3SY9A

Crystal structure of pseudomonas aeruginosa occd2 (opdc)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
416
structure length
371
Chain Sequence
EGFIEGSSLQLLTRNYYFNHDRRSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTFRGVSLTNNSFEDLTLTAGQVSFTKYYNDSHHLSWLGGTWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQYDYDFVALGVPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Histidine porin OpdC
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 101
structure length 371
sequence length 416
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sy9A01
2Y0KA 5PRNA 1BT9A 1HXUA 3WI5A 3HW9A 1BH3A 2J4UP 3SYSA 2PORA 3O0EA 1OPFA 3POUA 3UPGA 3K19A 4FRXA 4FSOA 4FMSA 4BUMX 2J1NA 3SYBA 3VZTX 1PRNA 2Y0HA 3POXA 3VY8X 4GCSA 1OSMA 6PRNA 2XE3A 3T0SA 1HXTA 4LSEA 5JDPA 2FGRA 4RJWA 4LSIA 5DL5A 3UU2A 3SZDA 4GCQA 3T24A 1HXXA 4JFBA 2K4TA 1GFOA 4LSFA 2QTKA 4GCPA 7PRNA 1GFQA 5DL8A 1GFPA 3VZWX 4D64A 3FYXA 2XE5A 2PRNA 3SZVA 3NSGA 3T20A 1GFNA 1PHOA 4FSPA 5DL6A 2O4VA 3POQA 1GFMA 5DL7A 4FOZA 5FVNA 2XG6A 3HWBA 2FGQX 4C69X 2XE1A 2ZLDA 4AUIA 4KR4A 3SY7A 3EMNX 3SY9A 4LSHA 2Y2XA 2Y0LA 2XE2A 3JTYA 4D65A 2OMFA 3A2SX 4FRTA 4KRAA 3VZUX 4FT6A 1MPFA 2ODJA 3WI4A 1E54A 4RJXA 3PORA 4D5UA 1H6S1 4KR8A 8PRNA 2ZFGA 3PRNA 3VY9X
chains in the Genus database with same CATH superfamily
2Y0KA 3PQUA 5KAFO 3DA4A 4AYDC 1QJ8A 5PRNA 2KZ7A 1BT9A 1HXUA 1QJPA 2R8AA 4N74A 4XNLA 3WI5A 3JCUO 2W81C 4K3BA 4IL6O 4E1TA 4XNKA 4O4UA 4Z3TA 3HW9A 2R88A 1BH3A 3PGRA 2XMXA 2J4UP 3HOLA 5ADXL 3SYSA 3AAAA 4N58A 4UB6O 3LK42 2PORA 3NJTA 1OPFA 3C5OA 3O0EA 3POUA 3K19A 5GTIO 4AYMC 3UPGA 4FRXA 5E79O 4AYNA 4FSOA 4FMSA 4QQ1A 4BUMX 4AKMA 2J1NA 1IZNA 3GP6A 1MM5A 3LK3A 3PQSA 3SYBA 3VZTX 4RLBA 1PRNA 4O4XA 2Y0HA 3POXA 4AYEC 3VY8X 4RJWA 2X27X 5GV0A 4GCSA 1OSMA 1MM4A 6PRNA 5B66O 2XE3A 1THQA 3QRAA 2F1TA 1QJ9A 2R89A 4AKRB 3G7GA 3AAEB 3T0SA 4AFKA 1HXTA 5AFUK 4C4VA 4LSEA 5JDPA 3LK2A 2IWVA 2WJRA 4RLCA 3DWNA 2FGRA 2W80C 3AA7A 2KXPA 2N2MA 2R4OA 3AA1A 4LSIA 2LFUA 2N2LA 2K0LA 5DL5A 3SZDA 2MHLA 5G3AA 3UAQA 1P4TA 4GCQA 3T24A 4AYID 3BRZA 3PF1A 1HXXA 4JFBA 4GHBA 3WU2O 2WVPA 3DA3A 4AZLA 2K4TA 3LK41 5G38A 5H2FO 1GFOA 5IYUA 2M07A 2YNKA 3AA6A 4LSFA 4O3WA 2QTKA 1IZNB 3AA0A 4GCPA 7PRNA 3RBHA 1BXWA 1GFQA 