4AYDC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 r106a mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
247
structure length
238
Chain Sequence
DIGAGLADALTAPLDHKDKGLQSLTLDQSVAKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEITLESGEFQVYKQSHSALTAFQTEQIQDGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 53
structure length 238
sequence length 247
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aydC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4aydC01
3PQSA 3VE1A 4O4XA 5T5FA 2KC0A 3V8UA 4O4UA 1YS5A 4O3ZA 4Z3TA 4AYMC 4AYEC 2W81C 3PQUA 3UAQA 4QQ1A 3KVDD 4O3YA 3VE2A 2W80C 3HOLA 4O3WA 4O3XB 2KDYA 4AYDC 3HOEA 4AYNA 2YPVA 5EE2A 2LFUA 4O49A 2Y7SA 4AYID 4U9CA
chains in the Genus database with same CATH superfamily
4HFUH 2NY3D 3OWEA 3HNSH 3PAUA 5KVDL 4G7VL 2DAVA 4WWKA 3WYRA 3TJEL 4HWEL 5ESQA 4LARL 2AXHA 4AUIA 5D6DC 2Q76B 2ZCZA 4Q6IC 2ZXBA 3GLEA 3VSUA 3Q48A 2C1PA 1KFAH 3BW9A 3OL2A 5CINL 3LIZA 4LCCB 3QYMA 3TM6A 4DT2A 4P06A 3U25A 3ZYJA 3PGSA 3A23A 5FOJA 5DUJA 4JVPA 3N44B 3BIBX 1P7QB 3BP7B 3NSXA 2YD9A 1CDHA 3VZUX 3UYRH 5DDHB 3LX9A 4YWGL 1JVKA 2CK0H 4FHJA 5T1KA 2WAQA 1EXUB 2KKQA 5JDJA 1WWWX 2V2XA 2H32A 2UVEA 4OF5A 4N8VA 5ACLA 4Z7VF 3TEWA 1V3LA 3BN9C 4YC2C 1P0SE 5D5ME 4PJXF 4QR7A 4H88L 4GFTB 1NFDA 3KLHD 1RMFL 3WJLC 5KBDA 3W2DL 1IIIA 4WTXA 1AD0B 1AQHA 1PL3A 5MI0C 1E0OB 4CN4A 5I75C 1THQA 5GPRA 1T5XA 4S1DD 5DA4A 4JE0A 5C0DA 5IJKC 1MRDL 2XV0A 3Q3GA 4OGYH 2H45A 1CICC 3VSQA 2NUTB 4WO0A 3H55A 1EGJL 3ARFC 2K4AA 2FGWL 5FYKL 3GMMB 3AITA 1TEFA 2I07B 3WHXB 2OMXB 3MJ7B 5KSBB 1CI5A 1P6AB 4DESA 4F8NA 4AIZA 3HG1B 3GSNA 1BFTA 4XBPA 3IPEA 3MRNA 2J73A 1HHKB 1NCTA 1JHTA 1GYWA 4MA3A 2R69A 3MLZL 4U3SA 3GBNL 2ENPA 1GH7A 3ZY7A 4Y5YA 4CJ0A 2LW3A 2X0VA 3RWIB 2OW7A 4N0YL 5C07D 1PGRB 2XE3A 4EJ1C 4NQVA 1CE1L 1HZHH 1L4IA 1UT1A 2YRZA 1T5KA 3RVXD 4PV8A 2WB7A 3QUMH 2R29L 2O5NA 3DK0A 4IHBA 3T65B 3EYVA 2PXYA 3PP3H 4M48L 3G6DL 4BUQA 4KVNH 4P4RA 5A7EA 1FZMA 5C0CA 2X88A 4WZ9A 3FQUA 3GJFB 3F62A 5GS1A 1FORL 5FA4A 2VL5A 4GAJH 3SDCC 3VFTB 3W11D 1E6JH 4ZUVA 1CDIA 1DVTA 1CIUA 4YGVA 5B39B 1KELL 4YAQB 3O3AB 3ZQ9A 5IVXF 2XJKA 4FQ1L 2J20A 4YXKH 5IBUB 2HP4A 2VABA 4KJPC 2OI9B 3C6LD 4RL9A 2YBGA 35C8H 3BWUF 4N6RA 2IAND 1JOIA 4X4MA 3P54A 1F6AA 4JM2C 2WLJA 3ZE0E 5F9DC 3W9EB 3WXVL 1MFCH 4D0DB 4I48A 2R83A 2Q3ZA 4R4FL 1YMHA 3N1FC 4UDUB 1AQMA 5CF3A 2VZSA 2HN7A 1UASA 2X3CA 2YFNA 2F1AA 1KCKA 4X99A 3WE6A 4F7KA 1OZUA 4AEHH 2QPDB 1FNEB 1AANA 1AXTL 1JI1A 1WK0A 3TBBA 2EINB 5IJDC 3C60B 1RUQL 1NJ9A 1DE4A 1IGFL 1HI6A 2G75A 4H5SB 3L3KB 4D8OA 1YRKA 3ASWA 3OPUA 3BGMA 3U83A 5IVOA 5CR8A 1W0VB 4HD9A 4YDNA 1E3ZA 4Z9KB 1A5FL 2XQ0A 1UHVA 4XPFH 1O5PA 3GS0A 3HHRB 1LMKA 2F68X 3D12B 3M1BA 3EBHA 3N41B 2PO6C 2DKSA 3RHWK 4EAEA 1P5UB 3GUTB 4HOMA 5JQHC 2VLRE 2E76C 3INUH 4UM8B 1QFWI 4ZSOA 3FB6A 1BF8A 2XWJB 4ENZA 2ZP8A 2KLRA 1CBVL 1A4AA 1XIWC 3IDIA 2W65B 5AOKA 3VWKA 3WJJA 4G70B 2VSDA 4DGWC 1NBYA 3QULB 1DBAL 1QA9A 3K81A 5T3XH 4QHUB 4P5TB 1KV3A 4QNPF 1A4KB 4XAWL 3Q5YA 2W60B 3LH2H 3QDGB 2AQSA 3CN0A 2D31A 3BJ91 4R96B 2VXVL 1DCLA 1YEJL 4MJ2A 4FRXA 4ZS6C 5LXGL 1Z32X 4FP8H 3TWCH 4ANKA 4LSDA 5A16A 3QJRB 2F8OA 4PFEA 5CWSA 1IC7L 3OZ9H 4LCYA 3RIFK 3IVKB 1WAEA 4WNQB 2GBAA 3BJLA 3QG6A 1KENH 1KIQA 2D7MA 4PLKD 1TNNA 3BQVA 3CDGB 3RNQB 1U6AL 3V5DB 2ZX6A 1BFSA 3OLIA 1G7IA 4OR1A 1QR1A 3T0SA 2ETWA 4GINA 4PM1A 5GSRB 4G72B 4RIRB 2KXPA 1IGJA 5HHOE 1NKRA 5FYLE 4PYHA 3F12A 5ADXL 4GRWB 4OLXH 1BFVL 4I9WD 4TTDC 3KYKL 4DZ8A 5IJBC 4PP1C 3B5GA 3QWRD 1S7QA 4ADJA 4JGMA 4XN9A 1ZLWK 5HI3D 1G0XA 1KACB 1XTMA 1N7MH 4X9HA 3WMQA 3ZPDA 5I18L 3VFGH 3BP4A 3LPGA 5KYYA 3BYYA 2NY5C 1WD9A 3MLXH 2P24B 4ODBD 3S5LB 2OTUA 1ACYL 2AF2A 3ZKNC 3MNVB 1WA1X 3D39D 5ELIA 2BSCA 1PZUB 4WWID 4D8PA 3Q06A 2WXNA 1TETL 2HVBA 4IL6O 1ZLEA 2YGVA 2BNRD 2O5YL 1JHLH 2Y0SA 4OAWB 1QSZA 5AD0B 1UJ3B 4NQSB 2ITDA 2VMFA 2KC0A 3UP6A 2AC0A 3LEYH 4JQVA 1ZCRA 3LN4B 4YVUA 1RJLA 2N1KA 4PJHF 3SGJC 1N3NA 3ZE1F 4B6ZA 5CCJA 3D39B 2H6UA 1ACCA 5B3JF 2FSDA 4EZMA 5TE4L 4AT6B 3VRJB 4WWKB 2YNKA 1RZKC 5J1SC 3TTSA 1I9RH 1FFPB 5ESQB 4I77H 1UFGA 2WBJA 5D2NC 3ABGA 1XHHA 4PHXA 1YO4A 1FFTB 2Q76A 3ARFD 1C1EL 3UDWA 4DEUA 2C1PB 4LGRB 3BW9B 1CXFA 1D5IL 4M9OA 4PP1D 5BUPA 3VE0B 1G9HA 1XAUA 5IB2B 1XH0A 4AI7A 5K9OB 1P7QA 2E27H 3AXHA 4OF7A 3FUMA 5GV0A 1CC3A 5DDHA 4P2OD 3MJGX 1HESA 2AQTA 2ZCLL 3LPOA 3B9KD 1EXUA 3U48A 2V2XB 3VGHA 5I1HL 2H32B 2YGOA 2KPNA 2X09A 1LEIA 3MLZH 1JMZA 1AJ7H 2Q9OA 2YD2A 4UOZA 2WJQA 4NAJA 5F21B 3SBWC 3WCYA 4ELMF 2BNRB 3RVXC 1LNUA 1RZ7L 3PPSA 5ALBH 1JERA 4IW4C 1AD0A 3TJPA 3AXIA 3NK3A 2QVIA 1JK9B 3FUHA 2XWEA 2CCLA 3QC5X 3ZQWA 5C0RH 4TNWK 5FOBB 4Y1SA 1YLBB 1ULVA 5FYKH 1EVUA 3T6VA 3P9LA 4HH9A 1Q0XL 4XNUH 5SX5K 4EMZA 1A3RL 2E8ZA 3U7WH 2IGFH 5E6IB 1S5IH 3CSGA 5FVNA 5I30L 5C7XH 1H3PL 5DGQA 1A4CA 1EPFA 4DP8X 4AYSA 2BM3A 3GMMA 4WI9A 3VXRB 4AG4L 4DGVH 4KQ4H 5I74C 5LAXA 3RJQB 5KSBA 1A6VL 5E08L 3NACH 4AIZB 3HG1A 2JQZA 4HUKB 1Z9MA 3EHBC 1OPGL 3VI4E 3QO0B 4XBPB 2EADA 2WKOA 4Y4HA 2ZUUA 4LHJB 4MYPA 1HHKA 5EIIG 5KSUB 4KO7A 4OFVA 1KXQA 1JHTB 4PRBB 4XHJC 1NC4B 3RIKA 1E4XL 1D7FA 5D2NA 4U1NB 