1OPFA

The structure of ompf porin in a tetragonal crystal form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title The structure of OmpF porin in a tetragonal crystal form.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 96
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 1994-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1opfA00
2QTKA 3VZWX 1HXTA 4FMSA 3VZUX 2Y0KA 3SYBA 5DL6A 4D65A 1MPFA 2J4UP 1E54A 3T20A 6PRNA 4LSHA 4BUMX 3A2SX 1HXXA 3WI4A 3K19A 2XG6A 4D5UA 4RJXA 2Y2XA 3SZVA 4FOZA 1BH3A 1OPFA 2OMFA 2ZLDA 2FGRA 1PHOA 2Y0LA 2Y0HA 3PRNA 1GFOA 5DL7A 2XE5A 3POXA 7PRNA 2ZFGA 3WI5A 3EMNX 4LSFA 4LSEA 5DL8A 3HW9A 4FRTA 4C69X 2XE3A 2PRNA 4GCSA 3VY9X 5PRNA 3NSGA 2J1NA 1GFPA 1OSMA 2FGQX 3SYSA 1HXUA 4LSIA 4AUIA 4FSOA 3VZTX 2O4VA 3SZDA 2ODJA 3T0SA 3FYXA 3JTYA 4FSPA 4GCQA 2XE2A 3UPGA 4JFBA 4KR4A 2XE1A 5DL5A 3UU2A 1BT9A 4KRAA 3SY9A 4FT6A 3HWBA 2K4TA 8PRNA 3PORA 3POUA 1GFMA 1GFNA 3SY7A 4GCPA 3VY8X 5FVNA 4D64A 1PRNA 1GFQA 4FRXA 4RJWA 3T24A 5JDPA 4KR8A 1H6S1 3O0EA 3POQA 2PORA
chains in the Genus database with same CATH superfamily
5KAIO 2F1TA 2QTKA 2R88A 1MM4A 2KXPB 1HXTA 3C5OA 3LK3A 4FMSA 4FZMA 2Y0KA 1T1LA 3VZUX 4AFKA 2KZ7B 3A0HO 5H2FO 2R8AA 3SYBA 5DL6A 3UAQA 4C4VA 4D65A 3AA6A 4C00A 2M07A 3QRAA 5G38A 4AKRA 1MPFA 1ZHZA 1E54A 3DA3A 2J4UP 1QJPA 2N2LA 3AAEB 4IL6O 3LK3B 3T20A 6PRNA 4LSHA 3LK2B 4G76A 4BUMX 1S5LO 2GE4A 2R4LA 1MM5A 4PUXA 4AYMC 3AA7A 3A2SX 1HXXA 4GHBA 4C4VB 4AYID 3A0BO 2MHLA 4UB6O 3WI4A 3K19A 4QQ1A 4AKRB 2XG6A 4O3XB 4O4UA 4RJXA 3VZWX 2Y2XA 3SZVA 2R4NA 4FOZA 3AAAA 4D5UA 5GTHO 1BH3A 3AA7B 1OPFA 2XMXA 4O3YA 1IZNA 5E79O 3GP6A 2OMFA 2N2MA 2ZLDA 2FGRA 2XTQA 1PHOA 3HOEA 4K3CA 5KAFO 5TISO 3PQUA 2Y0LA 3PGSA 2Y0HA 5B5EO 3PRNA 1GFOA 4N74A 5DL7A 4AZLA 4CTDA 1Q9FA 2AXTO 1IZNB 2ERVA 2XE5A 3DZMA 3POXA 3DA4A 7PRNA 2ZFGA 3WI5A 3EMNX 4LSFA 4LSEA 5EE2A 1ZHTA 5DL8A 3HW9A 4FRTA 4C69X 1THQA 2XE3A 3AA1A 3AA6B 2R4OA 2PRNA 2KDYA 3KVDD 3DWNA 4GCSA 4XNLA 3VY9X 3PF1A 4FZNA 4O3WA 2F1CX 4PJ0O 4RLCA 3V8UA 4PR7A 1YS5A 5PRNA 3DWOX 3NSGA 2J1NA 1GFPA 2M06A 1QJ9A 3G7GA 3QRCA 1OSMA 2FGQX 2R89A 1HXUA 4LSIA 3SYSA 4AUIA 3AA0A 4FSOA 4JCHA 4B61A 4U9CA 2IWWA 5G26A 3VZTX 2Y7SA 2O4VA 2LHFA 3RBHA 