1ZVSA 3QUXC 1HOEA 1OZUA 2QQNH 2ZX7A 3BXNA 4PJ9D 2Y36H 4RIRA 2ZXDA 3HOEA 2WTOA 4Y1AD 3T2NH 3NBNA 5ICUA 1EGJA 4WW1A 3SEPA 4YDLC 1N7MH 2YGNA 2HT4C 3PGFL 1J9TA 3I6LD 2AJZB 4AQOA 2OMYA 3B9VA 4KX7A 3KPRE 4P2QA 2W0FB 4BK5C 4F7TB 2P8MA 5F1IA 3BD3A 2ZYHA 1BQHB 1U8NB 4OIBA 4EDXB 4R8WL 3VUAA 2CD0A 3JUYA 3T5WA 1GPOH 5BMFL 4KJYA 3ZVVA 4FL4C 3IKCA 4WU7B 3FMGL 1AGFA 1JUFB 2F7QA 2G3NA 4JG5A 3MOAH 5T1JA 1P6WA 4AY0A 1MFMA 2R29A 2PNDA 3HVNA 3KLDA 5CHNB 3IETB 1CZ8L 4ZPVB 3RB5A 2F8XC 4NCDA 5K9JL 1CYWA 3P0VH 4LHUD 4CC4C 3CK0L 4MJ6A 1RERA 3OXSA 5AVZB 4JFVA 4XBPA 4F1ZA 2GJ6A 4QHUB 5AW8B 5ALCH 3ILPA 2ATKB 5FGBC 5ICZA 2Q76B 4FJ6A 3DRTA 2H6UA 3ARZA 4Y1SA 3JBG7 3T8MA 2E6PA 3IRPX 4PWKA 3IGAA 5AW6B 3VXSD 5EEVA 3ETBF 3AACA 1MW2A 5F1KC 2OTWB 2DQDH 3FJTA 2V2XA 1Z9PA 4RAVB 1U3HD 2HJFA 4N9OB 5HDQL 2YEZA 2O72A 1N7ML 1JTOA 4PCSA 2AZAA 2QQLL 5DRWB 2VITA 1FO0A 2UY7A 4ADIA 2Y0HA 3DSNB 5DQ9A 2CBOA 5IGXH 5CCGE 1G6VK 1E50A 1QATA 3BI9X 3K2UH 1IAOB 2QTVA 3A6CL 3ISYA 1U30A 4CU7A 5DMIL 1E5CA 1BVNT 1E4WL 1G7JA 3OSVA 4GH7B 3RDJA 1PCXA 4OGXL 3M17B 1CU4L 4PJGE 4RX4A 3QDGB 2EIDA 5EA0L 4I0KA 5I1GL 4Z7VA 3MJWA 1FPTL 3IN2A 3MV7A 2C3HA 4NO0A 5DC4B 1PAZA 5GJTH 5DK2A 4E5XG 2GUOA 3CMGA 4HIPA 4WQOA 5I1AA 1IEBA 1IGIL 4DUWA 3SQBB 2D7OA 3HG4A 2E9IA 1J18A 3CIQA 4N68A 5C0DB 3QUYC 2CUMA 2ED8A 3BS0A 5CCHE 1X4XA 3N43B 4S1QH 5JHDD 2ZD0A 4YJZL 3CZGA 2WBJB 1EEZA 4N22A 3QQ9D 4OZFB 3V4UH 4UQBA 4FFVC 5FO8B 2XV0A 3HBGA 5E6RB 1IUZA 1KYDA 3B2XA 5IEKA 4IQHA 5KG9B 3QIUD 3VXRA 3S88L 4ABWA 1TU2B 3LPOA 4BXSV 1AGEB 4G72B 1PS3A 4DGVL 2FR4A 1Q4NX 3BRGC 1EHNA 3QCVL 2WVVA 2R39A 2D2OA 3MHZA 1OF0A 4OCSL 5LG1A 5TTRA 1IL1B 1TJIL 2PCPA 3BEVA 1I3UA 4JPQA 4X0KB 4DGYH 1P69B 4U1JB 1DBBH 1WO2A 2FLBT 4I5BA 3ARDD 1B6UA 1KLFB 5I24A 3ULUD 3F12B 3DDGA 1SDAB 4WHDA 3WUWA 2V8LA 5JQIB 4LSTL 1HZKA 1H0DA 4K9EL 1FN4B 1I3RA 1QWHA 3DJ9A 