5DL8A 1S5LO 1GFPA 2LHFA 4PR7A 4GF4A 4N59A 3VZWX 2R4PA 4D64A 3UU2A 2WJQA 5T5FA 3FYXA 3BS0A 4U9CA 5AFUL 4C00A 2XE5A 4O3XB 2PRNA 3T20A 3SZVA 2KZ7B 2M06A 4PJ0O 3AA7B 3VE1A 2KXPB 3AA1B 4G75A 4PUXA 1ZHZA 3NSGA 3QRCA 4G76A 2JQYA 3HOEA 2XTQA 4E1SA 5G39A 1T16A 1GFNA 1PHOA 1Q9FA 4FSPA 4UB8O 5DL6A 5ADXK 2MNHA 2O4VA 4K3CA 3AAAB 3POQA 1GFMA 2X9KA 5DL7A 4RL9A 4FOZA 4FQEA 5FVNA 5D5DA 3KVDD 1ORMA 2XG6A 3AA0B 5G26A 4O3ZA 8PRNA 3LK3B 1YS5A 3HWBA 2FGQX 2ERVA 3V8UA 4O3YA 4C69X 2IWWA 4FESA 5EE2A 3A0HO 1ZHWA 2JMMA 3DWOX 2XE1A 2AXTO 2ZLDA 5KAIO 4AUIA 4KR4A 3SY7A 4AKRA 3VE2A 3AAEA 3PGUA 3EMNX 3SY9A 2YPVA 4C4VB 1ZHXA 3LK2B 3PGSA 2KC0A 4LSHA 2Y2XA 1Q9GA 2Y0LA 5TISO 2XE2A 4F4BA 2F1CX 4JCHA 1T1LA 3JTYA 4D65A 2OMFA 1ZHYA 1G90A 3A2SX 4FRTA 4FUVA 4N75A 5B5EO 4FZMA 5GTHO 1ZHTA 3A0BO 3AA6B 4O49A 4KRAA 3VZUX 2R4LA 4FT6A 3TZGA 1MPFA 2ODJA 3KZIO 2Y7SA 3DZMA 2KDYA 2XTRA 2GE4A 3WI4A 1E54A 4RJXA 4CTDA 2R4NA 3PORA 2F1VA 4D5UA 1H6S1 4B61A 4KR8A 3BRYA 4FZLA 4FZNA 2ZFGA 3PRNA 3VY9X
chains in the Genus database with same CATH topology
2Y0KA 3PQUA 3DA4A 4AYDC 1QJ8A 5PRNA 2KZ7A 1BT9A 1HXUA 1QJPA 3WI5A 4XNLA 2W81C 4E1TA 4XNKA 4O4UA 4Z3TA 3HW9A 1BH3A 2XMXA 2J4UP 3HOLA 5ADXL 3SYSA 3AAAA 4N58A 3LK42 2PORA 3O0EA 1OPFA 3C5OA 3POUA 3UPGA 3K19A 4AYMC 4FRXA 4AYNA 4FSOA 4FMSA 4QQ1A 4BUMX 4AKMA 2J1NA 1IZNA 3GP6A 1MM5A 3LK3A 3PQSA 3SYBA 3VZTX 4RLBA 1PRNA 4O4XA 2Y0HA 3POXA 4AYEC 3VY8X 2X27X 5GV0A 4GCSA 1OSMA 1MM4A 6PRNA 2XE3A 1THQA 3QRAA 2F1TA 1QJ9A 4AKRB 3G7GA 3AAEB 3T0SA 4AFKA 1HXTA 5AFUK 4LSEA 5JDPA 3LK2A 4RLCA 2FGRA 2W80C 3AA7A 2KXPA 2N2MA 3AA1A 4LSIA 4RJWA 2LFUA 2N2LA 2K0LA 5DL5A 3SZDA 2MHLA 3UAQA 1P4TA 4GCQA 3T24A 4AYID 1HXXA 4JFBA 4GHBA 4AZLA 3DA3A 2K4TA 3LK41 1GFOA 5IYUA 2M07A 2YNKA 3AA6A 4LSFA 4O3WA 2QTKA 1IZNB 3AA0A 4GCPA 7PRNA 3RBHA 1BXWA 1GFQA 5DL8A 1GFPA 2LHFA 4GF4A 4N59A 3VZWX 4D64A 3UU2A 5T5FA 3FYXA 4U9CA 5AFUL 2XE5A 4O3XB 2PRNA 3SZVA 2KZ7B 2M06A 3VE1A 3AA7B 2KXPB 3AA1B 4G75A 4PUXA 1ZHZA 3NSGA 3QRCA 4G76A 3HOEA 2XTQA 4E1SA 3T20A 1GFNA 1PHOA 1Q9FA 4FSPA 5DL6A 5ADXK 2MNHA 2O4VA 3AAAB 3POQA 1GFMA 5DL7A 4RL9A 4FOZA 5FVNA 5D5DA 3KVDD 1ORMA 2XG6A 3AA0B 5G26A 4O3ZA 8PRNA 3LK3B 1YS5A 3HWBA 2FGQX 2ERVA 3V8UA 4O3YA 4C69X 4FESA 5EE2A 1ZHWA 2JMMA 2XE1A 2ZLDA 4AUIA 