4YDLB 3WUWG 4Q6IB 1SY6H 3EH3B 5JYLA 5SWQB 4DUXA 1FH5H 3F84A 5BUAA 1DVZA 3M45A 3RWIA 3BPCB 3FTUA 5EEUA 2JJVA 2NX5B 3GXPA 1LK2B 3T65A 2BSEA 3CK0L 5AL8A 2JQAA 3EYVB 1GS8A 4P4RB 2QADD 4JAMB 1FZMB 5KYXB 5C0CB 3L45A 1JD9A 3FQUB 2GBTA 5EUOA 5ALBL 5DFVD 4PUBH 2VL5B 3FHEA 5TFSL 3ETBF 5D2LF 1EO7A 2RMNA 4XMPL 4YGVB 3NJNA 4J3WA 5B39A 1CGUA 3HNTH 3HFMH 4JHAL 4QRRD 5DMGC 3Q2WA 1Q0EA 4N6RB 3U7YL 4NZUH 1F6AB 1UOKA 4Z7WA 1KDIA 3L9BA 3IFOB 1YC7A 2KDYA 3BVUA 1WZMA 1IBGL 5L8JB 4YSOA 2A9AA 5HJBA 4AG4H 4DGVL 4PRAB 1GGBL 3RVUC 3O6MH 1MXGA 4YHMH 2JH2A 4XO4A 3ZE2B 1AHMA 4X99B 4X8GA 1KXQE 1MI5D 4P46C 5TE7L 2F1VA 4KROC 1JAEA 1FNEA 2ZCKH 4F92B 3ULUF 3TBCA 3CLEH 1CLYH 3IGFA 4FCHA 2JMMA 4J8QA 2XJLA 3ARBB 3WFZA 3TV3H 1BYOA 1NJ9B 2PNDA 5DMKB 1HI6B 5BRZA 2G75B 4H5SA 3L3KA 3LHPL 2DTSA 2WPGA 4FF9A 4R0LC 1T03L 5BZZA 4M7LH 1A7NH 2EDBA 1NCCL 3BGMB 2JJTA 5DZJA 3TZVD 3E2HC 1Q1PA 3QFJE 4KJQC 3FU8A 4CW1B 1RZJL 3QJHB 1LP9E 3DJSA 2IANE 3P77A 1P5UA 5BV7L 3GUTA 1E4HA 2F58L 1FC2D 5DFWH 2D4DA 4UM8A 3FB6B 4FL4C 4JG0H 1T7WA 2XWJA 4Y2LA 4PREA 5LXVA 5AW9B 1J88A 3CSBA 1WA0X 1WT5C 5GZOA 1A7RL 1L9TA 3KBFA 3IDIB 1MVUA 3ZDYF 3UGUA 4G82A 1LO5A 5T5FL 4Z1PA 3FUNA 1NBYB 3NP3A 1NLBH 1QA9B 3QULA 4JX0A 3O4LE 3UTSE 4QHUA 2NY7H 2HRPH 1QWHA 1JNLL 3L7FA 1HQ4B 3VDAA 2W60A 3QZLA 2EVGA 2M26A 1OY3B 3QG7H 2D31B 3RVUD 4R96A 3WO3B 3UBGA 1PY0A 4UM9B 5BS0E 3MNWB 1CO1A 1L0QA 4AQEB 5A16B 4PJAB 4GG6F 1BG9A 4OCRH 2RCSL 1X7TA 3ULVE 2JI1A 3IVKA 1VZGA 4FE9A 5E5UB 4FLQA 3QG6B 3S98A 2BVUA 3U6RB 4UT6L 1J18A 2J8HA 3V0WH 4JFWA 2BHZA 2V2WA 2QQKH 3R4DA 2ZYRA 4JM4H 3MOBH 1UD3A 1EZUA 4OJAA 4XOEA 1V05A 5E2TH 5DUML 1QR1B 2BC4B 2XXGA 5HHQA 3GI8L 5F0JB 3BWZA 5AL0A 2AJZA 4QPEA 4KK5D 1KEML 1UYWH 2EO7A 2ZAIA 3UOAB 4JFEE 5HGDA 1EDHA 1PCXA 1FL5B 5AVSB 2BP5M 3F12B 3M7FB 1U2HA 1ZWIA 4P5KB 4G83A 32C2B 4L18A 5IP4A 4YBHA 1RJZA 3MOQA 3ATFA 4L05A 2KZWA 2PF6A 1J11A 4XAWH 3VM7A 2HG0A 1S7QB 2CBPA 3CX5K 2E75C 3WD5L 3T1WA 4PS8A 2A4ZA 1FNGA 1TZOA 2K3TA 2GY5A 2FCBA 1XGQB 5E5MB 3SGEH 3VM5A 4D9RD 3TXAA 3PP3K 3BP4B 1V55B 5E0QA 4OM1L 3OPZL 5JW3H 3S5LA 1EO8L 2P24A 4YHKL 2NSMA 3SZ6A 3BKCH 2VR9A 4HZ1A 4J23A 2UYLB 4JR9L 4TVPE 1NMAL 1LP9B 2MJWA 4IKNA 3KLHC 2AJVL 4J3BA 4P5TC 4FUVA 1UJ3A 3BI9X 4LP8A 3S5LG 3ZTNH 4G8GD 4NQSA 3IDMB 2ITDB 3IPFA 4UQIM 3EJRA 2Z65C 4ALAC 4K94L 4OZHB 4QHKI 1CF8H 1YECH 4OF3A 4E9RA 4L23A 4DHLA 3LN4A 1RJLB 1N3NB 2KT6A 2CJUL 2X4RA 3D39A 3MTXA 4Y8AA 5D93B 1OF2A 4PLOB 3D5OF 2GTWA 4AT6A 3DUSA 3VRJA 5E7BA 1FFPA 1RUKH 1TOXA 4M02A 1EZVX 2JKIS 3VNYA 2WBJB 3OJDB 3ZE2E 3AA1A 4FZLA 1Q9KB 5MERB 2Y5QA 1TLKA 3WY1A 3OTTA 3RWFB 4OBSA 4OZGF 1BBDL 4OCMC 2GEQA 2XZQL 3VE0A 2H3KA 3KDMA 5IB2A 2PP8A 1ZGLM 1C9SA 5K9OA 3X13B 4Z3IA 5AW5B 1GOFA 5CEZE 4N8VG 2C9AA 2DLHA 2Z0BA 4FADA 5LGHL 4EE2A 5C2UB 1A6PA 3LVTA 3P40A 1XT5A 2V9UA 1A7OH 1M7IA 4S1QH 1TJMA 1UEYA 2G0KA 4HS3A 4XH2B 1OAYL 1LEIB 1YVLA 2BDNL 2NY6B 4RFNB 1HU8A 3ECWA 1SEQL 4GO8A 5DU7A 1V10A 2BNRA 1LNUB 2VZ3A 5CJOL 1X5JA 3GRWA 3P73B 1JK9A 1OXYA 3DURA 5FOBA 2X27X 1GVIA 4MDRA 2R4OA 2FJSA 3S3SA 4A2GA 1CK0L 5L4JA 4YOKA 3P9LB 2C34A 4GBXC 3K19A 4HH9B 2HT3D 2J88H 4W6WB 4DN4L 1T1LA 1WLHA 5E6IA 4MNGB 1G9MC 3ESNA 5LN8A 4J39A 4JCMA 1JNJA 3QCVL 1RLBA 2WBJD 1WE5A 3MLVL 3TESA 3PV6A 4LIQH 3VXRA 3A6CL 4KZ0A 5LAXB 3B9DA 4B5ZA 1MRCH 3F01A 4JREB 4FQJH 4LRNH 3QO0A 3ZX1A 4Y4HB 3ROLA 3P9WB 2FBJH 5KSUA 4XO9A 4PRBA 1RZ8B 4G11A 3VXTA 4AV4A 4JPIB 1NC4A 3ZR6A 4AL8C 2PP9A 4LASL 3MOAL 5D2NB 4U1NA 1FNSH 4MD5A 4Q6IA 4MJJA 4O00A 2ALAA 3JV6A 5SWQA 1AZCA 1CFQA 3KPNB 1J10A 2ZNWA 3D3VA 3NIDB 5ITFB 3BPCA 4HUCA 2ZLDA 4JHBA 3VMOA 2NX5A 2GJ6E 1LK2A 3FUIA 2CKBL 1MW2A 4X5LA 1KYUA 3VTTA 3C9NB 4G3YH 1N7ML 1SRDA 4MZ2A 4JAMA 4PJFF 5KYXA 1OCWL 1IKNA 5AOJA 5EUOB 5JO5A 3X14A 2NYZA 4YUEH 1DP0A 1R5VA 2AXWA 2JVUA 1A9BB 1SLVA 1VPOL 1DEDA 5I1KH 3PAZA 4KZEH 4Q9QL 5I73C 1LO0H 3SJVE 1KGCD 2A9DA 1YPZE 1O7SA 4FOZA 4KKPA 3K6IA 1BJ1H 3CUPA 5A7BA 1PJ9A 3X1BA 3CG8A 1K6QL 4D64A 4EXKA 3O4OB 4Z7WB 3IFOA 1M7XA 4LSSL 1I1YA 3VXQA 4PRAA 4Z0BL 4YQXH 3ZHFA 5K9JH 2YAFA 3WO4B 3QXUA 1MI5E 4LNRB 3V52H 1ZHTA 2R27A 4Y1TA 2EXYC 4CVZA 3SOBL 2ZUVA 1OK0A 2FE0A 3VGDA 3BQUC 5I6PA 1AR1C 1NGZA 2FJUB 3KEDA 4FG2A 2A9ML 4ZUSA 1YYLH 3ARBA 5DMKA 2HT2C 4P2QE 4R8WL 5BRZB 3CQQA 3BCFA 3TV8A 4YDLC 4I7ZC 4R83A 1PX3A 2XTJC 3ARWA 1BBJA 5FUZH 2VM3A 4RWYL 3MV11 5DS1A 4J2QA 4CW1A 4P9HH 3QJHA 1WEJH 3QDJB 5EBLA 4Z3GA 1WS7A 3CC1A 3P77B 3BAJA 3B4NA 1SHWA 2JKLA 3QCUH 4YDIH 4YUEL 3ZE1E 1FO0L 3EDKA 4CNIB 3W39A 1UEMA 4PB0H 4FOMA 3S8WA 5BJTA 3UZVB 2K70A 3IFNL 4PREB 5B22A 3VWKC 3ULUD 3T0VA 1CDCA 2DQGH 5H4ZA 4WK2B 2CLVB 3LNDA 4GUQA 1CT8A 4OH2A 1MVUB 3N9GL 1IQWH 4K8RC 1LO5B 3N41F 3S35H 3HG0A 4KU1A 1JNNH 3L7FB 4BGLA 1IEHA 1HQ4A 3CVHL 2NTFA 4QHNA 4BFBD 4FQHB 2VN5A 4UM9A 1N4XL 3JTSA 3MNWA 5I0WA 3NJMA 4AQEA 2Q3AA 4PJAA 4MMYB 2FX7L 4RA0C 2E9BA 2YD4A 3BPNC 3U6RA 4KKCC 1WAPA 5E1GA 4HXAH 2V2WB 4A7GF 1QFOA 4LCIL 2ADYA 3OMAB 3SOTA 1QACA 2BC4A 2ITEA 1UWGH 3BMWA 3HG1D 3M86A 2XYBA 3KR3H 4JPVL 4JKMA 4OD3L 4XWGL 3UAAA 2YAEA 2AJZB 4L3ED 2F7PA 2EICA 5DJXB 3F83A 5HGDB 1L0PA 1FL5A 4GEIA 2D0HA 2HKFL 4QRPD 1ZWIB 4P5KA 1T83C 2HLFD 