3RY5A 1ZAGA 4KRLB 1P7BA 5F93C 3HPLB 2UZPA 3HAEG 3VW3L 4POZD 3PS6A 3SPCA 2Y2TA 1RJLB 5BZDA 4I3GA 5HYIA 1NUFA 3BPCA 1I9JL 3P1VA 3S6CA 1GY2A 4FQIL 1RJZB 2AJVH 2P24B 1OB1B 3V95A 4UTAA 4YWGL 3PABA 3WLWD 3CBJB 4LPTA 4ZTOH 5JPNA 5FYLH 3X11A 3SZDA 6PCYA 1OAZL 4XN2A 3RIAK 3RVXD 4TUJA 4BFGA 4JHWH 4F8LA 5A3ID 5IB1A 5KW9L 2GSGA 3L45A 3PJSA 5B4MD 4XNDA 1D7DA 3MBEC 3DPBA 1RUAH 4NM4H 5KVDE 1H9DA 3MBWA 2KQMA 2AJUH 5JW4Q 3QFGA 4GP5B 2J88H 4X5XB 3LZFL 1E2ZA 5KVFH 4NAQA 1EZSA 2HRPL 4Y1AA 5IHZB 1U58A 1M42A 3QIWA 3KPMB 2TAAA 4HUUB 4Q9RL 4C58B 2EDHA 3VSUA 4FEMA 3B56A 2C7FA 3QWOA 3JWNE 2R23B 4JM2B 2M06A 4DVRL 1VRSA 2UWEB 5HDRA 43C9A 5HI3D 4JFEE 3PNRB 5LCVA 3GIZH 2ZLDA 2KQNA 4N2NA 3UEQA 5IY5B 5BO1H 3EG9B 2OXGA 3V0DA 1I3RB 3O2VH 3O0LA 3CXDL 2YO3A 2PTTA 4DZ8A 3VFUA 3TESA 3K81A 3MRDB 3VH8G 3DO7A 4L8BB 15C8L 4HIQA 4Y2OB 1OIOA 3U1PA 3WYRA 4LL1A 4WUUE 2Z64C 5FCUH 2ICWA 5AKVA 4N20A 5AAMC 1JF1B 4EZJA 1N5AB 1J1OH 2X12A 3GSNA 1JERA 4RMSA 4IOIA 3ULVF 4FYSA 4YHIB 1GIGH 4FA8A 1AGBA 1JPTL 1NFDA 3MBED 4PJ7A 4WW2B 1I9EA 1BIHA 1R5VB 3L54A 5GS3A 4WTZG 4PLNC 3H9HA 4LRIA 3Q6GL 3UERA 1AR1B 3I9GL 4PUBH 4FJZA 3RWFB 5IHUL 5C0BE 3GIVA 4WI0A 4F9LA 1WT5C 3CLFH 3JVGA 1UWGH 3FRPB 3L17A 3ARBB 1NMBH 3H9SA 3SKMA 4HG4K 4IRJC 2BSSB 1JZ5A 2RFXB 4MXQD 4XCFL 2X89A 2EVIA 2F6AA 1UQSA 4EN3D 4XWGL 2WNKA 3OZ9L 4P4KA 4TUUA 4KKBC 4JFFB 4CMHC 3QG7L 1JFHA 3LEVH 5DJ0B 1GKOA 1FRGL 2OZ4H 3MRJB 3MUUA 2G5BB 4O58H 1OCOB 4O58L 1ZLEA 4PJ9B 3TP4A 2I25N 1CLOH 1WBZB 4HETA 3EF4A 3VFUB 4AGQA 3QG7H 2HTLD 1UD3A 2VXTL 4FHKA 4KFMA 4PPTA 4X6CB 2ADJA 5GRWA 3HG2A 2DB8A 1I3GL 2R7EB 4P46B 1I9IL 1KJMA 1UA6L 1YC7A 4OIIH 4RAUA 3HG1E 3V7AE 1MCDA 4DIXA 4FQ2L 3VY8X 5EZIL 4AQEB 1L7TH 1XIWA 3NQIA 2H32H 5K9QG 1HINH 5HVHB 4OFQA 4NN6B 4Z3TA 2H5UA 3PDGA 4GKLA 5HHOD 1OOWA 4GP8B 2F54A 4DK6A 2AV1B 4HP5A 2E27L 2FQDA 2O1AA 2V2XB 4PJFA 