3AAAB 3SZDA 5AFUK 2ODJA 4AKMA 3T0SA 2F1VA 2WJQA 4AYDC 1ZHXA 2JQYA 3FYXA 3JTYA 4FSPA 4GCQA 3PGRA 2XE2A 3UPGA 5T5FA 1T16A 4O3ZA 4K3BA 3HOLA 4FUVA 4JFBA 3PGUA 3WU2O 2KZ7A 4O49A 5GTIO 3VE1A 4E1TA 4KR4A 4N58A 3LK42 2YPVA 4RLBA 4E1SA 5JDPA 5ADXK 2XE1A 3JCUO 1ZHWA 5DL5A 3UU2A 4F4BA 1BT9A 4AYNA 4Z3TA 3LK2A 2IWVA 4FESA 5GV0A 4KRAA 2JMMA 3AA1B 2XTRA 4FT6A 4N75A 3SY9A 5AFUL 3NJTA 2K0LA 3HWBA 4FQEA 1ORMA 1ZHYA 1G90A 4N59A 4GF4A 3LK41 4XNKA 3BS0A 1P4TA 2K4TA 4AYEC 8PRNA 2WVPA 3PQSA 4FZLA 3BRZA 3PORA 4UB8O 3POUA 1GFMA 2KC0A 3AA0B 1GFNA 3BRYA 5D5DA 3SY7A 2X9KA 5G3AA 4GCPA 3VY8X 4G75A 2WJRA 2W81C 2KXPA 3KZIO 4O4XA 2LFUA 1QJ8A 2MNHA 2YNKA 5FVNA 3TZGA 1PRNA 4D64A 5B66O 5ADXL 1GFQA 4FRXA 5IYUA 4RJWA 2R4PA 4RL9A 3T24A 1Q9GA 4KR8A 1H6S1 3O0EA 1BXWA 2X27X 3POQA 2PORA 5G39A 3VE2A 2W80C 3AAEA
chains in the Genus database with same CATH topology
2F1TA 2QTKA 3LK3A 1MM4A 2KXPB 1HXTA 3C5OA 4FMSA 4FZMA 3VZUX 2Y0KA 4AFKA 2KZ7B 3SYBA 5DL6A 3UAQA 4D65A 3AA6A 2M07A 3QRAA 4AKRA 1MPFA 1ZHZA 1E54A 3DA3A 2J4UP 1QJPA 2N2LA 3AAEB 3LK3B 3T20A 6PRNA 4LSHA 3LK2B 4G76A 4BUMX 2GE4A 1MM5A 4PUXA 4AYMC 3AA7A 3A2SX 1HXXA 4GHBA 4AYID 2MHLA 3WI4A 3K19A 4QQ1A 4AKRB 2XG6A 4O3XB 4O4UA 4RJXA 3VZWX 2Y2XA 3SZVA 4D5UA 4FOZA 3AAAA 1BH3A 3AA7B 1OPFA 2XMXA 4O3YA 1IZNA 3GP6A 2OMFA 2N2MA 2ZLDA 2FGRA 2XTQA 1PHOA 3HOEA 3PQUA 2Y0LA 2Y0HA 3PRNA 1GFOA 5DL7A 4AZLA 1Q9FA 1IZNB 2ERVA 2XE5A 3POXA 3DA4A 7PRNA 2ZFGA 3WI5A 3EMNX 4LSFA 4LSEA 5EE2A 1ZHTA 5DL8A 3HW9A 4FRTA 4C69X 1THQA 2XE3A 3AA1A 3AA6B 2PRNA 2KDYA 3KVDD 4GCSA 4XNLA 3VY9X 4FZNA 4O3WA 4RLCA 3V8UA 1YS5A 5PRNA 3NSGA 2J1NA 1GFPA 2M06A 1QJ9A 3G7GA 3QRCA 1OSMA 2FGQX 3SYSA 1HXUA 4LSIA 4AUIA 3AA0A 4FSOA 4JCHA 4B61A 4U9CA 5G26A 3VZTX 2Y7SA 2O4VA 2LHFA 3RBHA 3AAAB 3SZDA 5AFUK 2ODJA 4AKMA 3T0SA 2F1VA 4AYDC 1ZHXA 3FYXA 3JTYA 4FSPA 4GCQA 2XE2A 3UPGA 5T5FA 4O3ZA 3HOLA 4FUVA 4JFBA 2KZ7A 4O49A 3VE1A 4E1TA 4KR4A 4N58A 3LK42 2YPVA 4RLBA 4E1SA 5JDPA 5ADXK 2XE1A 1ZHWA 5DL5A 3UU2A 4F4BA 1BT9A 4AYNA 4Z3TA 3LK2A 4FESA 5GV0A 4KRAA 2JMMA 3AA1B 2XTRA 4FT6A 3SY9A 5AFUL 2K0LA 3HWBA 1ORMA 1ZHYA 1G90A 4N59A 4GF4A 3LK41 4XNKA 1P4TA 2K4TA 4AYEC 8PRNA 3PQSA 4FZLA 3PORA 3POUA 1GFMA 2KC0A 3AA0B 1GFNA 5D5DA 