3VNZA 4ABQA 32C2A 1FLTX 3KXFE 3HAEH 4UILL 1RJZB 1TTFA 1IC4L 4NZRH 1ECZA 4CC0A 4HMEA 5KSAB 1FNGB 3PGFH 1XGQA 5E5MA 3V7MA 5AVZB 5GS2H 2BO0A 2Y3NA 2A6IA 3OLGA 4GRLD 1FE8L 4OLZL 1KCRH 3I9AA 3V5KB 1QUPA 3U1QA 3BWSA 1U33A 2FT8A 5DQDH 4KTEH 3HG5A 4KI1A 4HQQH 2YOCA 2UYLA 3CZFB 3SJVA 4JO2H 1OWWA 2ATKA 3U1PA 1LP9A 3II1A 4YLBA 4IRSC 3QNZB 1QBML 3JWNC 1JV2B 4GLRI 5FCSH 4WUKL 1TMCB 5E7FA 1VPOH 1WCQA 3IDMA 5I1KL 4Y9GA 2FVNA 1LO2H 1MG2C 3CGTA 4K3DL 3PQYB 4OZHA 3RA7H 5CEZL 4S0HA 3ZMRA 4GXFA 4UANA 4DTGL 1VEPA 5HI5D 2OKMA 2KZKA 2X4RB 3CN1A 4JY5L 3T2QA 3TV3L 1OF2B 1E90A 4ENEC 4F58L 4KK8D 2GTWB 1GZHC 4WDIB 3DUSB 1OCRB 2CRYA 2XWRA 2UVFA 2WWOA 1RCYA 4R5TA 4PHZA 4OJCA 2AQNA 2PR4L 3D9AH 3OJDA 3U4BH 2O61A 3AA1B 3VRLE 3W9DA 1HKLH 1Q9KA 2QVFB 5E99H 3VGGA 5MERA 1FNLA 1LO4L 1QFPA 5F1IB 3RWFA 4F2ME 5ADXK 5B1BB 1EFXA 2FYVA 3W0WD 2B1AL 4AQ1A 4YSSA 1BW8A 2ZXGA 3FQYA 4XVUC 3KDMB 1OCCB 1BH3A 1WISA 2H9GA 4FCAA 3X13A 1G9EA 2L7EA 2DB8A 4MAUL 5A2LH 4IGBC 4LDLB 4GG6E 4DQOH 1A0QL 5ABDE 2Q2EB 4RDBA 1QJPA 1W80A 2C3XA 3QQ4A 3T8XB 1M7IB 2YPLE 1EK3A 3T9WA 3ZMEA 3A0HO 5EO1A 4HS3B 4XH2A 2ZKYA 1FZKB 3GI9L 2FYYB 2WNGA 2PCYA 1HNYA 2DQJH 5T3ZD 5CJXA 4DGYH 5EUOE 3GIZL 4PUBL 4RESB 4TS6A 5FO9B 5J11C 3UERA 2DF3A 3P73A 4NKIL 1TPXC 2SEBA 3DURB 4R5VA 4HGKC 1CU4L 1ZMYA 1I9JL 2ZJSL 3CZEA 2J1XA 2J8UA 1RSYA 2CJTA 2VGLM 2E47A 2R0LH 5FHBL 4ZW3A 2ZXQA 4MNGA 4RDQG 4AW4A 3ZTJG 3UL4A 4GLRH 4PBWD 5C0AA 3DBXA 1E54A 3PV6B 2QQKL 5TE6L 4HCRH 4XMVA 5GRUL 1NA8A 4F37F 1R46A 3ROLB 4BSWA 1DJIA 5JZ7D 4PW9A 3UBHA 3WLWC 2K7QA 4PRHD 4C69X 1XGTA 1RZ8A 5C09E 3VXTB 4JPIA 5KS9E 2BS71 2OV0A 1NDTA 3VG0L 4MD5B 4PWEA 3VD9A 3LZRA 1CLOH 3JV6B 1CFQB 4FZNA 2IG2H 3KPNA 3D3VB 1JGVH 3DK2A 3DV6A 3IFLL 3JV5A 3SB3A 4HF5L 5ITFA 2VE6A 2PP7A 5CJOH 4HMCA 4JFXB 2F7OA 5ALCL 3SPCA 4IKIA 1TQVA 1UB6A 4KV5F 2Z1KA 1PLGH 1UOVA 3QVAA 4N26A 3ULVC 4N22A 3GI9H 4MTMA 3C9NA 3S88L 5DA0B 1JGEA 1ORMA 2XTRA 4ZNEA 1DEEB 2ZFGA 4AEIL 2NCMA 2K6YA 1JV5B 4GUCA 5JO5B 3WIIH 3X14B 4QWWC 2F58H 3MBED 1R5VB 3S3DB 1UTDA 1YEGL 4J27A 3HI6L 1A9BA 4JO8A 1XCWA 1GPOL 1BQLH 3AT0A 4N68A 3OMNB 2OI9C 4GKLA 4NP4L 4OCNC 1S7TA 2H2SC 1U3ZA 3CUPB 4ELKA 3K2IA 2WKGA 4AXWB 4ENED 1RUKL 5MP6H 1I1YB 3VXQB 4KH2A 3ZDXE 1K3IA 1ZVSB 2K0RA 4WUUD 1IX2A 2WXRA 4LNRA 2X42A 2XN9B 3CH8A 1XXDC 4CVZB 2HKAA 1CGWA 2EJ1A 5CLTA 5D1XE 4PRID 1T1YB 5TTRA 2DPKA 3X17A 4TNEA 3CVIH 2WUCL 5DJYA 1NGZB 2XA8L 4HGWB 1FGVL 2ICWI 4R0LA 3GBNH 4ZUSB 1P53A 2VT0A 3QIUD 3BKMH 3VXSE 1R5IA 1Z66A 3PPEA 3IMUA 3F7RA 4PUXA 4M9PA 4M4PA 1KEMH 2C3WA 3BT2L 3WNPA 4F1ZA 1SGKA 2AGJL 1BBJB 2BWDA 2A99A 2Z92A 5D4QA 1EHLH 5AOZA 1TDQA 3QDJA 5EBLB 4B0MB 1HILA 2AFNA 3QUHA 3TA4D 4OLUH 4NJAL 4CNIA 4UNVA 3TYGH 3H7LA 3W39B 3UYOD 4LVHB 4Y9FA 2X9XA 1JNNL 5IB1B 1D5RA 1U95B 5JIHA 2DS4A 3UZVA 5BJTB 3KPOB 4ADIA 2MQGA 2CLVA 1CT8B 3NABL 2ZUQC 3LK2A 1IVLA 1HE8A 3O4LA 2WCSA 3EUUA 3F7PC 4FI7A 1JF6A 3WTTA 1DUZB 5E51A 1LWRA 1ZHNA 2FECL 4TQEH 2QPEB 1R3IH 3BYTA 4MNQE 1L5GB 2NTFB 4QHNB 5L4MA 4FQHA 3P0VL 1UXSB 3JTSB 3KPSB 4L3FA 5FGSA 4XBMA 3MV7D 4KDVA 2IDSA 2ZUXA 4MMYA 2VDKB 1BVNT 3D39E 4F2MA 4LCWA 5D1QB 5LG6A 4UB0L 3FT0A 1RVFH 4KQ4L 4RMSA 5AW6B 4GRWE 5HHVL 3DJRA 3U0WH 5GGVH 2Z93A 4JZNB 1L9MA 2OJZL 1KIRB 2NDFA 5HBBA 4NXSA 2PRNA 3PABA 4HWBA 5EIIB 4ZFGH 1J1XL 5KVFE 1N6QL 5B5EO 4KJQD 2YRLA 3S2AA 4IHOB 4HBCL 1TJIL 1TVDA 2YBRA 3N42B 5DJXA 1FZOB 2DD8L 2OS7A 4LSPL 1P4IH 5L0QB 2X1XR 1V3JA 4ZW8A 2Z7ZA 1B0RB 3NTCL 4ECNA 1ZTXE 2XTJB 3GLDA 1QSEB 2IPTH 5K33A 4GP5B 2BLFA 4YXLH 5KSAA 3CSYB 4K07A 4KDTA 4J7RA 4M3HA 4RMUA 3RJOA 5DD6B 2A6IB 4NUJA 3RUGE 3M17B 4HMDA 2R4PA 3V5KA 4KHTH 4ZSOE 1JTOA 1KENL 2VXUH 1N9PA 2X40A 3CZFA 1E2ZA 2DW5A 4GY4A 3SJVB 4LVEA 3JWNG 4DKAA 2ATKB 3AQDA 3H3KA 3L1GA 3QNZA 3LZFH 1TO5A 1U3HC 4JFFD 1JV2A 1XQ4A 3NPSC 5KVEE 4HPOH 3B34A 1OAQH 2ZD0A 5JIQA 2FEDD 1UZ8B 2F1BA 3PQYA 4ODUB 1IC1A 1QKZH 4MFHA 3OX8A 1RUQH 3N85L 5DFTA 2X3AA 4XCCL 4WDIA 4C4KT 1H19A 1PKOA 2C7UA 1XF2A 3DGDA 1BX2A 1V3KA 2NUPB 4FLSA 3RWCA 3E8VA 2O61B 1C5DA 5BS0D 5JOPD 3AA7B 4BUHA 2AITA 2D7OA 3QQDB 3W9DB 4MXQD 2GC4C 5D6DA 3TTYA 4QIRA 4W9JC 3SDDB 3F04A 5F1IA 2ATPB 2VH5H 2AHIA 1BV8A 3W1ZA 1EFXB 4AQ1B 1OM3L 3E1ZA 2H7WA 2H9GB 3CPUA 1KZQA 3BRDA 5TJWK 4AVIA 4XHJD 2EC9T 3UAFA 4HS6A 1OPGH 1AS6A 3QQ4B 2BIHA 4FFVD 3T8XA 3NZHH 1EVTC 1N8ZB 1IGFH 1Q1JH 4WI7A 1H3VA 5EO1B 3K46A 3LZLA 4O51A 5HGHA 4OZIF 1FZKA 1YJDL 2FYYA 1IGIH 4W93A 3O6FB 1QO3A 2VDMH 1G7QA 1IGCL 2B39A 4LKXB 3ESUF 3BDYH 3RAJH 3BE1H 3B9AA 4DP9X 1BF2A 1CE6A 1OOWA 2WBWB 2BIMA 2M06A 3CXDL 4U2YA 4M62H 5FO9A 1OGAE 4NX0A 5HYFA 3VY9X 1CBJA 3T71A 5AVUB 2SEBB 2BY0A 1XF5B 2FBOJ 4HIEA 2CD0A 2J8UB 4X7FC 4RGMC 1I3VA 4FFZH 1AVAA 1B3IA 2FB4L 4BFOA 4N0YH 5LBSL 4UZUA 1HWWA 3T2NL 3N3EA 1J5OH 5C0AB 3DBXB 3LKPA 4QY8B 2EEFA 5AFUL 3V5HB 2EDRA 2R15A 6FABL 4PJ0O 4LAQH 4JRFA 1OSEA 2LABA 4UTAH 2V3FA 2YARA 4BSWB 1HHJA 5HVHB 1LEGA 3ULVF 3EYQD 2WYZA 1XGTB 3B9VA 4JVWA 5DZ9A 2Z31B 3ETSA 3R1GH 3MVSA 2R89A 1KJ2H 1WZ1H 2ZOTA 2ZTBA 4ZO8A 3FQXB 1PAZA 2Y1ZA 1FH2A 5M94B 4EI5C 5SWSE 3DV6B 2CH8A 4N5ED 4LKCB 2VE6B 4W9KC 4NKIH 4JFXA 1NC2B 1VHPA 3MA9H 4OGXH 1BPVA 1UB6B 4H8UA 