3VB8A 2P8LA 3LRKA 5CSGA 5DFTA 2WSKA 2IFFL 3WBDA 1ZXQA 1KBPA 3CQQA 4PJHA 4JO8A 3LAFA 4JREC 4A2GA 3APCA 4LKCA 3O6LL 2FUTA 3PF1A 1JHLL 2WOBA 4LVEA 5IHLB 3H0TB 3ULVL 3DIDA 5FV2A 2VR6A 1KELL 1XCQA 2JI1A 1NMCC 3JV0A 3CBKB 3GSQA 5BRPA 2Q2LA 5F72S 4B53A 5BQDA 2V9TA 3FH7A 1HI6B 5ABAA 2J1ZA 1DQMH 3WV0A 1JRHI 1NC2A 4IOSA 3ABMB 1XTMA 2VQ4A 4Z1PA 4PJ5D 3U0WH 5E2WL 4GF4A 1BSIA 1QLRB 1DDTA 1A0QL 3BWUF 4JRFA 1VA9A 2BP5M 1DQKA 3STLB 3MFFA 4Z8FH 1K4CA 1QFWL 4L05A 1UFGA 2ZSWA 3VD7A 4CN6A 2EO9A 3BD4A 4NJ9H 3QUYB 4Z7NB 3DGDA 4N1HB 1BJ8A 3MRMA 2WVPA 4FOMA 1JPSL 1P2CB 1DANU 3AITA 1JZ6A 4QXGL 4JKMA 3R18A 3N50A 1SJEA 2OTUA 4I3SL 4P9ML 4KZDH 4S1DD 1HEZB 3VXSE 4ENEC 1ZOXA 2XBZA 4M6NL 1S5HA 4X80L 4ZTEA 3S34H 3SQOL 5GS0D 3HB3C 2IPUG 4OZGF 2AJZA 1A3QA 2R15A 2W1NA 1ZRUA 2MHLA 3GI8L 4G80A 5AW3B 4AKOA 2DMHA 4QO1B 3UROR 3FSVA 3SPVB 2LT9A 1FNSH 3V5KA 3PNWA 3TO2B 4PJEF 1NGWB 2XDHA 3BZ5A 1KMGA 4ZS7H 1QLFA 4NO2B 3WDHA 3OXRA 1J5DA 4FQXD 4PJ8B 3RWCB 3G6DL 3NCXA 4GBXB 2XN9B 4FQLH 5ANMB 3G5VA 3Q5YA 2DQJL 2VR3A 2NOYA 3R0MA 4OF7A 4XMPL 3WY3A 3KLHD 1D5IH 1JNNH 4M5SA 3D6GA 3G5XB 2FWSA 3CWGA 5BVJA 3HAEH 1U8QB 5F9JB 2DQEL 5HHMB 4ZFOL 2J56A 5IFHL 3GHBH 1E8XA 2R2CA 2D7TL 3G6JB 3L6FA 2IH3A 3ZK0A 3D18A 3LH8A 4HD5A 1AMXA 2EEFA 4P5TB 3LNEA 1Q1PA 2CHXA 3L3GB 4ZPTB 5DGRA 4Y9GA 4PP2B 1UZ6E 1P4IL 4GKOA 5MERB 2F1TA 5ESAB 4Y5VB 2WLHA 1T7YA 3EYUL 1PBYA 5E8DH 4ELMB 4FZEL 1LO2H 3S3BB 3A0OA 1FF5A 4O3YA 1F2QA 4N8PA 4DGVH 2JKJA 1I8LA 3ARBD 3EIFA 5MENB 3KS0J 2NY0B 2APXA 2DYPD 5EN2B 5F88B 5FYKE 1HDMA 4FI8A 5D2NE 3QWNA 5I1CL 4RAVA 4XB3A 1FCCA 2J4WL 3S35L 5J1TC 4AGMA 1PNDA 2NR6D 2Q2EB 4GAGH 1IGFL 5J9PB 1BVOA 1XGTA 3ZDWA 3N1MC 1RY7B 5EBGA 3TTYA 4Q97A 4Y1AB 1EAPA 3D4YA 4JFDB 4F2FA 3ULUE 1FIEA 1S7TB 4LLWB 2YMXL 4Z7QB 2KZWA 1XCTB 2ZUVA 3L95A 3LXAA 4PGCA 5DS8A 2L7UA 1P9MC 4JANA 1H9VA 1Z9OA 3IDJA 