4KR4A 3SY7A 4AKRA 3VE2A 3AAEA 3EMNX 3SY9A 2YPVA 1ZHXA 3LK2B 2KC0A 4LSHA 2Y2XA 1Q9GA 2Y0LA 2XE2A 4F4BA 4JCHA 3JTYA 4D65A 2OMFA 1ZHYA 1G90A 3A2SX 4FRTA 4FUVA 4FZMA 1ZHTA 3AA6B 4O49A 4KRAA 3VZUX 4FT6A 3TZGA 1MPFA 2ODJA 2Y7SA 2KDYA 2XTRA 2GE4A 3WI4A 1E54A 4RJXA 3PORA 2F1VA 4D5UA 1H6S1 4B61A 4KR8A 4FZLA 4FZNA 2ZFGA 3PRNA 3VY9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0K A;  5PRN A;  1BT9 A;  1HXU A;  3WI5 A;  3HW9 A;  1BH3 A;  2J4U P;  3SYS A;  2POR A;  3O0E A;  1OPF A;  3POU A;  3UPG A;  3K19 A;  4FRX A;  4FSO A;  4FMS A;  4BUM X;  2J1N A;  3SYB A;  3VZT X;  1PRN A;  2Y0H A;  3POX A;  3VY8 X;  4GCS A;  1OSM A;  6PRN A;  2XE3 A;  3T0S A;  1HXT A;  4LSE A;  5JDP A;  2FGR A;  4RJW A;  4LSI A;  5DL5 A;  3UU2 A;  3SZD A;  4GCQ A;  3T24 A;  1HXX A;  4JFB A;  2K4T A;  1GFO A;  4LSF A;  2QTK A;  4GCP A;  7PRN A;  1GFQ A;  5DL8 A;  1GFP A;  3VZW X;  4D64 A;  3FYX A;  2XE5 A;  2PRN A;  3SZV A;  3NSG A;  3T20 A;  1GFN A;  1PHO A;  4FSP A;  5DL6 A;  2O4V A;  3POQ A;  1GFM A;  5DL7 A;  4FOZ A;  5FVN A;  2XG6 A;  3HWB A;  2FGQ X;  4C69 X;  2XE1 A;  2ZLD A;  4AUI A;  4KR4 A;  3SY7 A;  3EMN X;  3SY9 A;  4LSH A;  2Y2X A;  2Y0L A;  2XE2 A;  3JTY A;  4D65 A;  2OMF A;  3A2S X;  4FRT A;  4KRA A;  3VZU X;  4FT6 A;  1MPF A;  2ODJ A;  3WI4 A;  1E54 A;  4RJX A;  3POR A;  4D5U A;  1H6S 1;  4KR8 A;  8PRN A;  2ZFG A;  3PRN A;  3VY9 X; 
#chains in the Genus database with same CATH topology
 2Y0K A;  3PQU A;  5KAF O;  3DA4 A;  4AYD C;  1QJ8 A;  5PRN A;  2KZ7 A;  1BT9 A;  1HXU A;  1QJP A;  2R8A A;  4N74 A;  4XNL A;  3WI5 A;  3JCU O;  2W81 C;  4K3B A;  4IL6 O;  4E1T A;  4XNK A;  4O4U A;  4Z3T A;  3HW9 A;  2R88 A;  1BH3 A;  3PGR A;  2XMX A;  2J4U P;  3HOL A;  5ADX L;  3SYS A;  3AAA A;  4N58 A;  4UB6 O;  3LK4 2;  2POR A;  3NJT A;  1OPF A;  3C5O A;  3O0E A;  3POU A;  3K19 A;  5GTI O;  4AYM C;  3UPG A;  4FRX A;  5E79 O;  4AYN A;  4FSO A;  4FMS A;  4QQ1 A;  4BUM X;  4AKM A;  2J1N A;  1IZN A;  3GP6 A;  1MM5 A;  3LK3 A;  3PQS A;  3SYB A;  3VZT X;  4RLB A;  1PRN A;  4O4X A;  2Y0H A;  3POX A;  4AYE C;  3VY8 X;  4RJW A;  2X27 X;  5GV0 A;  4GCS A;  1OSM A;  1MM4 A;  6PRN A;  5B66 O;  2XE3 A;  1THQ A;  3QRA A;  2F1T A;  1QJ9 A;  2R89 A;  4AKR B;  