2PPDA 4CMHB 2EQDA 3HG4A 3CXFA 4IGBB 3II3A 3C08H 4PGZA 2XUWA 1JGEB 4I2XA 1GPOH 4JMNA 5E70A 1DEEA 1QNZL 5GGQL 3EDEA 3EYUL 2ORBH 1TO4A 1JV5A 1NCOA 3HN3A 3DC0A 3M7OA 3IU4L 1TKWB 3MDJA 4RMQA 4O02A 2E86A 1HAUA 2JTDA 3TT1L 2Y07L 1WFOA 3BX7C 5J89A 4EXPX 1MG3C 3B7SA 1HXUA 4O2CA 3QIBD 1BFOA 2YPLB 1KNOB 2VDRB 3MYZA 4JFDD 4XC3H 3KZIO 1S7TB 2OR9L 3MJ9L 1TPXB 1RZQA 4PJBF 1ZLVK 4ELKB 2WTPA 3AQXA 4AXWA 1GYAA 1W9XA 2C9VA 1J0HA 2O1AA 1SXNA 4N8UA 5C1MB 1CLOL 3HZKB 5JHLL 1ZVSA 3MC0A 3U36A 5SV3A 5IMLA 4UNTA 3WTSA 2XN9A 4ATTA 5IVNA 4NDMA 4BKLA 1T1YA 2WCGA 4NRZA 2J12B 4PCTA 5GS0C 3TJEH 5DJYB 4HGWA 2AERT 1WVZA 4R0LB 3MV8A 2B1AH 3L2LA 3WI9A 1R5IB 1HSBA 5C6WH 3QJFB 4ISVB 5I0DA 5ABZA 3BFQG 3L1EA 3AG2B 3N43B 2Z92B 4MB5A 3O0LA 3EGXB 2NT1A 1VZIA 4YDMA 1U8LA 4L8SC 2ATAA 2RB8A 1HILB 4LOFA 4HS8L 1JPSL 1ROCA 4MJIA 4AZ8B 1FDLL 2K8MA 3BH9A 2VIRA 4DETA 4LOUC 4DGYL 5IB1A 1U95A 3WJJC 2B1OA 3KPOA 1W16A 1UH4A 1IGTB 1M6OB 2FWLB 4N2CA 3LK2B 3O4LB 2W5PA 5FGBA 2IWEA 4PG2C 5J8OA 5F8RC 1DUZA 1OGPA 1ZHNB 3EJCA 1L5GA 4G8EB 5D7JD 3UROR 3ECUA 2BVTA 1UXSA 5GRUH 2V5SA 3VA6A 3KPSA 4FNSA 1L7TH 4LSUH 1BQHG 3S37H 1GZQA 1H9VA 2VDOH 3BZ5A 2EUZA 1PKQE 4N1CA 1IFHH 2O72A 2AVFA 4F2MB 4LCWB 5D1QA 4K7PY 4ZODA 1DQDL 3AA6B 2NPLX 1Q0XH 1PHOA 1RSFA 3JXAA 2WHVA 3IFLH 4XNUL 5CGTA 3RLSA 2Z93B 4JZNA 3NIGB 5HPMA 1KIRA 4LSPH 1BQKA 3PABB 2QHRL 5AAPA 1VCAA 2YSTA 1MCOL 1N64H 4ERSH 4IHOA 4MJID 2YBRB 4QMEA 3GIVA 4QYAA 2F74A 3MRCB 2V6HA 1E8YA 1FZOA 4TMPA 3ZKQD 5L7XH 3DI2B 1A7PH 1GW0A 3QIWD 2VR6A 1CMOA 3OKEB 2J8OA 1OP4A 3QFGA 5HHMB 1B0RA 4KHXL 4LB8A 3ZHNA 4AYBA 1QSEA 1A64A 2X1WL 2MWCA 5BV7H 2YRBA 3PQSA 3MLSL 4OJYA 3CSYA 5DQ9A 5ICZB 2MTAA 3V0HA 5DD6A 1SY6A 4NUJB 4K9EH 3M17A 4BGDA 5JDSB 4QJ3B 1MNNA 4LBEB 5FUCC 3IB4A 3WEBA 3R06B 3V6OE 1NLDH 3EO9H 4JM2D 4P05A 3VD1A 3V4VL 3TCTA 5HSFA 2ZUQB 2FX9H 4L5FE 4NFCA 3RWEB 2D7NA 1AQKH 1I3GH 4LLMA 4Y5XA 4ZMPA 2ARWA 4HJ0C 4JHWH 4KKCD 4WFHD 1QSFD 3VU2A 1PLAA 1UZ8A 3MRKB 4IJ3C 1PBYA 1RP9A 2MNJB 2VLRA 4ODUA 4FXGC 5FM5M 1WH0A 4O4XA 2CM6A 4MAYD 5EBWB 5GRYA 2YXMA 2YSSB 3OX8B 1U93A 4P3CL 3J27A 3V10A 4P2CG 2C7UB 3V0JA 1XF2B 3AUVA 1BX2B 2NUPA 2OQJA 1QFWL 3RWCB 1E65A 3GEWB 2BSDA 1C5DB 3BT2H 1DVYA 3AA7A 1M42A 3QQDA 1VAHA 3FCGA 5KANI 3RURA 1HH9A 3PFQA 4GYBA 3NJVA 3SDDA 2ATPA 1ZGLA 4JUTA 3Q05A 1PIFA 2VXSH 4ZMVA 3OD3A 2XPGA 4BUGA 1BVOA 3LNFA 4ZW5A 4NQXB 3G7GA 4HKBB 3DGCR 1BXUA 4O2EB 3T1FB 3D8MA 3ESPA 4HS6B 2F54D 3ATEA 2CHWA 1N8ZA 3W81A 3Q9QA 5HGHB 1PZSA 1NLBL 3MNMA 4FX5A 4MQSB 2XN1A 4O51B 2I60L 4OKDA 1FDLH 4OZGA 3O6FA 5AW7B 1QO3B 1G7QB 3Q13A 4LKXA 4FNLH 2MIZA 4KBPA 4Q4IA 3SKJL 1CE6B 5CZVL 1O6TA 2YAPA 4MJHA 2NY1C 2B9AA 1MRDH 2FX9L 3CZUB 3B2XA 1H6FA 5B1JA 3MUHL 4KNTA 2VDNH 1SBBA 1J5CA 3JVGA 1EZLA 1XF5A 5BZWA 3VX1A 4HIEB 3HC4H 5KAQG 5LKNA 3AFLA 4MA8H 3LK3B 4XN8A 4JPKH 4W9IC 2QFRA 3VI3F 3I85A 3NPSB 1OEZW 1BM3L 3LKPB 4QY8A 5DL6A 4JREC 2X4QB 3V5HA 4R97C 1JZFA 1LLAA 1UURA 3JCUO 4ANVA 1HHJB 1LEGB 1IARB 5TFSH 1AG6A 4MDIA 1JZ5A 2Z31A 2UXTA 4CN1A 1LE5B 1RU9L 2F54B 3GBEA 1SOQA 3FQXA 2QPFA 4WIQA 4WSJA 2QTEA 1ZS2A 4LKCA 5IHZB 1NC2A 3LZOA 1HXYB 4AQ1C 3B83A 3PRZA 4NWUL 4ZX4A 3WUWA 2X1PA 4IGBA 1UM5H 4HWZB 2BZ7A 4MXVF 4I2XB 2ZWLT 5ANMA 3QDMB 3SYOA 3UEQA 2IXQB 1H9DA 4BWUA 4LLWB 4BFKA 1FF5A 1H6UA 1TKWA 3VD5A 3I50L 4O02B 4RQQA 3V0VB 1RZKL 1NCDL 3ECQA 1EHNA 3CFEA 1SDAB 4OZGE 1QG3A 4O2CB 3Q1SL 1BFOB 2YPLA 3TN0D 1VENA 4O5LH 1KNOA 1A8ZA 1UZ6E 5J4MA 3KPRD 4XO8A 1KT2B 4AM0Q 5HD8D 4J3TA 4O3YA 4MASA 1UENA 5C08A 2WCPA 4LARH 2YQ2A 1P6FA 4Q4EA 1LO2L 1TVBB 3CFBA 3HZKA 3NIDE 4NNXB 5DZLA 3VUAA 1TQCB 4ZI8A 3U36B 5C0FB 5IMLB 2DQUL 3DJ9A 2XWXA 4LQFH 1NKOA 4NDMB 4R7NA 3EW3B 4BKLB 3STLA 3GSQA 5CCKH 3CDFA 5JR1L 3FMGL 4H2CA 4IJTA 4NRZB 1F86A 2ZSWB 4RA3A 1YNTF 4KITB 3UEZA 3AM8A 1G9NH 3MV8B 2OA9A 3NJKA 2A0LC 1HSBB 3OJ2C 3QJFA 3BWAB 3C60C 4ISVA 1HT6A 5IR1B 2IDFA 3MA7B 4G71B 2WD0A 3ZUCA 2C4FT 2XNAB 2WXJA 2JJTC 2V9TA 1KWGA 3EGXA 1FZJA 3HE7B 1U8LB 1J0IA 4XN7A 3T5WA 2EABA 4KVNL 2LFUA 2QLVB 4MJIB 4AZ8A 5IW6A 2V5MA 1QATA 3AJ7A 3C2AL 2X4TA 3BH9B 4QLWA 2VIRB 4RX4D 4XB7A 3V95A 5MEPA 1ES0B 1Z6JT 3L1OH 3EFDL 1AE6H 2HFFA 5HDQL 2M8XA 1U9KA 3NCCB 1TQSA 3C87A 1WT5A 1IGTA 1M6OA 1R1CA 3GXNA 4F8LA 3MGAA 1A7OL 1EMTH 5FWRA 1J5OL 1TQTA 1MDAA 5DD0L 3WS6A 1BAFH 2HX7A 4QHPA 4ABVA 4G8EA 1T1WA 2WOYA 2FB4H 3DMMD 3KXFA 4OTXL 1F4YL 3IRCA 2VERA 4LL9A 5DD5L 3RPKA 2FK9A 2J6EA 4RAHA 4Y4KD 3ZUNC 4N85A 1GZQB 3CFCH 1UD5A 1ZDQA 3O2DH 4EUPH 2EO9A 3RU8H 4Q58C 4Z5RB 3GPEA 3KLAB 5I8OH 2JF1A 5JNYB 1T04A 3WD5H 1WD8A 1CXKA 4M6OH 3AA6A 5IEKB 4G9FA 4WENB 4UT9A 2CXKA 3FHQA 5HPMB 3F6IA 2YGNA 1S78C 4Y88A 1I3GL 2ZWNA 4AOFA 1FNSL 1KJ2L 3RBHA 5HHOD 3SYCA 5ISZE 5IKCA 3GHBL 5A2BA 2CG9X 5EU3B 3EJYC 4ZMLA 1Q0YL 2RBLA 4NAQA 4AGPA 3GIVB 2F74B 3MRCA 1D5BB 5MHSE 2PWEA 4JPVH 4FJYA 1FH5L 4G5ZH 4FQJL 4I4WA 5T1MA 2ICWA 1ZK9A 2AJVH 1UM6L 3OKEA 5IVZA 3QJZA 3IBOA 4U0QB 3SZVA 4ONGL 2AI0H 2ZAGA 3K4ZA 4KO5A 4M3JA 1S7WB 5DQ9B 4FC3E 4HQQL 5ICZA 2WZ0A 1YQVH 2Y72A 2EYRB 4WI3A 4UOW1 5JDSA 3CQPA 5FV2A 3EUDA 2Z3FA 4ATWA 4LBEA 4YHPA 4U6VL 4QOKE 2C8NA 4XCEB 3R06A 2CO7B 5B4MC 1NUGA 3FFOA 3KCPA 1GIGL 