5D96B 1ZS8B 5JA9A 3QFJB 3CX5J 3X1GA 2FSEB 2A9CA 2FE0A 1Q9WA 3PIQA 3CTTA 3FQXA 3GBML 4QRUB 3U4BL 2AEIT 2IAMD 2NDGA 4D0CA 2HT2C 2Y3NA 4WW2F 1YEHL 4Q0XH 1KJ3L 1S9YB 3GJFH 4KKAD 1MWAA 2OP4H 4ZUVA 5I2IB 4OBSA 3F65A 2WV3A 2KZ1B 4NN7B 3LKSB 4QLWA 4ZO9A 2GTWA 3R7RA 3GXFA 3QGVA 3KGSA 3ESUF 5F3BA 4M48L 1Q72L 1T1WA 3IF1B 2B4CH 3LB6C 4Y9FA 1G9HA 4AYMC 1YVLA 1B6DA 3IU3B 4E9LA 4IHOB 3B9AA 2HX9A 4G9FD 1XXDC 4JVPA 4ZMYA 1J48A 5HDOA 1T4WA 3PJNA 1WAEA 2PWGA 4AEFA 4CKVX 5CBEB 2DYPB 1U3ZA 3CVHA 3MBEB 5BQ7A 2O6PA 3TA3A 4G8IA 2OMWB 4JPVL 3MNDA 3D5OF 3HHSA 1NFDF 3B1TA 1TPXC 2BNUA 4CJ0A 5I6MA 1PKQB 5EUKA 3Q2VA 2X9WA 1DL7H 4PJEA 4Q9BA 2BS71 2CGZA 2RH0A 3GMMB 6TAAA 1WEJH 4FQQB 3VWKB 1G7QA 4H1LH 5AVWB 2J57A 3ULUH 2DEYX 2DYRB 3PWNA 1IJ9A 4I13B 1T7XA 2WYTA 5JNYB 4BFEA 1CGWA 5FKAB 1KTCA 1WCBB 2YN5A 5D1QC 1X5KA 2BVEA 5J1AB 1WZ1L 1RZIA 3LMJL 4C56A 1DQQB 1CLOL 2LAAA 3B34A 4I3RL 2RA1A 3HRZC 2AW2A 2XQYA 3EO9L 3BQUC 3PP3H 5DMYA 1QI4A 3K71B 3GM0A 4JY4B 1K4CB 3QJZA 4N0YH 3Q8BA 3A22A 4KKPA 3VG9B 5DD0L 2ARJA 3EDKA 1E28B 3C08H 4GQ9H 4HPHA 4XN1A 2YD3A 1N9PA 1INEL 5C0NC 7FABH 1A7RL 1HWGB 3LKSA 3SZVA 4QOKD 2YEQA 2K1MA 3DX8A 4AKRB 3IMVA 3BUDA 1CTMA 4JCMA 2XA8H 5FYJH 3UJIL 1BVLA 2B08A 1IT9H 4L29A 3K6IA 4L3EB 4CMMA 2OMVA 1SEQH 3H0TA 3CE1A 1F3JB 3SD2A 4LOFA 4YSSA 4MMXA 2NY6C 1UD5A 2AK4A 3SBWA 4TSBL 3VTAA 2H1XA 5FUOH 2ENYA 1PD1A 4A2EA 3L95B 4PGCB 4CVUA 3HOLA 1U95A 1KFAL 3BT2H 1ZE3H 1Z3GL 3NRPA 3DK2A 4KI1A 4OCRL 4RISL 5TDPB 5EWIL 2JJSA 3JXAA 3BP6A 3LY6A 4OLUL 3NTCL 2W81C 3V79C 5D2NC 2WNXA 5K9KA 5MHSD 3HC0A 3C6SB 4PJ5E 3MNWA 4U6XB 4XMLH 4HJJH 1G6RH 3ATEA 4QHUA 4ZOCA 3C09B 5I0DA 1QBLL 4OF0A 2C9AA 2BY0A 4WNJA 3IRCA 4JDTH 3UIZA 4H0GA 4I0CC 4XPBH 2ZYSA 2IJ0C 2XQ0A 4E68A 2R8SL 1RK1A 1MCPH 3T0EE 3AREC 2MRYA 3ME0A 3QA3B 3S2CA 2FL5B 2DTSA 3CFIC 4YN3A 3B5HA 3CHQA 4TLKA 2FH8A 5DJZB 1NBVH 