1OPFA

The structure of ompf porin in a tetragonal crystal form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title The structure of OmpF porin in a tetragonal crystal form.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1994-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1opfA00
1E54A 3VZUX 4C69X 3EMNX 3VY8X 1OPFA 2Y2XA 2XG6A 2FGRA 1PRNA 2XE5A 4LSIA 3SZVA 3SY7A 3K19A 2XE1A 4FT6A 3PORA 3T20A 3O0EA 8PRNA 6PRNA 2ZFGA 4FRXA 2J1NA 4FSOA 3VZWX 3VY9X 7PRNA 3POQA 2Y0LA 2OMFA 1GFQA 4LSFA 4D64A 2ODJA 3VZTX 1GFMA 5DL7A 3WI5A 3SYSA 3T24A 2Y0KA 1HXTA 1GFOA 3POUA 4GCQA 2PRNA 5DL8A 3PRNA 1GFPA 5PRNA 4GCSA 4RJXA 1BT9A 4KRAA 3UPGA 1HXUA 1H6S1 3POXA 4JFBA 3WI4A 1HXXA 4KR4A 2QTKA 3A2SX 4RJWA 3SYBA 2Y0HA 3HWBA 5DL6A 5JDPA 4FSPA 3NSGA 1GFNA 4KR8A 1BH3A 3SY9A 2XE2A 4D65A 4GCPA 5FVNA 4LSEA 3SZDA 4LSHA 1MPFA 5DL5A 4AUIA 1PHOA 3JTYA 2FGQX 1OSMA 4FMSA 2XE3A 3FYXA 3T0SA 2ZLDA 4FOZA 2J4UP 3UU2A 4D5UA 2PORA 4BUMX 2K4TA 2O4VA 3HW9A 4FRTA
chains in the Genus database with same CATH superfamily
5G26A 4FZNA 1E54A 3VZUX 4C69X 5AFUL 3EMNX 3VY8X 2R88A 1OPFA 3PQUA 5TISO 2Y2XA 3DA3A 5GV0A 2XG6A 2YPVA 3PQSA 2Y7SA 3DWOX 2MHLA 3AAAA 2FGRA 2WJQA 3A0HO 5B5EO 1PRNA 2XE5A 3PF1A 3LK41 4LSIA 3SZVA 2GE4A 4O4XA 2KXPB 3K19A 3LK3B 3SY7A 4PR7A 2XE1A 4AYDC 4FT6A 2X27X 3PORA 4XNKA 5H2FO 3T20A 2IWVA 1Q9FA 3O0EA 1QJ8A 3VE1A 1BXWA 6PRNA 8PRNA 3AA6B 2ZFGA 3KVDD 2J1NA 3KZIO 4FRXA 2MNHA 4FESA 3TZGA 3BS0A 2JQYA 4FSOA 2KZ7A 3GP6A 4FZLA 3VZWX 3VY9X 7PRNA 3LK3A 4F4BA 3AA0B 3POQA 2Y0LA 4E1SA 2OMFA 1GFQA 5G3AA 4RLBA 2N2MA 2R89A 4QQ1A 4LSFA 5E79O 4D64A 5IYUA 3AA6A 3HOEA 4K3BA 1ORMA 3LK2B 3DZMA 2ODJA 4AYID 4N74A 3VZTX 3RBHA 5GTHO 1GFMA 1ZHYA 2IWWA 1QJ9A 3AA0A 5DL7A 5KAFO 4C4VA 4AFKA 1Q9GA 3WI5A 2R4LA 4K3CA 2R4NA 2N2LA 2ERVA 5GTIO 1S5LO 2Y0KA 2YNKA 3SYSA 3HOLA 3C5OA 3T24A 5ADXK 1HXTA 1MM5A 3LK42 3WU2O 4GHBA 1GFOA 4G76A 4O3WA 3POUA 4GCQA 4G75A 1P4TA 2PRNA 5T5FA 4N75A 5DL8A 2KDYA 4AYNA 3PRNA 4E1TA 1GFPA 4RLCA 2XTRA 2LFUA 4AZLA 5PRNA 3DA4A 3AA7B 2KXPA 4GCSA 4RJXA 3UAQA 2JMMA 1BT9A 4KRAA 2M06A 4N58A 3UPGA 4O3YA 4AKMA 5B66O 3PGUA 1HXUA 1H6S1 3POXA 2X9KA 3AA1B 4RL9A 4O49A 1ZHXA 2R8AA 4PJ0O 3AA7A 4JFBA 2XMXA 3WI4A 