3G7G A;  3AAE B;  3T0S A;  4AFK A;  1HXT A;  5AFU K;  4C4V A;  4LSE A;  5JDP A;  3LK2 A;  2IWV A;  2WJR A;  4RLC A;  3DWN A;  2FGR A;  2W80 C;  3AA7 A;  2KXP A;  2N2M A;  2R4O A;  3AA1 A;  4LSI A;  2LFU A;  2N2L A;  2K0L A;  5DL5 A;  3SZD A;  2MHL A;  5G3A A;  3UAQ A;  1P4T A;  4GCQ A;  3T24 A;  4AYI D;  3BRZ A;  3PF1 A;  1HXX A;  4JFB A;  4GHB A;  3WU2 O;  2WVP A;  3DA3 A;  4AZL A;  2K4T A;  3LK4 1;  5G38 A;  5H2F O;  1GFO A;  5IYU A;  2M07 A;  2YNK A;  3AA6 A;  4LSF A;  4O3W A;  2QTK A;  1IZN B;  3AA0 A;  4GCP A;  7PRN A;  3RBH A;  1BXW A;  1GFQ A;  5DL8 A;  1S5L O;  1GFP A;  2LHF A;  4PR7 A;  4GF4 A;  4N59 A;  3VZW X;  2R4P A;  4D64 A;  3UU2 A;  2WJQ A;  5T5F A;  3FYX A;  3BS0 A;  4U9C A;  5AFU L;  4C00 A;  2XE5 A;  4O3X B;  2PRN A;  3T20 A;  3SZV A;  2KZ7 B;  2M06 A;  4PJ0 O;  3AA7 B;  3VE1 A;  2KXP B;  3AA1 B;  4G75 A;  4PUX A;  1ZHZ A;  3NSG A;  3QRC A;  4G76 A;  2JQY A;  3HOE A;  2XTQ A;  4E1S A;  5G39 A;  1T16 A;  1GFN A;  1PHO A;  1Q9F A;  4FSP A;  4UB8 O;  5DL6 A;  5ADX K;  2MNH A;  2O4V A;  4K3C A;  3AAA B;  3POQ A;  1GFM A;  2X9K A;  5DL7 A;  4RL9 A;  4FOZ A;  4FQE A;  5FVN A;  5D5D A;  3KVD D;  1ORM A;  2XG6 A;  3AA0 B;  5G26 A;  4O3Z A;  8PRN A;  3LK3 B;  1YS5 A;  3HWB A;  2FGQ X;  2ERV A;  3V8U A;  4O3Y A;  4C69 X;  2IWW A;  4FES A;  5EE2 A;  3A0H O;  1ZHW A;  2JMM A;  3DWO X;  2XE1 A;  2AXT O;  2ZLD A;  5KAI O;  4AUI A;  4KR4 A;  3SY7 A;  4AKR A;  3VE2 A;  3AAE A;  3PGU A;  3EMN X;  3SY9 A;  2YPV A;  4C4V B;  1ZHX A;  3LK2 B;  3PGS A;  2KC0 A;  4LSH A;  2Y2X A;  1Q9G A;  2Y0L A;  5TIS O;  2XE2 A;  4F4B A;  2F1C X;  4JCH A;  1T1L A;  3JTY A;  4D65 A;  2OMF A;  1ZHY A;  1G90 A;  3A2S X;  4FRT A;  4FUV A;  4N75 A;  5B5E O;  4FZM A;  5GTH O;  1ZHT A;  3A0B O;  3AA6 B;  4O49 A;  4KRA A;  3VZU X;  2R4L A;  4FT6 A;  3TZG A;  1MPF A;  2ODJ A;  3KZI O;  2Y7S A;  3DZM A;  2KDY A;  2XTR A;  2GE4 A;  3WI4 A;  1E54 A;  4RJX A;  4CTD A;  2R4N A;  3POR A;  2F1V A;  4D5U A;  1H6S 1;  4B61 A;  4KR8 A;  3BRY A;  4FZL A;  4FZN A;  2ZFG A;  3PRN A;  3VY9 X; 
#chains in the Genus database with same CATH homology