3SY7A 4GCPA 3VY8X 4G75A 2W81C 2KXPA 3TZGA 4O4XA 2LFUA 1QJ8A 2MNHA 2YNKA 5FVNA 4D64A 1PRNA 5ADXL 1GFQA 4FRXA 5IYUA 4RJWA 4RL9A 3T24A 1Q9GA 4KR8A 1H6S1 3O0EA 1BXWA 2X27X 3POQA 2PORA 3VE2A 2W80C 3AAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTK A;  3VZW X;  1HXT A;  4FMS A;  3VZU X;  2Y0K A;  3SYB A;  5DL6 A;  4D65 A;  1MPF A;  2J4U P;  1E54 A;  3T20 A;  6PRN A;  4LSH A;  4BUM X;  3A2S X;  1HXX A;  3WI4 A;  3K19 A;  2XG6 A;  4D5U A;  4RJX A;  2Y2X A;  3SZV A;  4FOZ A;  1BH3 A;  1OPF A;  2OMF A;  2ZLD A;  2FGR A;  1PHO A;  2Y0L A;  2Y0H A;  3PRN A;  1GFO A;  5DL7 A;  2XE5 A;  3POX A;  7PRN A;  2ZFG A;  3WI5 A;  3EMN X;  4LSF A;  4LSE A;  5DL8 A;  3HW9 A;  4FRT A;  4C69 X;  2XE3 A;  2PRN A;  4GCS A;  3VY9 X;  5PRN A;  3NSG A;  2J1N A;  1GFP A;  1OSM A;  2FGQ X;  3SYS A;  1HXU A;  4LSI A;  4AUI A;  4FSO A;  3VZT X;  2O4V A;  3SZD A;  2ODJ A;  3T0S A;  3FYX A;  3JTY A;  4FSP A;  4GCQ A;  2XE2 A;  3UPG A;  4JFB A;  4KR4 A;  2XE1 A;  5DL5 A;  3UU2 A;  1BT9 A;  4KRA A;  3SY9 A;  4FT6 A;  3HWB A;  2K4T A;  8PRN A;  3POR A;  3POU A;  1GFM A;  1GFN A;  3SY7 A;  4GCP A;  3VY8 X;  5FVN A;  4D64 A;  1PRN A;  1GFQ A;  4FRX A;  4RJW A;  3T24 A;  5JDP A;  4KR8 A;  1H6S 1;  3O0E A;  3POQ A;  2POR A; 
#chains in the Genus database with same CATH topology
 5KAI O;  2F1T A;  2QTK A;  2R88 A;  1MM4 A;  2KXP B;  1HXT A;  3C5O A;  3LK3 A;  4FMS A;  4FZM A;  2Y0K A;  1T1L A;  3VZU X;  4AFK A;  2KZ7 B;  3A0H O;  5H2F O;  2R8A A;  3SYB A;  5DL6 A;  3UAQ A;  4C4V A;  4D65 A;  3AA6 A;  4C00 A;  2M07 A;  3QRA A;  5G38 A;  4AKR A;  1MPF A;  1ZHZ A;  1E54 A;  3DA3 A;  2J4U P;  1QJP A;  2N2L A;  3AAE B;  4IL6 O;  3LK3 B;  3T20 A;  6PRN A;  4LSH A;  3LK2 B;  4G76 A;  4BUM X;  1S5L O;  2GE4 A;  2R4L A;  1MM5 A;  4PUX A;  4AYM C;  3AA7 A;  3A2S X;  1HXX A;  4GHB A;  4C4V B;  4AYI D;  3A0B O;  2MHL A;  4UB6 O;  3WI4 A;  3K19 A;  4QQ1 A;  4AKR B;  2XG6 A;  4O3X B;  4O4U A;  4RJX A;  3VZW X;  2Y2X A;  3SZV A;  2R4N A;  4FOZ A;  3AAA A;  4D5U A;  5GTH O;  1BH3 A;  3AA7 B;  1OPF A;  2XMX A;  4O3Y A;  1IZN A;  5E79 O;  3GP6 A;  2OMF A;  2N2M A;  2ZLD A;  2FGR A;  2XTQ A;  1PHO A;  3HOE A;  4K3C A;  5KAF