1HXXA 3DWNA 4KR4A 1QJPA 2QTKA 5EE2A 3A2SX 5G38A 3G7GA 4IL6O 4RJWA 3SYBA 2Y0HA 2K0LA 3LK2A 5AFUK 4C00A 2XTQA 3QRCA 3BRYA 3HWBA 5DL6A 4O3XB 5KAIO 3PGRA 2WJRA 3V8UA 4FSPA 5JDPA 4UB8O 4XNLA 3NSGA 4Z3TA 1GFNA 1ZHZA 2R4OA 4KR8A 4N59A 4CTDA 1ZHWA 1BH3A 4FQEA 3SY9A 1ZHTA 5ADXL 2XE2A 2M07A 3A0BO 4PUXA 3PGSA 3JCUO 1G90A 4FUVA 4D65A 1YS5A 4GCPA 4GF4A 2W81C 4LSEA 2R4PA 5FVNA 3SZDA 4LSHA 2AXTO 1MPFA 5D5DA 1IZNB 5DL5A 2KC0A 1PHOA 4AUIA 3JTYA 4O3ZA 3BRZA 1T1LA 2KZ7B 2FGQX 3AAEB 3VE2A 1OSMA 4FMSA 2XE3A 2W80C 3FYXA 3T0SA 2F1CX 2ZLDA 4FOZA 1T16A 4AYMC 4AKRB 2WVPA 2J4UP 3UU2A 4FZMA 3AA1A 1THQA 4D5UA 1IZNA 2LHFA 2F1VA 4AYEC 2PORA 1MM4A 2F1TA 3AAEA 4JCHA 3QRAA 3NJTA 4O4UA 4U9CA 4UB6O 4B61A 4BUMX 4C4VB 2K4TA 2O4VA 3HW9A 3AAAB 4FRTA 5G39A 4AKRA
chains in the Genus database with same CATH topology
5G26A 4FZNA 1E54A 3VZUX 4C69X 5AFUL 3EMNX 3VY8X 1OPFA 3PQUA 2Y2XA 3DA3A 5GV0A 2XG6A 2YPVA 3PQSA 2Y7SA 2MHLA 3AAAA 2FGRA 1PRNA 2XE5A 3LK41 4LSIA 3SZVA 2GE4A 4O4XA 2KXPB 3K19A 3LK3B 3SY7A 4AYDC 2XE1A 4AYMC 4FT6A 2X27X 3PORA 4XNKA 3T20A 1Q9FA 3O0EA 1QJ8A 3VE1A 1BXWA 6PRNA 8PRNA 3AA6B 2ZFGA 3KVDD 2J1NA 4FRXA 2MNHA 4FESA 3TZGA 4FZLA 4FSOA 2KZ7A 3GP6A 3VZWX 3VY9X 7PRNA 3LK3A 4F4BA 3AA0B 3POQA 2Y0LA 4E1SA 2OMFA 1GFQA 4RLBA 2N2MA 4QQ1A 4LSFA 4D64A 3AA6A 3HOEA 1ORMA 3LK2B 2ODJA 4AYID 3VZTX 3RBHA 1GFMA 1ZHYA 1QJ9A 3AA0A 5DL7A 4AFKA 1Q9GA 3WI5A 2N2LA 2ERVA 3SYSA 3T24A 2Y0KA 2YNKA 3HOLA 3C5OA 5ADXK 1HXTA 1MM5A 3LK42 4GHBA 1GFOA 4G76A 4O3WA 3POUA 4GCQA 4G75A 1P4TA 2PRNA 5T5FA 5DL8A 2KDYA 4AYNA 3PRNA 4E1TA 1GFPA 4RLCA 2XTRA 2LFUA 4AZLA 5PRNA 3DA4A 3AA7B 2KXPA 4GCSA 4RJXA 3UAQA 2JMMA 1BT9A 4KRAA 2M06A 4N58A 3UPGA 4O3YA 4AKMA 1HXUA 1H6S1 3POXA 3AA1B 4RL9A 4O49A 1ZHXA 3AA7A 4JFBA 2XMXA 3WI4A 1HXXA 4KR4A 1QJPA 2QTKA 5EE2A 3A2SX 3G7GA 4RJWA 3SYBA 2Y0HA 2K0LA 3LK2A 5AFUK 2XTQA 3QRCA 3HWBA 5DL6A 4O3XB 3V8UA 5JDPA 4FSPA 4XNLA 3NSGA 4Z3TA 1GFNA 1ZHZA 4N59A 4KR8A 5IYUA 1ZHWA 1BH3A 3SY9A 1ZHTA 5ADXL 2XE2A 2M07A 4PUXA 1G90A 4FUVA 4D65A 1YS5A 4GCPA 4GF4A 2W81C 4LSEA 5FVNA 3SZDA 4LSHA 1MPFA 5D5DA 1IZNB 5DL5A 2KC0A 1PHOA 4AUIA 3JTYA 4O3ZA 2KZ7B 3AAEB 2FGQX 3VE2A 1OSMA 4FMSA 2XE3A 2W80C 3FYXA 3T0SA 2ZLDA 4FOZA 