 2Y0K A;  3PQU A;  3DA4 A;  4AYD C;  1QJ8 A;  5PRN A;  2KZ7 A;  1BT9 A;  1HXU A;  1QJP A;  3WI5 A;  4XNL A;  2W81 C;  4E1T A;  4XNK A;  4O4U A;  4Z3T A;  3HW9 A;  1BH3 A;  2XMX A;  2J4U P;  3HOL A;  5ADX L;  3SYS A;  3AAA A;  4N58 A;  3LK4 2;  2POR A;  3O0E A;  1OPF A;  3C5O A;  3POU A;  3UPG A;  3K19 A;  4AYM C;  4FRX A;  4AYN A;  4FSO A;  4FMS A;  4QQ1 A;  4BUM X;  4AKM A;  2J1N A;  1IZN A;  3GP6 A;  1MM5 A;  3LK3 A;  3PQS A;  3SYB A;  3VZT X;  4RLB A;  1PRN A;  4O4X A;  2Y0H A;  3POX A;  4AYE C;  3VY8 X;  2X27 X;  5GV0 A;  4GCS A;  1OSM A;  1MM4 A;  6PRN A;  2XE3 A;  1THQ A;  3QRA A;  2F1T A;  1QJ9 A;  4AKR B;  3G7G A;  3AAE B;  3T0S A;  4AFK A;  1HXT A;  5AFU K;  4LSE A;  5JDP A;  3LK2 A;  4RLC A;  2FGR A;  2W80 C;  3AA7 A;  2KXP A;  2N2M A;  3AA1 A;  4LSI A;  4RJW A;  2LFU A;  2N2L A;  2K0L A;  5DL5 A;  3SZD A;  2MHL A;  3UAQ A;  1P4T A;  4GCQ A;  3T24 A;  4AYI D;  1HXX A;  4JFB A;  4GHB A;  4AZL A;  3DA3 A;  2K4T A;  3LK4 1;  1GFO A;  5IYU A;  2M07 A;  2YNK A;  3AA6 A;  4LSF A;  4O3W A;  2QTK A;  1IZN B;  3AA0 A;  4GCP A;  7PRN A;  3RBH A;  1BXW A;  1GFQ A;  5DL8 A;  1GFP A;  2LHF A;  4GF4 A;  4N59 A;  3VZW X;  4D64 A;  3UU2 A;  5T5F A;  3FYX A;  4U9C A;  5AFU L;  2XE5 A;  4O3X B;  2PRN A;  3SZV A;  2KZ7 B;  2M06 A;  3VE1 A;  3AA7 B;  2KXP B;  3AA1 B;  4G75 A;  4PUX A;  1ZHZ A;  3NSG A;  3QRC A;  4G76 A;  3HOE A;  2XTQ A;  4E1S A;  3T20 A;  1GFN A;  1PHO A;  1Q9F A;  4FSP A;  5DL6 A;  5ADX K;  2MNH A;  2O4V A;  3AAA B;  3POQ A;  1GFM A;  5DL7 A;  4RL9 A;  4FOZ A;  5FVN A;  5D5D A;  3KVD D;  1ORM A;  2XG6 A;  3AA0 B;  5G26 A;  4O3Z A;  8PRN A;  3LK3 B;  1YS5 A;  3HWB A;  2FGQ X;  2ERV A;  3V8U A;  4O3Y A;  4C69 X;  4FES A;  5EE2 A;  1ZHW A;  2JMM A;  2XE1 A;  2ZLD A;  4AUI A;  4KR4 A;  3SY7 A;  4AKR A;  3VE2 A;  3AAE A;  3EMN X;  3SY9 A;  2YPV A;  1ZHX A;  3LK2 B;  2KC0 A;  4LSH A;  2Y2X A;  1Q9G A;  2Y0L A;  2XE2 A;  4F4B A;  4JCH A;  3JTY A;  4D65 A;  2OMF A;  1ZHY A;  1G90 A;  3A2S X;  4FRT A;  4FUV A;  4FZM A;  1ZHT A;  3AA6 B;  4O49 A;  4KRA A;  3VZU X;  4FT6 A;  3TZG A;  1MPF A;  2ODJ A;  2Y7S A;  2KDY A;  2XTR A;  2GE4 A;  3WI4 A;  1E54 A;  4RJX A;  3POR A;  2F1V A;  4D5U A;  1H6S 1;  4B61 A;  4KR8 A;  4FZL A;  4FZN A;  2ZFG A;  3PRN A;  3VY9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...