O;  5TIS O;  3PQU A;  2Y0L A;  3PGS A;  2Y0H A;  5B5E O;  3PRN A;  1GFO A;  4N74 A;  5DL7 A;  4AZL A;  4CTD A;  1Q9F A;  2AXT O;  1IZN B;  2ERV A;  2XE5 A;  3DZM A;  3POX A;  3DA4 A;  7PRN A;  2ZFG A;  3WI5 A;  3EMN X;  4LSF A;  4LSE A;  5EE2 A;  1ZHT A;  5DL8 A;  3HW9 A;  4FRT A;  4C69 X;  1THQ A;  2XE3 A;  3AA1 A;  3AA6 B;  2R4O A;  2PRN A;  2KDY A;  3KVD D;  3DWN A;  4GCS A;  4XNL A;  3VY9 X;  3PF1 A;  4FZN A;  4O3W A;  2F1C X;  4PJ0 O;  4RLC A;  3V8U A;  4PR7 A;  1YS5 A;  5PRN A;  3DWO X;  3NSG A;  2J1N A;  1GFP A;  2M06 A;  1QJ9 A;  3G7G A;  3QRC A;  1OSM A;  2FGQ X;  2R89 A;  1HXU A;  4LSI A;  3SYS A;  4AUI A;  3AA0 A;  4FSO A;  4JCH A;  4B61 A;  4U9C A;  2IWW A;  5G26 A;  3VZT X;  2Y7S A;  2O4V A;  2LHF A;  3RBH A;  3AAA B;  3SZD A;  5AFU K;  2ODJ A;  4AKM A;  3T0S A;  2F1V A;  2WJQ A;  4AYD C;  1ZHX A;  2JQY A;  3FYX A;  3JTY A;  4FSP A;  4GCQ A;  3PGR A;  2XE2 A;  3UPG A;  5T5F A;  1T16 A;  4O3Z A;  4K3B A;  3HOL A;  4FUV A;  4JFB A;  3PGU A;  3WU2 O;  2KZ7 A;  4O49 A;  5GTI O;  3VE1 A;  4E1T A;  4KR4 A;  4N58 A;  3LK4 2;  2YPV A;  4RLB A;  4E1S A;  5JDP A;  5ADX K;  2XE1 A;  3JCU O;  1ZHW A;  5DL5 A;  3UU2 A;  4F4B A;  1BT9 A;  4AYN A;  4Z3T A;  3LK2 A;  2IWV A;  4FES A;  5GV0 A;  4KRA A;  2JMM A;  3AA1 B;  2XTR A;  4FT6 A;  4N75 A;  3SY9 A;  5AFU L;  3NJT A;  2K0L A;  3HWB A;  4FQE A;  1ORM A;  1ZHY A;  1G90 A;  4N59 A;  4GF4 A;  3LK4 1;  4XNK A;  3BS0 A;  1P4T A;  2K4T A;  4AYE C;  8PRN A;  2WVP A;  3PQS A;  4FZL A;  3BRZ A;  3POR A;  4UB8 O;  3POU A;  1GFM A;  2KC0 A;  3AA0 B;  1GFN A;  3BRY A;  5D5D A;  3SY7 A;  2X9K A;  5G3A A;  4GCP A;  3VY8 X;  4G75 A;  2WJR A;  2W81 C;  2KXP A;  3KZI O;  4O4X A;  2LFU A;  1QJ8 A;  2MNH A;  2YNK A;  5FVN A;  3TZG A;  1PRN A;  4D64 A;  5B66 O;  5ADX L;  1GFQ A;  4FRX A;  5IYU A;  4RJW A;  2R4P A;  4RL9 A;  3T24 A;  1Q9G A;  4KR8 A;  1H6S 1;  3O0E A;  1BXW A;  2X27 X;  3POQ A;  2POR A;  5G39 A;  3VE2 A;  2W80 C;  3AAE A; 
#chains in the Genus database with same CATH homology