4JQIL 3WLBA 2AQQA 1ERNA 1X9QA 4DTGH 3RWEA 1JF1B 1WCBB 4LLMB 4Y5XB 5C6TH 3CFCL 1WG3A 5LXGH 2V17L 3MRKA 4EBQH 3EF4A 2VLRB 1CTNA 3Q1SH 4NPYA 1QSFE 4HLJA 4I0PC 4N2MA 3NH7H 4TL4A 2AV7B 2DQDH 5EBWA 5B21A 4YEFA 2YSSA 1U93B 1JMXA 4ZD3H 5KVEH 4G80A 5D7IA 4P9MH 5G4MA 4KKAD 2OQJB 2ICWJ 3VYPA 3WN6A 5JOFB 4PEEA 4PJGF 1X5YA 1HH9B 4N0RA 1ZGLB 5DHEA 1KLGA 2YXFA 4FRWA 2HJLB 4KRLB 4F8QA 4WHDA 3X1EA 4ABWA 4N58A 3J07A 2NY4C 3FCUB 2XPGB 3J2PA 4NQXA 3QXWA 2HXAA 4HKBA 4J6IA 3MYJA 5KYUB 4O2EA 3T1FA 3MXWH 4N2EA 4OGYL 1NCAL 1MCJA 3GIZH 4PVLA 2YAMA 1DBAH 5T3XL 2FAUA 3S35L 2Q0ZX 4MMZB 4DGUA 2GBUA 5PRNA 3RPBA 4OZGB 1MOEA 5AWNH 4B7IA 5KW9H 2Z9TA 4KDTC 4JJOA 4DP7X 4FQXD 1ZHLB 1R47A 3W5MA 4MD0B 4GEJA 3VW3H 2YD7A 3DZMA 3I3DA 5E8DH 1BP3B 4ZQKB 1RK0A 3AXLA 2VMEA 1G5GA 5E24E 5BZWB 3G9VA 3I3BA 1U8MA 1MLBA 1WWBX 1ACXA 2WZ6A 2NYKA 2DWDA 3LK3A 4GBXA 1VEMA 1KTKE 4RJXA 4FHBD 2HMID 2XXFA 3DDGA 3SDXF 5E6IC 1JZ3A 4ZMAT 4JFTA 2F7RA 2PCFA 1Y1DA 1N64L 2X4QA 2E0PA 4ERSL 7PAZA 2R2BA 1FPTL 3LN5B 4Y2DD 5LB1A 4M6OL 2NXZB 3M8OL 4XVJH 4AV5A 3E6HB 1BA9A 4MDIB 3CSPA 3LZNA 1MWAL 2XN9E 3KYOB 4GOSA 4AM0B 5T5NF 1TLMA 1LE5A 2F54A 4NIKB 3K5RA 4LRIC 1XH3B 3IWUA 3OGCA 5IHZA 4M4RA 3K8LA 1HXYA 5IGXH 35C8L 2BP0B 3FTXA 1GS7A 5FAAA 4XP1H 2Z7WA 3WUWB 3FMGH 4HWZA 1FG9C 4HP5A 5ANMB 4ZUWB 3VD7A 1EHXA 3QDMA 4LLDB 1FCGA 2IXQA 3H3BC 1R4XA 5IOPB 5I30H 4LLWA 1J1PL 2DJUA 2Q86B 3NIFB 3VG9B 5GRWA 2ZKWA 4RQQB 3V0VA 5CSGA 3CFEB 1KCUH 3M88A 4PRPE 3AB0B 5IQ9B 4V2BA 3HCVB 2EVHA 1KT2A 3AC0A 4Q7DA 4YVNA 2YLKA 3KLSA 1XDTT 4CSPA 5FYJD 3X3FH 5C08B 4Q6KA 4I77L 2NNAB 2NY5L 1VEOA 1TVBA 3CFBB 4L1BA 4NNXA 4AJ0A 4P9HL 5C0FA 1HOEA 1KFGA 2IGLA 5DMGD 3P0YL 4R7NB 3K0WA 5L4FA 1Z7JA 4JPQA 3STLB 1F3DH 1W0YT 3GSQB 1CWVA 3TS8A 2AK4E 3ARVA 4Z3EA 2ZSWA 3KGUA 3ISYA 1ODUA 1XV8A 4P46B 2MSPA 1MXDA 2ED6A 3K2UH 3CPLA 2DIBA 5KTEH 3LRLA 2R0KH 1HSAB 3SD5A 1WZKA 4XE0A 4PJEE 3BWAA 5SWZA 1ITCA 3FFCE 3UAJD 3MA7A 5IR1A 1JYXA 1OAKH 4L8SA 2XNAA 1PZ3A 1PVHA 2UZIH 1IKOP 1FZJB 4DPRA 3HE7A 3AABA 1TTCA 3HZYA 2H4EA 2CJ3A 4FQXC 5GGVL 4RLCA 5E9AA 5IW6B 4G42A 5G3AA 1MPAL 2XU9A 2X4TB 4HD5A 4CL7A 5JXEC 2A6DB 2XHNA 1S46A 1OSZB 1TFHA 2YWZA 5MEPB 1ES0A 1OGAA 1RULH 1IFRA 1V27A 3QUZD 4BINA 2QQLH 3SE4A 2HFFB 3KPRA 4JL1A 1A0QH 2Z6FA 4F24A 1SXAA 2D3VA 2Z7YA 3UTTA 1B2WL 2GW5A 4U6HB 5FO7A 2ZCLH 3DUUB 4M29A 3S37X 2A7BA 1OSYA 2WUCH 3NZ8A 3OKOB 4ABUA 5DRXB 2XWZA 1T1WB 3KXFB 1WTLA 2X9WA 3BUQA 3KPQB 1QI5A 3CIAA 5GRXG 1E4WH 3GKWH 3UTPD 4D0CA 3UU2A 2XSKA 2WB1A 2PORA 4Z5RA 3KLAA 1ED3A 4K8RH 5JNYA 1QSFB 1T04B 1ZV5A 3QEQB 4J4PA 4TUJB 4Y5VB 5JMOC 5IEKA 4N9OB 4G9FB 1QYGL 4X5PA 3FBKA 1A22B 3EJJX 3PDGA 4NZTH 4JKPL 4Y8DC 3UC2A 4ETQB 1XWVA 2XVBA 4X9FA 5DLLA 4ZZKA 5IKCB 3ARDD 1B9ZA 4FQLH 5EU3A 5DJAA 5LCVL 2EIJB 4E42B 5L0QC 4LPUA 3ESMA 4TULL 5INCA 4JO2L 1WFJA 1D5BA 2NXYD 3TA3D 2DQ6A 4PV1C 4LESA 4I4WB 1JRHH 5T1MB 3PQYE 4ZAKB 2ICWB 2QGEA 3CMOH 1TSRA 5IVZB 3HAEA 4XP9H 3WNKA 5LVEA 3ZRSA 2Z8RA 1QW8A 1TZIB 2WQRA 5B7FA 1D7DA 1DVSA 3P0VH 1S7WA 4NKDB 4G5ZL 3DKHA 4R26H 2VLLA 2J6EH 5F7FA 2EYRA 5F1NA 4JCHA 1HH6B 5IK3A 3ZKSD 2Q1EA 3ECVA 2CHNA 3WIHA 3FYIB 5KVFL 4YHPB 1EO5A 1LQBC 4XCEA 2CO7A 4JL2A 5T3ZL 1S5HB 3ZTEA 3KCPB 5CILH 3WLBB 5HVFB 1OP5H 4DAGL 4FTVD 1KN2H 1JF1A 2WMPB 1WCBA 3KLDA 4G43B 1N6QH 3MRIA 3GEFA 4AYEC 2GSGA 3U9PL 5EB9A 1N6VA 5I5MA 1BZDA 1ZTXL 3FTYA 3HI6H 3LV3A 4NPYB 4AGOA 4YGAB 1IZKA 2AV7A 4FYRA 2IFGA 3WELA 4IOIA 3AA0B 3SKNB 4JHAH 4G80B 5D7IB 3GNMH 4TLUA 5EOQL 4K71C 4O49A 5JOFA 4OF0A 3O0EA 1CLVA 2WBJC 3UP1A 4BA0A 4I18C 1KLGB 4HIHB 4YFLF 5IOKA 1JZ7A 2OL3L 2HJLA 1NCAH 4HSQA 4UIKL 4I3RL 3BLBA 3UTTE 4ACPA 4RLBA 3JWDH 4HYTB 3DX4A 3MYJB 5KYUA 3WXWL 2ERJB 3LZFL 3O6KH 5FM5O 2MHLA 2X5PA 2L7UA 2VMDA 4X9IA 3S48A 4MMZA 3TPUA 3OHMB 4A2FA 2A83B 1ADQH 2HLAB 1ZHLA 4RFNC 1CGTA 6PRNA 4PD4K 4ZFZA 4MD0A 2ZWSA 3JVGC 3D30A 3GBDA 3GDCA 3O11A 4WI4A 5E4AA 4ZQKA 3T2NH 1RK0B 3AXLB 4DP4X 3AVEA 4HT1H 4J1UA 4NUMA 3L4CA 1JZ8A 4C4BA 1CDBA 1NWOA 1U8MB 1MLBB 2IBGA 3LRMA 3C09B 3QORD 4H0GA 4P2RA 5CU9A 2DWDB 3JVFC 4GBXB 1P84J 1N70A 4NGHL 2AQ1A 4Y19D 5IT2H 1QKZL 3AS3A 3ABLB 4QRTA 5A43C 1SHSA 1BZQK 3C6LA 2PCFB 1AZUA 3JT2A 1S7SB 3OZ9L 4XMLH 3RX7A 4CVWA 5HYQA 2WY3B 3FQ1A 5JHDE 2K7PA 4S2SB 2R2BB 2EVJA 2ZP9A 3TF7C 3LN5A 3IMRA 3ASNB 2H32H 4M7KL 3GKWL 5FYLH 3E6HA 4M03A 2WWMD 4W9HC 3PHQA 3P69A 4Y4HC 4ZTOH 4HIPA 4X6BB 5JTWA 1R3KB 3KYOA 1FO0B 4MYWB 5F7HA 2G9HA 4AM0A 1FLRH 1MFCL 3C8KB 4ONGH 1E8WA 3HZVA 2B77A 4DPBX 4L8DB 2CDGA 1CD1A 1XH3A 3OGCB 4M4RB 4CMHC 4URTB 2BP0A 1ZSDB 5DF0A 1AY1L 3C60D 4PI0A 5KEZA 2OYPA 3V0EA 2GTZA 4Q74A 5I1AA 3LXCA 5ADOH 3GINA 4ZUWA 3VX0A 4LLDA 3S96A 3OPZH 2W9EL 3QZPA 4KOCA 1ET7A 5IOPA 2YS4A 3L5HA 3REWA 1NAKH 4MMZC 2Q86A 2Y6TE 4QGTA 3L81A 4M8QB 3P02A 1G4RA 1G1CA 1YA5A 3BAEL 4D3CL 2VLJE 1GIGH 2WIIA 4JQIH 3VO0A 2LVCA 3EBGA 4CDHA 1A7RH 5IQ9A 5JQIB 1F18A 2UWEE 5B1JC 3HCVA 2HTLC 3P3UA 4X4KA 3UMNA 4FQPA 3ILDA 4NO0D 4GI9A 3N06B 1BJ1J 2CIKB 3IBEA 3INUL 3DIFB 4PJIB 2NY3B 3H3PH 2BNQE 2NNAA 2DJMA 4DUVA 1YS5A 3QPXL 5KOVC 2KZ7A 1GS6X 5DVOA 5AQ0A 5KVDH 2VLKD 3BSHA 2XPYA 4PS3A 4ZXBD 1M53A 2APXA 5DC9B 3FUDA 4KJPD 4W1TA 1JXKA 