3TFBA 5ITBH 3QPQD 4YFDB 1ZXKA 2RGSA 4LKXA 4YXKL 5B66O 3BAYA 4WU7A 3EXJA 4WI9A 3CPLB 4I9XA 1QFUH 2WBWB 3D12B 3QO1A 2IVFC 5AWNL 1EO5A 2EDEA 2BHFA 5EZLB 4XPFH 3O2DL 4XI5D 4M1DL 3V0VA 5CP7A 2YN3A 5G5DB 1AYOA 3MAWA 5D71L 3MLTA 4LDOB 3LK42 4FNSA 3ZDXB 4F3FA 1U8IA 3O2DH 1LO2L 3U9UB 1P7KA 1G1KA 3GMOA 4HWBH 3RWJB 4F7CA 5B39G 1N8ZA 3BUQA 4KK6C 3ARFA 2WAHA 1FVEA 5TDPA 3OKOB 2Z31C 1MY5A 25C8L 5SV3A 4NLAA 5IT2H 4OI8A 3MRQA 1OW0A 3P2DA 4HW6A 4RNRA 5CP3H 1JF1A 3IE9A 2ICCA 3MDJA 3P54A 4LASH 4W93A 1DUZA 4AVIA 4P57A 3QORC 2NX5B 4FTVB 2I5YH 8FABB 1KGUA 5TGBA 1RSYA 1FJ1B 3PREA 1NEZA 4GSXA 4GPVA 2QV2A 4ELMA 3LKRB 5EOCL 2VDMB 2R56L 3TJHC 3RTQC 3V8UA 1FORH 3QJHB 4LCUA 1XZ0B 4U9CA 5CD3B 1P5UA 1ECYA 4LEOB 4PLJC 2I9LB 2IH1B 3RVTD 4M7ZC 4RQQA 2AQ1A 4OFPA 1XR9A 4QHKJ 1BWMA 3QCVH 3HFML 3N3EA 5KVFE 2L7QA 3GSXA 2WQVA 3FS9A 4UILL 1ZT1B 1BQLH 6PAZA 2VB5A 3UTTD 2JJSC 1G9NC 3QSKB 4ECNA 3MBWB 3RA7H 3BGMB 1ZTMA 3WEOA 3GZQA 2RCSL 5KSBA 4Y2LA 5DHYA 3NIGE 3QUMB 2DLIA 1S7WB 1XBDA 3NFNA 2K45A 3L7EA 5IIEB 5DL5A 3VJ6A 3TT1L 3TYGH 1VHPA 2GI7A 4PJIA 4FSPA 1OPGH 1U8CA 2YSSB 1MWOA 2CKBL 3FQ4A 2DD8H 4HS6A 4M4RA 5E6UB 3EYVA 2FT7A 1CI3M 1U93B 1E8ZA 5GGVY 3RB7A 4BV1A 3O8XD 1YNTB 5EZJA 4D9QD 1I1AB 3C6LA 4TOYL 3FQNA 3LJ3A 3ZMEA 4MDIB 2VC2B 4MJ5B 3GMPB 5FOBA 1QZNA 4IRJD 4K73A 4AYFA 1CLYH 3T77A 1EA9C 3LRHA 4TNWF 3T4AB 3IFOA 4HMCA 3ZGHA 2YMTA 3NJLA 4JM2D 5C0CA 3F6IA 1S7UB 2D4DA 4O02B 3CX2A 3POUA 5GS2D 1Q0YH 5FPIA 5CUSL 2J5LC 3UTPE 2VRAA 3WKYA 1W6LA 2GJ6E 3GD1C 1XD0A 2WCGA 1IC4L 3H56A 5F7HA 3ZHDA 3BP5B 4TSAH 5C0CB 4KR8A 5JDPA 4KGLA 3QYCA 2DJUA 3OAYH 1T1XA 1QLRA 4OF5A 2F7OA 5I16B 3FUKA 5ISZB 3E1ZA 2J2ZA 4IBTA 4L5FE 4NCC1 4XO5A 1IBBA 1JK8A 2FECL 1FVCB 4UB6O 2K7QA 3WCYA 4J39A 4Z95H 3RX7A 3AA0B 1TZ8A 3TZVA 3QEQB 5F1NB 5C0EA 2BWDA 5BPPA 2Q3ZA 4ZX3A 3VJ6B 5GIRB 2E47A 5CN2A 5DD5H 4G3YH 3MRLA 