4AKRB 2J4UP 3UU2A 4FZMA 3AA1A 1THQA 4D5UA 1IZNA 2LHFA 2F1VA 4AYEC 2PORA 1MM4A 2F1TA 3AAEA 4JCHA 3QRAA 4O4UA 4U9CA 4B61A 4BUMX 2K4TA 2O4VA 3HW9A 3AAAB 4FRTA 4AKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E54 A;  3VZU X;  4C69 X;  3EMN X;  3VY8 X;  1OPF A;  2Y2X A;  2XG6 A;  2FGR A;  1PRN A;  2XE5 A;  4LSI A;  3SZV A;  3SY7 A;  3K19 A;  2XE1 A;  4FT6 A;  3POR A;  3T20 A;  3O0E A;  8PRN A;  6PRN A;  2ZFG A;  4FRX A;  2J1N A;  4FSO A;  3VZW X;  3VY9 X;  7PRN A;  3POQ A;  2Y0L A;  2OMF A;  1GFQ A;  4LSF A;  4D64 A;  2ODJ A;  3VZT X;  1GFM A;  5DL7 A;  3WI5 A;  3SYS A;  3T24 A;  2Y0K A;  1HXT A;  1GFO A;  3POU A;  4GCQ A;  2PRN A;  5DL8 A;  3PRN A;  1GFP A;  5PRN A;  4GCS A;  4RJX A;  1BT9 A;  4KRA A;  3UPG A;  1HXU A;  1H6S 1;  3POX A;  4JFB A;  3WI4 A;  1HXX A;  4KR4 A;  2QTK A;  3A2S X;  4RJW A;  3SYB A;  2Y0H A;  3HWB A;  5DL6 A;  5JDP A;  4FSP A;  3NSG A;  1GFN A;  4KR8 A;  1BH3 A;  3SY9 A;  2XE2 A;  4D65 A;  4GCP A;  5FVN A;  4LSE A;  3SZD A;  4LSH A;  1MPF A;  5DL5 A;  4AUI A;  1PHO A;  3JTY A;  2FGQ X;  1OSM A;  4FMS A;  2XE3 A;  3FYX A;  3T0S A;  2ZLD A;  4FOZ A;  2J4U P;  3UU2 A;  4D5U A;  2POR A;  4BUM X;  2K4T A;  2O4V A;  3HW9 A;  4FRT A; 
#chains in the Genus database with same CATH topology
 5G26 A;  4FZN A;  1E54 A;  3VZU X;  4C69 X;  5AFU L;  3EMN X;  3VY8 X;  2R88 A;  1OPF A;  3PQU A;  5TIS O;  2Y2X A;  3DA3 A;  5GV0 A;  2XG6 A;  2YPV A;  3PQS A;  2Y7S A;  3DWO X;  2MHL A;  3AAA A;  2FGR A;  2WJQ A;  3A0H O;  5B5E O;  1PRN A;  2XE5 A;  3PF1 A;  3LK4 1;  4LSI A;  3SZV A;  2GE4 A;  4O4X A;  2KXP B;  3K19 A;  3LK3 B;  3SY7 A;  4PR7 A;  2XE1 A;  4AYD C;  4FT6 A;  2X27 X;  3POR A;  4XNK A;  5H2F O;  3T20 A;  2IWV A;  1Q9F A;  3O0E A;  1QJ8 A;  3VE1 A;  1BXW A;  6PRN A;  8PRN A;  3AA6 B;  2ZFG A;  3KVD D;  2J1N A;  3KZI O;  4FRX A;  2MNH A;  4FES A;  3TZG A;  3BS0 A;  2JQY A;  4FSO A;  2KZ7 A;  3GP6 A;  4FZL A;  3VZW X;  3VY9 X;  7PRN A;  3LK3 A;  4F4B A;  3AA0 B;  3POQ A;  2Y0L A;  4E1S A;  2OMF A;  1GFQ A;  5G3A A;  4RLB A;  2N2M A;  2R89 A;  4QQ1 A;  4LSF A;  5E79 O;  4D64 A;  5IYU A;  3AA6 A;  3HOE A;  4K3B A;  1ORM A;  3LK2 B;  3DZM A;  