1SOKA 3WO4C 1S3KL 1UUSA 2IJ0C 4GXUN 3ABZA 2AJXH 1X6LA 3D18A 3V0GA 5FYLD 1C16B 4H1LG 4WFED 3NCJH 4P46A 2B4CH 1F02I 3CPLB 1HSAA 3X12A 2H0PA 3IDGA 4EZKA 2O6FA 4UMSA 1E4WL 4LCWD 1E28B 5SWZB 5A6LA 3VQ1C 1ZHBB 1DHKA 3RY6A 1J12A 5FC9A 4L8SB 1KCUL 4OF6A 5ECGA 2PN5A 1T6BX 4Z7UA 3TF4A 3HZYB 4TNFA 2FLBT 2W9EH 3CN3A 3L9YA 3V4PB 4XWOD 2KERA 1DLHA 1SZNA 4JK0D 3NA9H 3VSTA 1FGNL 2X53A 3HS8A 4G42B 1OPOA 2DYRB 4L2LA 2A6DA 4MMXC 3RGVB 1OSZA 1BYPA 1U92B 2X89D 1OGAB 2FTAA 4WJG3 5AW0B 4DKEL 1AH1A 2QQQA 3QQNA 3KPRB 1WP6A 3CLFH 4KXBA 3UTTB 4U6HA 3T08A 3O3EA 4P23B 4F15C 5FO7B 3UTSA 1BEYH 4XC1L 4JFVA 3DUUA 1U8JB 5IIEB 5T5FA 3NZ8B 4NNPH 3OKOA 5DRXA 3O6LH 2W0KA 4A67A 1LE9A 5DT1L 4I3SL 1OT2A 1RPQA 1XB3A 2CUHA 3O8XD 1IM9B 3PGFL 1T0PB 3KPQA 4MGXA 4Q0XL 3CBJB 3CXDH 1ACZA 2IDUA 4XVJL 4D0CB 4PQXA 1TFPA 4DP6X 2D73A 3L9RA 3TH2T 5KVFH 4KRMB 5DC0A 2EC8A 3TBSB 2BSSB 4M61B 5CGMA 1ED3B 5K69A 5ESAB 4XMUA 3GBML 1QSFA 4TUJA 3QEQA 2FWUA 4Y5VA 3Q5TA 3THML 1B4RA 4AVKA 3V4VH 4NGHH 5EE2A 3HNSL 1KB9J 1PW3A 4ETQA 1MWOA 2X28A 2F5BL 2ZXAA 1ZE3H 2H1PL 1DO6A 3FH8A 4KAQH 3KWWB 4GPVA 5DJAB 4XCFH 2O5ZH 4E42A 1YEIL 4MVBD 5INCB 2MCAA 3AM8C 3T3PF 3UCQA 5CUSL 4Q9BA 4ZAKA 4LRNL 5DHVA 2HYMA 3HAEB 3TEXA 1TZIA 4U7SA 3X3GH 2ZWYA 2HTKD 1P7BA 3KL5A 4L1LA 3FU7B 4NKDA 1LILA 3FCSA 4POYA 5L7XL 3FAXA 5FUOH 2VLLB 4FFWC 5D5DA 5IK3B 5F1NB 3BUPA 1HH6A 4BD4A 1X5HA 4P2YA 5GRZA 2QKSA 4PPTA 2AJUL 4MMXA 1N6UA 1NAKL 3NJIA 1S5HA 1SUJA 5BO1H 4JM2F 4KKBC 5EEVA 1F11B 1GGCH 2CDEA 4A6YH 2WMPA 2GABA 3R4RA 4G43A 2P8PA 4QTIH 3N55A 3MRIB 4IJ3B 2GSGB 1MH5A 3D06A 2C5DC 4FXGB 3SYAA 2A6JA 2ZF9A 5EOQH 3UO8B 3LV3B 1QTSA 4FS0A 1NPUA 3M1OA 1HINH 4QXWA 4BFFA 3J8F7 2E59A 5A40E 2DMBA 3ZDYB 4YWGH 3LZQA 2A4CA 4IOIB 3AA0A 2P49B 3SKNA 5IQLA 3QJXA 4XP4H 3VQLA 2HRGA 2OMBA 4Y5VC 2WZPD 4ANUA 4E9SA 3QUXD 3P30H 2ICCA 1O9VA 5F7KC 3IYLW 4B3VA 4GSDH 4L5FL 2OYLA 1XBDA 2IGFL 2XE1A 4HIHA 4H0IA 4LSRL 2B7DT 4AYGA 4KNSA 1TTRA 2JQYA 2BS9A 5F3BA 5DURD 3BXNB 5EDXA 3UFIA 3TIEA 4HS8H 4GW4A 2J1WA 2V9QA 3BO8B 4LLAA 1VRSA 4ZAKC 3UPAA 1N18A 1SBSH 2Q8AH 2FJFB 4N59A 2XTLA 5GTHO 1USZA 1TZGH 3KGTA 3GTTA 4YSDA 3TPUB 4C8XA 2AJSL 2A83A 2HLAA 1KBVA 5TDNA 1I9EA 3FSZA 4W70A 4IGBD 1WFTA 1OAXL 3IKCB 1AE6L 4ZFZB 3FRPB 5CSBA 5KOMC 4XNKA 2JKWA 2BHUA 3HW7A 3O11B 2J4WL 3MSPA 5J11B 3WNNA 4J1UB 4W4OC 4ZMWA 5GZOD 4N2BA 3WNOA 4P2RB 1FYTA 4JDTH 4A39A 3PAVA 5IUCA 1BSIA 5B8CA 4RGND 4QRTB 4Z18A 3W57A 1Z9LA 2MEJB 3C6LB 2WUBL 1S7SA 4Z3JA 4NNPL 4E9YA 4M48H 5HYQB 2VDMB 1AKJA 3P30L 5D72L 4S2SA 3TJHD 1CLZH 1ZXKA 3K1KC 4AJYV 1E9QA 1TENA 1Z9SA 4LDEB 2OR7A 3L4YA 2WGNB 3VH8G 3PHQB 4OFIA 4K71B 1EH9A 3U7YH 3UADA 4FZ8H 4BK5A 3QB7C 12E8H 4X6BA 1R3KA 1FO0A 2G9HB 4ZXBC 3C8KA 1CUOA 5C70A 2N2MA 2EDKA 3HZVB 1XX9C 3L8QA 4L8DA 4G1EA 1M2OA 4XN4A 2CDGB 2B59B 4APXB 4R6UA 1CD1B 1MWAA 3UTQA 3K6SA 3MX0A 3PXLA 3S3BB 1XCXA 4AWJC 3O0RH 4B9GA 4PBVC 4R4BA 1ZSDA 4YX2H 5KVGE 1MAML 2GTZB 1XTLA 5I1AB 1E4JA 2EDFA 3S96B 4NRYB 1N12A 3SEPA 1X5ZA 3BSZL 3REWB 1X9LA 4U1JB 4NM4H 4M8QA 4MDJB 3GP6A 1BZ8A 5F0MB 2WIIB 4FYSA 3PYCA 4M5ZL 4PJ9B 5MENE 3MKKA 2HMIC 1CBVH 1P2CA 3IT8D 5D2NE 3VH8B 1CDUA 1XB8A 5BMFH 5I1CL 1INEL 3OKYA 5C9JA 3PGUA 1A3LL 1LWJA 1OHZA 4DNLA 2CIKA 2XV2A 4LPXA 4XNQA 3DIFA 4PJIA 4WK4B 5DI8A 1IBBA 4GJTB 3QS2A 4Z0XA 1NDMA 1GGCL 2K4WA 3D3VE 4KTEL 1JFQL 2KZ7B 1HCFX 1CICA 4PTTA 4CKVX 2Z4QA 4M00A 1W72L 2GTQA 2JKRM 2XZZA 4LLYB 4Y9BA 3NIGE 1YC8A 5EO9A 5GJSH 3ZN6A 2EDTA 4V1DA 3GMNB 3N85H 3V55A 5HYJE 3D18B 4N2HA 3RDJA 2DEYX 1C16A 4UUJA 3EOTL 3B6SA 3PDDA 1Z3RA 2VZVA 2RALA 1F8TH 3DHJA 4DKDC 4RFOL 1U8OA 3X12B 3IDGB 5D1QD 1YEEL 1E28A 5A6MA 1ZHBA 1DBKH 1BM7A 2AABL 3QEGH 2XVLA 1T66D 1MLCB 4Z7UB 4Y16C 5BQ7A 3HZ3A 3MOBL 3NSFA 4Y9EA 1DLHB 1XGRB 2CE6A 2YR3A 5CP3H 2KLSA 4TRPL 1EV2E 1G87A 2JI3A 2CQVA 2PXYC 2FT6A 1FFOB 1XCQB 1P4BH 2WINB 3WFCH 1CD8A 1J5DA 2PTUA 1TZGL 1U92A 2CR6A 2EC9U 1TSHA 3RGVA 3MCYA 3FO1B 4LVHC 1JNHB 4N6QA 1R3IL 1SBSL 4PG2A 2Y36L 2KQNA 2N7SA 4PJ7A 3RDTB 3SKUD 1OQOA 2DMCA 1I1FA 1TYJA 3O3EB 1INEH 4P23A 4DN3L 3UTSB 2PYFB 4E68A 4X5XA 5B1AB 3A24A 1U8JA 5IEHB 5IIEA 1KEGH 3GSVB 2WO4A 4XMLL 1ILUA 1LEKB 1LE9B 4DERA 1MRFH 2VR8A 1IM9A 1QWUA 2ODIA 3GKZA 1G1OA 1QMUA 3T2PA 2UZPA 4P2RD 3IMBA 1F4HA 2IQ9H 5C0GB 5GJSL 2DEXX 1GW6A 2CRMA 3L9RB 3H2QA 1F58L 4J4PC 1NPJA 5J6SA 3TBSA 2BSSA 2BVPB 4M61A 3S8GB 2CNYA 1WWAX 5ESAA 3PHAA 2YA1A 3LKOB 3K80A 1PEZA 4X7EC 5HHMD 3EO0A 4MKMA 3PUUA 3OG4B 1YAZA 1UB5A 2GSMB 2OL3B 1AI1L 4NUQA 5FHAH 3A0OA 3DA0A 5B38G 1CVSC 2X2IA 3KWWA 4EIBA 4JQIA 2J1ZA 4AW7A 3L3DA 1I8LA 3IK2A 1FG2B 1EEZA 1VCBC 5HYJD 3U4EA 5DHVB 5KSVA 4BUMX 2ZPKL 3QUXC 4OGXL 4ZRGA 4NZDA 4JHWL 4R7DA 1NGPL 2XXMB 3OSVA 4G8AC 2AJUH 2F8VA 4ZYKA 3T0BA 4ZG1A 4FG0A 3FU7A 5KUMA 3FCSB 3WEAA 3BC9A 4XX1G 1QSEE 4JY5H 4Q0XH 4IRZL 2CJSA 2OP4L 4BQCA 4MMXB 1INDL 1J1PH 2WKLA 5T5FH 4BRVA 1A9EA 2J55A 5L2KD 1B88A 4LEEA 1F11A 2VN6A 1LDPL 2CDEB 4GNKB 2EE3A 2XY1A 4P23C 4F15B 5I8EA 4ZQTA 1FHGA 2P8PB 2WWKO 1MH5B 3WIIL 4FXGA 2A6JB 4H0HB 1F2QA 3HC4L 5HXMA 3SKMB 2E7DA 3VA2C 2Y7SA 2R59A 2J5WA 2J56A 4OJFL 3CHOA 1XFPA 2YFOA 2B3IA 2BNQD 1UA7A 3C8DA 3VACA 4M7LL 4TQPA 