5KBMA 1OF2A 3AY4A 1FC2D 2WQWA 1X6NA 1A7QL 1MRCL 3I6GA 1MN4A 2XV2A 4CGUB 3ZW3A 4IL6O 4Z77A 2OYMA 2LQRA 3THMH 4XVJH 4TVPH 1KWGA 1T20B 2NZIA 3UBHA 4UDUB 4XN7A 4FXGA 4NP4H 2FO4B 4QRPA 2WJ7A 3HOGA 5J11C 5K39A 4APQB 1J8KA 2BHYA 1QO3B 2BC4B 3BUYB 3BSZA 1FCGA 1VZHA 4GRWH 3V52H 3PXLA 3JV5A 1U0QA 1I8IB 4H20L 4PY8I 2VE6A 4FKEA 4NPJA 2J71A 3C8KA 4X7DC 3X1EA 2QADB 3ATDA 1VSCA 4DETA 5T1KA 4IBLT 1G4RA 1IEAB 3GSWA 4KJWC 3MRFB 1A3LL 4TF4A 1U21A 4U0RC 1UA3A 5I6PA 2IMNA 5ICYB 3REWA 3U1SL 2XVGA 1YY8A 3OV6A 5I15H 1BLNA 2DQCL 2OPCA 4PG9A 1UQSB 4HLJA 4WUUD 3RGBA 2VR5A 1HL4A 3HG1D 2X9KA 3RWGB 1QWNA 2OXHA 2X6MA 4UM9D 4XWOC 3RNKA 1DQIA 1Y0LB 3SCMB 4W9GC 4LLQA 4JJ5A 3TEXA 2B0SH 1L9SA 1U8IB 3CUPA 2J1NA 2P46B 4XAWH 3TN0A 2JMRA 3FT3A 1KGXA 4HOWA 4J3SA 4JZOB 3KW8A 5LXVA 3BDBA 4B9FA 3RGVC 3HJEA 3QZWG 1QFWM 1RIVL 1HHKB 3BZ4A 3I74A 2WYHA 4RSYA 3RFRA 5I17A 3CFJA 3ULUF 3HNTL 1P5UC 3G9VA 3ME0B 3FFCA 3QA3A 1ZA3B 4YHOL 4LSFA 2RTTA 3BWAA 3QDJE 2QKIB 3P3SA 4JM4L 2VM4A 2B1HH 2D31B 1T04A 4Y1AE 3QH3B 1AAJA 1GFPA 1LP9E 1P4BH 4M6MH 3PWUA 2XG4A 4FEIA 1FFPA 1X7QA 5TJWK 2SODB 2KDGA 5H4ZA 4JPWL 2VLRE 2MWCA 3VO0A 2DWDA 1OAUH 1INDL 3ILDA 4PV1C 3HG0A 1USZA 5CCKL 3L3OC 2JF1A 1YEJH 1AP2A 4NUJA 1E9OA 4AEIL 2D31A 1OXYA 5TD4A 1OSYA 5DJXB 4AIZA 3GJFA 4HJ0C 5AQ0A 1U95B 4TNGA 1S9XA 3VFOB 3Q2CA 1MFDL 3EFFB 4GUCA 3BEVB 3VCLB 5K9OB 1JZEA 4U1NA 3OLEA 4PVMA 5D1ZD 5FO7A 2V7HA 2F53A 1XGUA 2XQYG 1S7WA 2W9LA 3QYMA 3F7YA 1PZ5A 2QSCL 4GQQA 1YNTA 5EZJB 5FR3A 5I76B 2B14A 5JIQA 4UV4H 4QXTA 5DT1L 2YGQA 4Y88A 4YUEH 4LZKA 4MLSA 4OGAD 2FO8A 1BBJB 3HI5H 5IEHB 1Q9KA 1R3IH 1U41A 4DVBA 4GUOA 4AZ8B 3E8UL 4P4RB 2FX7L 3KVPA 3BPCB 3SKNB 3L48A 3L16A 1MNNA 3W1ZA 5E8OA 3KMDA 3HMXA 1ACYH 2LU5A 4UWQB 4YHOH 1N19A 3TASA 4U0QB 5BUGA 1XF5B 2VDKH 1DSFL 2DWTA 3POCA 1E5AA 1NINA 1TJGL 1Y1DA 3EGXA 4IK6A 4CU8A 4LEXH 2RB8A 1ZMYA 