 2F1T A;  2QTK A;  3LK3 A;  1MM4 A;  2KXP B;  1HXT A;  3C5O A;  4FMS A;  4FZM A;  3VZU X;  2Y0K A;  4AFK A;  2KZ7 B;  3SYB A;  5DL6 A;  3UAQ A;  4D65 A;  3AA6 A;  2M07 A;  3QRA A;  4AKR A;  1MPF A;  1ZHZ A;  1E54 A;  3DA3 A;  2J4U P;  1QJP A;  2N2L A;  3AAE B;  3LK3 B;  3T20 A;  6PRN A;  4LSH A;  3LK2 B;  4G76 A;  4BUM X;  2GE4 A;  1MM5 A;  4PUX A;  4AYM C;  3AA7 A;  3A2S X;  1HXX A;  4GHB A;  4AYI D;  2MHL A;  3WI4 A;  3K19 A;  4QQ1 A;  4AKR B;  2XG6 A;  4O3X B;  4O4U A;  4RJX A;  3VZW X;  2Y2X A;  3SZV A;  4D5U A;  4FOZ A;  3AAA A;  1BH3 A;  3AA7 B;  1OPF A;  2XMX A;  4O3Y A;  1IZN A;  3GP6 A;  2OMF A;  2N2M A;  2ZLD A;  2FGR A;  2XTQ A;  1PHO A;  3HOE A;  3PQU A;  2Y0L A;  2Y0H A;  3PRN A;  1GFO A;  5DL7 A;  4AZL A;  1Q9F A;  1IZN B;  2ERV A;  2XE5 A;  3POX A;  3DA4 A;  7PRN A;  2ZFG A;  3WI5 A;  3EMN X;  4LSF A;  4LSE A;  5EE2 A;  1ZHT A;  5DL8 A;  3HW9 A;  4FRT A;  4C69 X;  1THQ A;  2XE3 A;  3AA1 A;  3AA6 B;  2PRN A;  2KDY A;  3KVD D;  4GCS A;  4XNL A;  3VY9 X;  4FZN A;  4O3W A;  4RLC A;  3V8U A;  1YS5 A;  5PRN A;  3NSG A;  2J1N A;  1GFP A;  2M06 A;  1QJ9 A;  3G7G A;  3QRC A;  1OSM A;  2FGQ X;  3SYS A;  1HXU A;  4LSI A;  4AUI A;  3AA0 A;  4FSO A;  4JCH A;  4B61 A;  4U9C A;  5G26 A;  3VZT X;  2Y7S A;  2O4V A;  2LHF A;  3RBH A;  3AAA B;  3SZD A;  5AFU K;  2ODJ A;  4AKM A;  3T0S A;  2F1V A;  4AYD C;  1ZHX A;  3FYX A;  3JTY A;  4FSP A;  4GCQ A;  2XE2 A;  3UPG A;  5T5F A;  4O3Z A;  3HOL A;  4FUV A;  4JFB A;  2KZ7 A;  4O49 A;  3VE1 A;  4E1T A;  4KR4 A;  4N58 A;  3LK4 2;  2YPV A;  4RLB A;  4E1S A;  5JDP A;  5ADX K;  2XE1 A;  1ZHW A;  5DL5 A;  3UU2 A;  4F4B A;  1BT9 A;  4AYN A;  4Z3T A;  3LK2 A;  4FES A;  5GV0 A;  4KRA A;  2JMM A;  3AA1 B;  2XTR A;  4FT6 A;  3SY9 A;  5AFU L;  2K0L A;  3HWB A;  1ORM A;  1ZHY A;  1G90 A;  4N59 A;  4GF4 A;  3LK4 1;  4XNK A;  1P4T A;  2K4T A;  4AYE C;  8PRN A;  3PQS A;  4FZL A;  3POR A;  3POU A;  1GFM A;  2KC0 A;  3AA0 B;  1GFN A;  5D5D A;  3SY7 A;  4GCP A;  3VY8 X;  4G75 A;  2W81 C;  2KXP A;  3TZG A;  4O4X A;  2LFU A;  1QJ8 A;  2MNH A;  2YNK A;  5FVN A;  4D64 A;  1PRN A;  5ADX L;  1GFQ A;  4FRX A;  5IYU A;  4RJW A;  4RL9 A;  3T24 A;  1Q9G A;  4KR8 A;  1H6S 1;  3O0E A;  1BXW A;  2X27 X;  3POQ A;  2POR A;  3VE2 A;  2W80 C;  3AAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...