1RHHA 2N0KA 3MLUH 4BCYA 4XPBL 2K4TA 1GZHA 5SWSA 4KZCA 5HYJB 1TNMA 2XX0A 3U6XS 3K2UL 2GI7A 4OT1H 4XMTA 4MKTA 2FR4A 1MJUH 1O75A 1E7VA 5F3BB 3TYGL 4HX1B 3BXNA 5C08E 3BUTA 2BDNH 2DQFA 5E6UB 2CKNA 3TIEB 2Q10A 1AS8A 4GW4B 2ADFH 3BO8A 2IDCA 4MXQC 2FJFA 3QUXA 5F9OH 5FUCE 4F7MB 3W2DH 4PJGA 1GY1A 2XN0A 3KBEA 3QDJD 5H8DA 4NWUH 1YY9D 2FD6H 2QMKA 5T8IA 2KUTA 2HB0A 2P28B 2XQYK 4NB7A 1DBMH 5TDNB 4PWHA 1TITA 3RPIA 3E8UL 3IKCA 4QHMA 5DHVH 1T0NA 1TJXA 3FRPA 1S4IA 4XCCH 3VXRD 4APQB 4HG4J 4HSCX 4FMVA 4IKJA 1OP3H 3BLKA 4GSQA 4QRBA 4G6JL 4GT0A 4Z8FL 1FYTB 5DZAA 4GMSH 5G26A 4HWBH 2N59A 4A1RA 4FKHA 5B8CB 4FAAB 1GC1H 5IHHA 4U0RC 1RK7A 3T8VA 3RKDC 1K4DB 4BFEA 3O3DB 5HJDA 1AKJB 2AEOA 2EEBA 2NXZC 2VDOB 1MCEA 5DUMH 1PLBA 4B61A 4HXAL 5AOIA 1E9QB 1Z9SB 1ZJBA 1BQRA 4O02H 3MZTA 2HFEB 1YJDC 4BHUA 2A5UA 2G2PA 4E41E 3QDMD 5HVHC 4LPYA 3ZO9A 1KCVL 4DEPC 3US1A 1FPTH 4G1EB 3N91A 4APXA 2B59A 4PTUA 2WC7A 1MWAB 1MW0A 3UTQB 3K6SB 3F6JA 4AKQA 3MX0B 3ZDXF 4R4BB 3I9PA 4FG6D 4GSXA 2LU3A 2WK2A 2X7LB 1URZA 4MJ4A 4P3DB 4N0CD 4RGOL 3AADB 1WICA 2K9FB 4NRYA 4TYUA 3E8UH 3LQMA 1QP1A 3DOHA 5EU7E 2FIKB 1EBPA 4U1JA 3KL0A 4MDJA 4XNLA 3KJ6L 5CXPA 4FSOA 1EERB 5DJZA 4YC2B 3VW3L 4N90D 3SBWA 4PJ9A 2EIKB 5C2BH 4AJVA 2X6UA 1UWXH 4XP5L 3LPWA 1P2CB 3QUZA 3VH8A 4LOUD 1OANA 5I6LA 1MCLA 5C9JB 8PAZA 1A6TA 4ONOA 4WFFD 2W0PA 4XNQB 2G9KA 5DI8B 4G7SB 4JG5A 2DQDL 4UTBL 4Z0XB 3UTZA 1NDMB 3R18A 3T6XA 2AXTO 5IWLC 3OKKB 1CICB 3HJEA 4PTTB 5AYUH 3TGXA 4HBQA 2Z4QB 3POQA 5EO9B 5L2KE 4LLYA 1X9UA 2W38A 3C6LC 3KAAA 3NOIA 4V1DB 3GMNA 1MIML 1XMWA 3PWNB 4XPTH 5KS9F 3HI1B 4G6MH 5JQ6H 3MLUL 5AVYB 4UUJB 2QPSA 3B6SB 1FYTE 1ETZA 3H8NA 4X8XA 4IK6A 4ZS7L 1JGDB 4YBQD 4RDQF 4TNWF 1U8OB 3WS3A 3GQFA 4PR7A 2W81C 5GJTL 1EBAA 2VERN 4Q6YA 4NWTL 1UACH 2DQIH 2Y2TA 5CN1A 5IQ7H 2CLZA 1KTCA 2EE9A 1JZ2A 3OWRA 2DJ4A 4O3XB 1MLCA 1F4YH 5CD5C 3EADA 5BQ7B 2P5WD 3D85D 4GQ9L 4YZWA 2BP3A 3EH5B 1XGRA 2FLRT 2W1NA 5E4OA 3S3PA 4QRPA 5JW4N 1AI1H 1OM9A 1OE3A 1FFOA 1XCQA 2WINA 3P11H 3QRBA 1MFMA 3E6FB 3CBKB 3FO1A 4OLWL 1JNHA 4QXUL 1BLIA 5TK4A 2EH7L 3HR6A 1N10A 1KTRL 2B2XH 2YGQA 4PJ7B 3RDTA 5JUEH 1MPAH 1I1FB 4L29B 4PW3A 2CBOA 4XXDA 5D9SA 2PYFA 4X5XB 4JO4L 4KUZL 5IEHA 1HCYA 3GSVA 2V3DA 1T2QL 4PJ9C 4QRUB 1LEKA 4C58B 3QFJB 3QYCA 9CGTA 3BZEA 3WS6C 3HLAA 5ESVB 2IO5A 1XEDA 1AZBA 4FA8A 3K0YA 4FULA 4WNJA 3S97C 2P8MB 1D7BA 3FZUD 1I7ZB 5DUBA 5C0GA 5CEXB 1AACA 4LPCA 2N0MA 5CN3A 2IFFL 1H6TA 1FL3B 5IFJA 2BVPA 2QLYA 2VLME 2O93L 4B9ZA 1V7MH 1PNDA 1NCJA 3LKOA 1IAIL 3EO0B 2CO1A 4PVBA 4WO4C 3MJ8B 4BDVA 1TTAA 4NIYE 4B9YA 1UB5B 2OL3A 3GHEH 4BHUI 4BZ1A 1ZTXH 3HOLA 4JKKA 5F72S 1RJYB 2J2ZB 4U1GB 3L3DB 4NZTL 4JKWA 1FG2A 1EEZB 4KRNA 4ADGA 5IZ7A 3U4EB 3ZE2F 4K23H 1FORH 5KSVB 5J56B 5ALCH 4U9CA 3Q9PA 4R7DB 1KEGL 3LKQA 2Y7OA 5I15H 3CTTA 4ZYKB 5I1EL 1E5UI 2FJGB 2IH8A 4PG9A 5E9DA 2PO6B 3RTQD 2X70A 4Y7OC 5EORL 3VXNB 3QBTB 1KTLB 4P5TD 3FQ4A 1GFQA 1LYQA 1AC6A 1ZHWA 1BVKA 2FX8H 2YUVA 4WTZA 4XO3A 1WHPA 1A9EB 5F7EH 1GTNA 3BVNA 3C08L 1D2OA 1XIWB 1QRNE 1UA6L 2VDQL 4YHZL 5HI5C 4M7JL 3ZMNA 5C2BL 3NCYS 1P6WA 3P0GB 2VH5L 4OIFA 5I8EB 4NN5C 4OJDH 3X3FL 1GFNA 4AENA 4ALAL 3F05A 4KKNA 5AUMB 5T1LA 2RJMA 4FQLL 4QCIA 3CVHB 4JFDB 2CCWA 4LSQL 3SKMA 1EFXD 3W0WA 2PKDA 3KM1A 2X12A 2HWZH 1F8TL 4QEGA 4I0PA 4U4BA 3SOBH 4DFHA 3FULA 1RHHB 4NZRL 2GI0A 4M56A 4ODTL 1SJXA 5SWSB 3ZSSA 6FABH 4K7PX 5TGBA 4V1DE 5HYJA 2P5EE 2VTFA 4WWNA 2E6QA 3RRQA 2IOOA 4WO4A 1IO4C 4G7QB 5D7LD 2KQMA 1JZEA 4PJAF 3QQXA 3RZCA 3GO1L 1JRHI 2FR4B 1JPFA 2GITA 1MIEL 1G7JB 1KIUA 4AUUA 4HX1A 1WDAA 2YD6A 2DQFB 3H56A 4HGMA 2HT4C 1JTTA 4E9XA 5FCUH 1ADQL 1DBML 3DIVA 4H13C 4NBYB 3HS9A 3QUXB 4HC1H 3SCMA 4F7MA 2R1XA 3BCDA 4PJGB 4Y19E 1KBBA 2A9BA 1OTTD 3JYCA 3R7RA 4U1HB 5L88L 2HH0L 4FYTA 3D2TA 3D51A 4K0OA 2FQFA 1P9MC 3RPIB 3RVVC 1FVEA 4QHMB 3UBFA 1J05A 4GMSL 5C0AD 1T0NB 1C7TA 1HCZA 2MH4A 3WG7B 4APQA 3D0VA 4FZEH 4JQXA 4LHUB 5F7BA 2P45B 4KXZH 1ZTMA 5JUEL 1TJHH 2H2PC 1JWUA 4XMKL 3FZUC 5B3SB 4BE6A 2CO3A 4YO0B 3B56A 3K8MA 4K3DH 3Q2NA 3RA7L 3G6DH 2VZOA 4U31A 2DRUA 4AV0A 4RMBA 2ENJA 4BZ2A 2COVD 2LR4A 1CFMA 4E9LA 1AGDA 4LLUA 3KPLA 4GMTL 1K4DA 5DQJB 4KX8A 3O3DA 1CCZA 4DVRH 3UTOA 4MQTB 2LU7A 2DZEA 2IPUG 3SPIA 1A7PL 2CK0L 2JJSA 3CMOL 4WWKC 2HFEA 1LO4H 2YUZA 3GO1H 3APNA 5BOZG 3MRGB 1G94A 2CUAA 4F57H 2AS5M 1KELH 2VDLB 3RIAK 2X4PB 4PTUB 3RWJA 1PD6A 2VLJA 4XB3A 2P43B 1J86A 2DD8H 2VQ4A 1BWMA 2XKSA 3L1FA 3SGDI 1EWHA 1QOKA 2YK1L 1ZDSA 2X7LA 5EHFA 4P3DA 3SBPA 3V6BR 2VZ1A 5AG9A 2N56A 2Y7MA 2B4CC 4UNUA 2F18A 2FIKA 2X44D 4WJ5B 3QRGH 4N3UA 1GMEA 4Q8BA 1RP8A 5DJZB 1LJMA 3G6JF 4GB9A 5E1AB 2OULB 4N2KA 1DVXA 1UCBH 2HVKA 3LEYL 3KLLA 1KXVC 1BT9A 4N2AA 1YAIA 3QUZB 3KGRA 5FDWB 2NY0C 1GKEA 3VQMA 3T4AC 5DFVC 2D9CA 3IF1B 3T0EE 5FIEA 1A6TB 5C09A 3OMZA 4JKNA 4B3EA 3QXDA 1MN4A 4KR4A 1DL7H 2ZX5A 5AYQA 3WU1A 2OJ1A 2W94A 3UTZB 2FJHA 3LB6C 4UQCA 3HHMA 3FONB 3OKKA 4FP8L 5I28A 1XSOA 3NABH 4W9ZA 1S7UB 4TUOB 3ZO0A 1M3JA 2BWQA 3PWNA 5E23A 3LHAA 1AQKL 2VLMD 3U79A 3DBSA 3HI1A 1LHZA 1FJ1B 3NMEA 4OLVL 1K72A 2DH2A 5FM8A 4F7PB 3EHBB 5T3XD 1ETZB 1UH3A 1QBAA 3P4OB 1UGNA 1JGDA 1ZEAL 4PV9B 4NN7B 3WS3B 