2ODJ A;  4AYI D;  4N74 A;  3VZT X;  3RBH A;  5GTH O;  1GFM A;  1ZHY A;  2IWW A;  1QJ9 A;  3AA0 A;  5DL7 A;  5KAF O;  4C4V A;  4AFK A;  1Q9G A;  3WI5 A;  2R4L A;  4K3C A;  2R4N A;  2N2L A;  2ERV A;  5GTI O;  1S5L O;  2Y0K A;  2YNK A;  3SYS A;  3HOL A;  3C5O A;  3T24 A;  5ADX K;  1HXT A;  1MM5 A;  3LK4 2;  3WU2 O;  4GHB A;  1GFO A;  4G76 A;  4O3W A;  3POU A;  4GCQ A;  4G75 A;  1P4T A;  2PRN A;  5T5F A;  4N75 A;  5DL8 A;  2KDY A;  4AYN A;  3PRN A;  4E1T A;  1GFP A;  4RLC A;  2XTR A;  2LFU A;  4AZL A;  5PRN A;  3DA4 A;  3AA7 B;  2KXP A;  4GCS A;  4RJX A;  3UAQ A;  2JMM A;  1BT9 A;  4KRA A;  2M06 A;  4N58 A;  3UPG A;  4O3Y A;  4AKM A;  5B66 O;  3PGU A;  1HXU A;  1H6S 1;  3POX A;  2X9K A;  3AA1 B;  4RL9 A;  4O49 A;  1ZHX A;  2R8A A;  4PJ0 O;  3AA7 A;  4JFB A;  2XMX A;  3WI4 A;  1HXX A;  3DWN A;  4KR4 A;  1QJP A;  2QTK A;  5EE2 A;  3A2S X;  5G38 A;  3G7G A;  4IL6 O;  4RJW A;  3SYB A;  2Y0H A;  2K0L A;  3LK2 A;  5AFU K;  4C00 A;  2XTQ A;  3QRC A;  3BRY A;  3HWB A;  5DL6 A;  4O3X B;  5KAI O;  3PGR A;  2WJR A;  3V8U A;  4FSP A;  5JDP A;  4UB8 O;  4XNL A;  3NSG A;  4Z3T A;  1GFN A;  1ZHZ A;  2R4O A;  4KR8 A;  4N59 A;  4CTD A;  1ZHW A;  1BH3 A;  4FQE A;  3SY9 A;  1ZHT A;  5ADX L;  2XE2 A;  2M07 A;  3A0B O;  4PUX A;  3PGS A;  3JCU O;  1G90 A;  4FUV A;  4D65 A;  1YS5 A;  4GCP A;  4GF4 A;  2W81 C;  4LSE A;  2R4P A;  5FVN A;  3SZD A;  4LSH A;  2AXT O;  1MPF A;  5D5D A;  1IZN B;  5DL5 A;  2KC0 A;  1PHO A;  4AUI A;  3JTY A;  4O3Z A;  3BRZ A;  1T1L A;  2KZ7 B;  2FGQ X;  3AAE B;  3VE2 A;  1OSM A;  4FMS A;  2XE3 A;  2W80 C;  3FYX A;  3T0S A;  2F1C X;  2ZLD A;  4FOZ A;  1T16 A;  4AYM C;  4AKR B;  2WVP A;  2J4U P;  3UU2 A;  4FZM A;  3AA1 A;  1THQ A;  4D5U A;  1IZN A;  2LHF A;  2F1V A;  4AYE C;  2POR A;  1MM4 A;  2F1T A;  3AAE A;  4JCH A;  3QRA A;  3NJT A;  4O4U A;  4U9C A;  4UB6 O;  4B61 A;  4BUM X;  4C4V B;  2K4T A;  2O4V A;  3HW9 A;  3AAA B;  4FRT A;  5G39 A;  4AKR A; 
#chains in the Genus database with same CATH homology