1W0VB 5FO2A 1ZLVH 5FYJD 1C8PA 1RURL 3V0JA 1J8HD 1B4TA 2BSRA 3U46A 1UJ3A 3H3KA 3O6FB 4FA7B 5ICYA 4HWZA 2JFCA 3FYXA 1WSST 2O61A 2VMJA 1CN4A 5EO0A 3LNHA 2ZYIA 4U1JA 3QAQA 3T2PA 3GEFA 5I0WA 5IMOB 5KYUB 5JO5A 1HH6B 2HVKB 1AQKL 3TEZA 4G9DA 4J7RA 4EVNA 4FLQA 3GB7A 5DS1A 4ZT1A 5EEXA 3IK2A 5K9KB 3O45A 4NO3B 3WS6A 2YC1A 1A0QH 1NDGB 1JYXA 1MQKH 3ECQA 5KYYA 1KYOK 2CJSA 3O4LD 3OQ3B 3T2QA 4WV1A 2VDMH 2ZSVA 4B97A 4M6AA 5E51A 3WIHL 2BNQA 2ITCB 5LJYH 2IFFH 5F9OH 3DROA 1IVTA 2F8IA 3C6EA 3ALXA 3BKMH 2DJ4A 3BAXA 3C8HA 4OZIB 2OS7A 1TCMA 2R4SH 5MEOB 1THAA 1OTTC 2B5IC 1EDYA 4AVKA 1ILUA 5EZOL 1PVHA 4NRZB 1A6TA 3OTTA 3ZL2A 1G9EA 5KJ7E 5KOVC 2Z8WC 4RGMB 3ZHLA 1XHHA 1X5ZA 4P07A 4WFGD 2IAND 2SEBA 1YC8A 3QJFA 5B8CC 5LGHH 3ZE1F 3GZOA 5GGSB 3KJ4B 1N64H 3MN8A 4K5PA 4M6OL 2WW8A 2EDMA 5DUPL 3EADA 2YBGA 3C6SA 2GKIA 2IADB 3KL0A 4M6OH 5IJVA 3LIUA 3SGJC 4GW5B 3G6DH 2BVOA 2VDOB 5EOTA 4PGZA 1BFOA 3MMEA 1F5WA 3AQDA 5CLXA 5KZCD 2OXGB 4KQ3H 5C08A 3SDCB 4ZAKC 2ZPKH 3AT9A 1PIFA 1ZD6A 2Q8BH 1H19A 4XCCL 4L37A 2XT1B 3NFSL 5EEYA 4KI5E 5C0IB 2EZ0C 4LT7A 3ZYIA 1E4HA 2R2HB 1JHKL 2C4XA 5LDUA 2A83B 4OLXH 3RGVD 4HWBA 4RIRB 1CG9B 3DVNB 2W91A 2ZWZA 3N1GC 4O51B 5CGMA 2ADFH 3NCFB 7PCYA 1IQWL 2UV3A 1NFAA 2OMWA 3W0WA 1FE8H 3ZPDA 5EEZA 4J3OC 4DTGH 4OW6A 4UI2A 5CBEA 2AEPL 1LP9B 3SE9L 2CK0L 4U0RB 4PJ7E 2WXHA 4OJCA 1PG7X 1J0ZA 1OANA 5DHVA 3VXQA 2YD6A 4G9FA 1FFOA 4UQ2A 5DJ2B 2VGLM 3EYFA 4G11A 4XNQA 2ZKYA 5EBMB 5MEND 3IAPA 4JQIA 4M62L 3UAJA 4BGLA 3B83A 3ECVA 4W6YB 3WO4C 4LLDA 4N2CA 4K3BA 2D03H 3HI1B 2V7NB 5ADXK 5G39A 2DM4A 2QDWA 4YLQT 2NXYB 1X9UA 4DN3H 2CKBB 4LVHB 3JWDH 2MTPA 5K1VA 3L4TA 2NY4B 1FFOB 4UQ2B 5DJ2A 5GPRA 3MV11 3T71A 2CUIA 4HJSA 3DHMA 3S8FB 1QVOA 4ELMF 2VC2L 1RUML 5ACZB 1IKNC 1T03L 4PTUB 3BSGA 4Y4HA 3QZMA 3IDJB 4NZ8A 2Q10A 1SQ2N 3IDYC 2CIKB 3FTZA 1MCWM 1H3XA 4D65A 2BX5A 3EFFA 4PYHA