1S3KH 4TTGA 4U6TA 4BK5C 3IN0A 3GK8L 3MRHA 1JPTL 3FNKA 3PJLA 1XH2A 3SY0A 2CLZB 4Y16A 3A4FA 4EOWH 3T04D 1GXEA 3WTYA 1QBLL 3NFSL 1AGBA 3Q01A 3CSFA 2DQIL 1P4UA 4QRPB 2C1OA 3SYSA 3NSGA 4YEEA 5DLML 1MPFA 1PD1A 4M6MH 1JD7A 3E6FA 4FQIL 3VI3E 2XE2A 4Q9RL 4JRXA 1LVEA 1YMMD 3LDBC 3O2WH 5MHSD 3NVQA 3P3YA 4YH6A 3KL3A 1B0WA 4OGAD 7TAAA 3MRPA 3H6JA 4L29A 4Z7UF 4XXDB 5D9SB 5GRJH 2XN2A 4WHTA 1CGXA 2DWSA 1BXWA 3LB6D 3DV4B 4QRUA 3ZDZF 4HCGA 5CR1A 3QFJA 1DJHA 2EH7H 3BZEB 3HLAB 1CDYA 5ESVA 4AH2A 1HCVA 1YQVL 5FK9B 3RTLA 2Y2XA 2P8MA 5DUBB 5CEXA 1I7ZA 3MODL 1T1XA 1OAZL 1SMOA 2YEQA 2X2HA 1EFQA 1FL3A 2VYRE 4HCRL 3V0DA 4Z95H 5IFJB 3BGAA 1OALA 3GHEL 2LLGA 3ZE0F 3EFOA 3AQZA 3QC6X 2YZ8A 2VAAA 5E2WH 5F96L 1NICA 4YSCA 5ADPH 5DEGB 1FVCA 4BM7A 4J2XA 5JIDA 1D6EB 3MJ8A 5SX5H 4BDVB 1Z2KA 5IHUH 4DSYA 1AZRA 3C2AH 4IYKA 4Y4KA 4OZFH 2IMNA 4N75A 3S2CA 1I4FA 1RJYA 2J2ZA 5EZOH 3A0BO 4FA6A 3HE6A 2LTQC 3DWNA 3DX1A 5DEFB 5SV4A 4HHAA 1MFEH 1BF5A 3X1FA 4IM8A 1DQMH 2ED9A 2OMWA 3HMXA 5IQNA 2R0WH 5BW7C 2CR3A 3E2HB 1NC2D 4X7CC 1I3UA 3LKQB 3OG6B 5AVRB 5DO2D 1V54B 1KY6A 2FJGA 3GZQA 4PG9B 5E9DB 1J0JA 2PO6A 2YKKA 2X70B 4FTVA 4OIAA 1XSIA 3DYPA 4NQEB 4XP6H 1MM5A 3FO9B 3VXNA 4HJJH 1KTLA 4FL4B 2DQTH 2YIHA 1BVKB 3KPPA 2FT7A 3QPKA 4YHNA 4FJ6A 4H8WH 4K5LA 4R7VA 3BVNB 1XIWA 3PCYA 3QPXH 4V33A 4CU8A 2DQCL 15C8L 1KF9B 3TFKD 4AENB 2ESVD 5I9QB 3CHQA 5IG7A 5AUMA 2C9PA 5T1LB 3GHBH 1KPUB 4QCIB 3CVHA 4JFDA 1XD0A 3V9FA 1PDKA 1PZDA 3T8MA 3VGAC 4E41D 5KW9L 3F5WA 4K2UH 1SJMA 3W0WB 1X5MA 3BUBA 2EZ0C 5KYNA 1SM3L 4JGJA 5AAMA 3F85A 4I0PB 2PLTA 2DMHA 2HRLA 3KVPA 4K5MA 4V2CB 3QISA 2I25N 2NLJA 5DURB 5EOCJ 3WEXA 2VM4A 1DL7L 4FD0A 2UUDK 4PCSA 2FBRA 4POZC 3RVTD 2VN3A 5EZOL 2NZIA 5TGBB 3OKDB 4WO4B 4FQQA 5DVMA 2ZUWA 3PGRA 1GYUA 1X3DA 3QR2A 3RZCB 3UX9B 1X5KA 4H26A 1JCVA 1JPFB 2GITB 2OXGB 1G7JA 1KIUB 5DRZA 4ZTEA 7FABL 5GGUA 5JR1H 2JE8A 5IBLC 2VDQH 4YHZH 1PS3A 1UGKA 4AK1A 2XA8H 5CJBA 1QJ8A 1T83A 5FKPA 3ZGIA 3SCMB 5LWYL 1ND0B 2R1XB 3BSZA 4AJWA 4K3JH 4KK9D 4BELD 4ZO9A 2H26B 4U1HA 4AIOA 3CVBA 1NCIA 3L2MA 4OCSL 1JXGA 4L4VD 3CFTA 2PWFA 4I0CC 4FG6C 4P23D 5CJQL 5J9PA 1FVEB 4P5RA 1GSKA 2BRRH 1J05B 3M46A 2WVSA 4PJBE 3D0VB 4LHUA 4X6DE 4EO5A 3MACL 3KMDA 1DSFL 1JPEA 1ICTA 1JWUB 4FLHA 4HZLB 5DT1H 3LS5H 2H3NB 4YO0A 1T0MA 5CFAA 1N0XH 1J0YA 2OZ4H 4N74A 5HHVH 1B4JL 3VFMA 1W6LA 2XZAH 4OUOA 5TD4A 4NCC2 4WY7H 1YN6A 1AGDB 4LLUB 4YLCA 2CRZA 2JCCF 2C9UA 3KPLB 2MOGA 2KBGA 3QO1B 5DQJA 4TXVB 3RP1A 2APVA 3SGJA 4N2DA 3FOLA 4UCFA 3IMVA 4ZPVB 4F4BA 4M8UA 2Y4SA 3GYRA 3FQ2A 3VFVB 5GRVL 3QWNA 5GISL 2DWXA 4RRPG 3MRGA 5DMJB 2YN3A 4PRNA 2YOAA 1V7NL 2X4PA 4HC1A 3RWJB 2VLJB 3FTWA 3B9KA 2P7TB 3REVA 1PG7H 1KTBA 4FYQA 4OVVA 4E9TA 3P3SA 5F88A 3FRPG 3JYBA 1T0OA 5JW4Q 1G7PA 1UH2A 2ZUYA 1FIGL 5E6RB 5GZNC 4WJ5A 3CFDA 5BMFL 5I1CH 1W8EA 3GK8H 3SD2A 1KPVA 4GMTH 5D4IA 5E1AA 5E8DL 1NCCH 4P49A 2Y06L 2HVKB 3V4VB 3M6DA 4Y19B 5FDWA 3M8OH 2DWYA 3AB0C 3QRGL 5DHMC 3IF1A 5C09B 4TSCH 3JWOC 4EDWL 1MW3A 5H2FO 2PTVA 3GXIA 3QXDB 2NSXA 4PJXE 2R8SL 1NAMH 3QUKA 1DDTA 5IB4B 1BQUA 2FJHB 4ZMXA 5JIIA 2VKWA 3FN0L 1C5BL 3FONA 3MBXH 4Y89A 5ECJE 4TM9A 3HWBA 4PMFA 1S7UA 4TUOA 4DUWA 1IKFL 1VGKA 4YSPA 3GNML 1FJ1A 4XPBH 4JZOA 5LAPA 4R90H 5G5DB 4F7PA 2D7TL 4PWJA 1NIAA 4XAKD 5BOPA 3P4OA 4PV9A 5DWUL 1U3YA 2G4GA 1Z0MA 3CFUA 4JCLA 4M5SA 3QQ9D 4BH7B 3S37L 1WITA 3MRHB 5CCHE 1BEYL 2WZAA 4XC1H 4X0NA 4OZHE 1HE7A 3SE6A 3SY0B 2YMXL 4Y16B 4WGWB 3MGOA 3O2VL 3B1TA 1KTJA 8CGTA 1AGBB 4N90E 1J9CT 4YE0A 3UAQA 5FX3A 3IEAA 2QHRH 4C00A 2C1OB 1WZLA 3US0A 2VDKL 4PB9L 3PF1A 2I60H 5EFIB 1MFBL 3G04A 3RDTC 5GXBB 2A77H 4JRXB 3LIUA 2I69A 3ELQA 1JYNA 1FUNA 2NQCA 5L4IA 1J8HE 2GBVA 1N0LA 4MAZA 3MRPB 2D03H 3VXPA 2IWVA 1OW0A 4WHTB 4QRSA 5I73B 3DV4A 1RUPL 3VFUB 4L37B 4AGMA 4MXVE 3UJIL 1JZ4A 3QUZC 4AH2B 1ONQB 3GZKA 3JTYA 4LP4A 5G4OA 2Q20A 2FQEA 5FK9A 3Q7JA 2F53D 1MNUH 4G6AD 4Z78B 3DHMA 5IW1A 1T1XB 1PCSA 2W59A 4EBQL 4QXTA 5FHAL 2GSIA 2I9LA 1M56B 4O3WA 3EFOB 2VAAB 1QTPA 5I76B 1IVTA 1T1ZB 4TVPL 5DEGA 2XZCH 3W38A 1FVCB 4IRZA 1D6EA 3JWDC 2R56H 1IT9H 2AXJA 8FABA 3SQRA 4RFEA 4NS0A 1MHHB 3L3JA 3A6BL 4Y4KB 1AR1B 2FGWH 5E94A 1GAFL 5KSAD 1I4FB 3RBSA 1NGPH 4D9LL 3HE6B 4WK0B 1I75A 5DEFA 3EYSL 4QXGH 4HUNB 1YSOA 1V7NH 4HHAB 2X0WA 4I1RA 2W9LA 4GRWF 3VDBA 2OMWB 5L2KA 5DC2A 5FW7A 5GISH 5LQBL 1TQBB 4JRXD 2ILLA 1UWYA 1R3LA 2V37A 4LFHG 1OK8A 3MOAH 3QHZL 3BZDA 5FCUL 1Q72L 3O45A 3QNXA 4H8WL 4FTVB 4HFUL 4ODHH 4NQEA 1TEYA 3FO9A 3KPRE 4Q97A 1O5DT 5ICXB 4PSPA 2J57A 3KPPB 3QCTL 4TQHA 4YHNB 4U1KA 1PZ2A 5C0BA 4QLRA 3UBXG 2J7LA 2Q2LA 1E67A 5FO2A 3WKYA 4P99A 4LSTL 1OW0C 1OCZB 1NMCC 5TF1L 4LCUA 5IG7B 2D7PA 1OTUC 2NR6D 2Y6SD 1KPUA 1IC7H 1PDKB 1F3JB 2YAOA 3F5WB 3MPCA 1MJJA 4KUCD 4NQTA 1K5WA 3RWGB 4TN9A 5KTEL 2GJJA 5IHWA 5AYUL 1DQDH 4BQ9A 2WTOA 3DHPA 3MRQA 5C8JA 1UFUA 2NLJB 2N7AA 4KV5E 3BPNB 3WEXB 1ORSA 4CC4A 1QZ1A 3GSWA 4OJFH 1GSMA 3K6DA 3OKDA 1ET5A 3WXVH 4X6DF 3NBNA 1FP5A 4FQQB 5FWQA 4Z7OE 4LDOB 5L2JA 5DK3A 3OHXA 2CMRL 3SO3B 4H26B 3ARBD 2FO4A 3WY2A 2ZIDA 2YUXA 3QIUB 2OXGA 5DRZB 1UOWA 3COOA 5GGUB 2W88A 2D7TH 2JSFA 3U0TB 4B9JA 2NY2D 5DVNA 4GKSA 4AYDC 3VFPA 4HA1A