 5G26 A;  4FZN A;  1E54 A;  3VZU X;  4C69 X;  5AFU L;  3EMN X;  3VY8 X;  1OPF A;  3PQU A;  2Y2X A;  3DA3 A;  5GV0 A;  2XG6 A;  2YPV A;  3PQS A;  2Y7S A;  2MHL A;  3AAA A;  2FGR A;  1PRN A;  2XE5 A;  3LK4 1;  4LSI A;  3SZV A;  2GE4 A;  4O4X A;  2KXP B;  3K19 A;  3LK3 B;  3SY7 A;  4AYD C;  2XE1 A;  4AYM C;  4FT6 A;  2X27 X;  3POR A;  4XNK A;  3T20 A;  1Q9F A;  3O0E A;  1QJ8 A;  3VE1 A;  1BXW A;  6PRN A;  8PRN A;  3AA6 B;  2ZFG A;  3KVD D;  2J1N A;  4FRX A;  2MNH A;  4FES A;  3TZG A;  4FZL A;  4FSO A;  2KZ7 A;  3GP6 A;  3VZW X;  3VY9 X;  7PRN A;  3LK3 A;  4F4B A;  3AA0 B;  3POQ A;  2Y0L A;  4E1S A;  2OMF A;  1GFQ A;  4RLB A;  2N2M A;  4QQ1 A;  4LSF A;  4D64 A;  3AA6 A;  3HOE A;  1ORM A;  3LK2 B;  2ODJ A;  4AYI D;  3VZT X;  3RBH A;  1GFM A;  1ZHY A;  1QJ9 A;  3AA0 A;  5DL7 A;  4AFK A;  1Q9G A;  3WI5 A;  2N2L A;  2ERV A;  3SYS A;  3T24 A;  2Y0K A;  2YNK A;  3HOL A;  3C5O A;  5ADX K;  1HXT A;  1MM5 A;  3LK4 2;  4GHB A;  1GFO A;  4G76 A;  4O3W A;  3POU A;  4GCQ A;  4G75 A;  1P4T A;  2PRN A;  5T5F A;  5DL8 A;  2KDY A;  4AYN A;  3PRN A;  4E1T A;  1GFP A;  4RLC A;  2XTR A;  2LFU A;  4AZL A;  5PRN A;  3DA4 A;  3AA7 B;  2KXP A;  4GCS A;  4RJX A;  3UAQ A;  2JMM A;  1BT9 A;  4KRA A;  2M06 A;  4N58 A;  3UPG A;  4O3Y A;  4AKM A;  1HXU A;  1H6S 1;  3POX A;  3AA1 B;  4RL9 A;  4O49 A;  1ZHX A;  3AA7 A;  4JFB A;  2XMX A;  3WI4 A;  1HXX A;  4KR4 A;  1QJP A;  2QTK A;  5EE2 A;  3A2S X;  3G7G A;  4RJW A;  3SYB A;  2Y0H A;  2K0L A;  3LK2 A;  5AFU K;  2XTQ A;  3QRC A;  3HWB A;  5DL6 A;  4O3X B;  3V8U A;  5JDP A;  4FSP A;  4XNL A;  3NSG A;  4Z3T A;  1GFN A;  1ZHZ A;  4N59 A;  4KR8 A;  5IYU A;  1ZHW A;  1BH3 A;  3SY9 A;  1ZHT A;  5ADX L;  2XE2 A;  2M07 A;  4PUX A;  1G90 A;  4FUV A;  4D65 A;  1YS5 A;  4GCP A;  4GF4 A;  2W81 C;  4LSE A;  5FVN A;  3SZD A;  4LSH A;  1MPF A;  5D5D A;  1IZN B;  5DL5 A;  2KC0 A;  1PHO A;  4AUI A;  3JTY A;  4O3Z A;  2KZ7 B;  3AAE B;  2FGQ X;  3VE2 A;  1OSM A;  4FMS A;  2XE3 A;  2W80 C;  3FYX A;  3T0S A;  2ZLD A;  4FOZ A;  4AKR B;  2J4U P;  3UU2 A;  4FZM A;  3AA1 A;  1THQ A;  4D5U A;  1IZN A;  2LHF A;  2F1V A;  4AYE C;  2POR A;  1MM4 A;  2F1T A;  3AAE A;  4JCH A;  3QRA A;  4O4U A;  4U9C A;  4B61 A;  4BUM X;  2K4T A;  2O4V A;  3HW9 A;  3AAA B;  4FRT A;  4AKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...