3SY9A

Crystal structure of pseudomonas aeruginosa occd2 (opdc)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
416
structure length
371
Chain Sequence
EGFIEGSSLQLLTRNYYFNHDRRSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTFRGVSLTNNSFEDLTLTAGQVSFTKYYNDSHHLSWLGGTWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQYDYDFVALGVPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine porin OpdC
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 101
structure length 371
sequence length 416
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sy9A01
3T24A 4KRAA 3SY7A 1HXXA 3SZVA 2XE5A 3WI4A 4JFBA 1BH3A 1OPFA 3K19A 4KR8A 1GFMA 3PORA 1E54A 4LSFA 4FRTA 4GCPA 4RJWA 2Y0LA 1HXUA 2J4UP 3SY9A 1PRNA 5DL5A 3EMNX 4D5UA 3NSGA 3WI5A 1OSMA 5JDPA 5DL8A 3SYSA 4FSPA 4FSOA 4LSHA 8PRNA 4AUIA 1GFPA 3T0SA 1HXTA 2J1NA 3VZUX 4FT6A 5DL6A 3UU2A 2XE1A 2FGRA 2Y2XA 3VZWX 1GFQA 2Y0KA 4RJXA 3PRNA 2O4VA 4LSEA 4D64A 4GCSA 5FVNA 3POUA 4BUMX 3UPGA 1PHOA 2PORA 6PRNA 2OMFA 4FRXA 1H6S1 2XE2A 2ZFGA 5DL7A 4GCQA 1BT9A 5PRNA 2PRNA 3O0EA 2K4TA 2QTKA 3VY8X 3SZDA 1GFOA 4FOZA 2ZLDA 1GFNA 3VZTX 3SYBA 3A2SX 2Y0HA 3VY9X 3HW9A 3POQA 2XE3A 3FYXA 2XG6A 4C69X 1MPFA 3HWBA 3T20A 7PRNA 3POXA 4D65A 2FGQX 2ODJA 3JTYA 4FMSA 4KR4A 4LSIA
chains in the Genus database with same CATH superfamily
2K0LA 3LK2A 3T24A 4PUXA 3TZGA 4KRAA 1ORMA 3C5OA 1IZNA 4QQ1A 3SY7A 1HXXA 2XTQA 2YPVA 4UB6O 5T5FA 4AYID 4RLCA 3KZIO 3SZVA 2W81C 5GTIO 2XE5A 3WI4A 1THQA 2ERVA 2GE4A 4JFBA 4RL9A 3PGSA 4C4VB 3AA1A 1P4TA 1QJ9A 2LFUA 5H2FO 2XTRA 5AFUL 1BH3A 1OPFA 5ADXK 3K19A 4IL6O 2AXTO 2KXPB 1GFMA 4KR8A 4E1SA 2WVPA 3PF1A 5B5EO 4KR4A 3PORA 2N2LA 3V8UA 4FQEA 4O49A 1E54A 4XNLA 4C4VA 2W80C 3AA0A 3AAAA 3A0BO 3LK3B 3AA6B 4LSFA 5B66O 1G90A 3LK2B 2R89A 4FRTA 2F1VA 4GCPA 3LK42 1IZNB 2KDYA 3HOEA 4RJWA 2Y0LA 4N59A 1HXUA 5G3AA 3PQUA 4AFKA 1T16A 5KAIO 3UAQA 2J4UP 5KAFO 3SY9A 4C00A 1PRNA 3GP6A 1QJPA 1Q9GA 1MM5A 2KC0A 3EMNX 3QRCA 5DL5A 3NSGA 4D5UA 3AA1B 2LHFA 4RLBA 3WI5A 1OSMA 5JDPA 1ZHZA 5DL8A 3SYSA 5AFUK 5D5DA 2F1TA 5TISO 4O3XB 3AAEA 4FSPA 2N2MA 4N58A 4AYDC 4FSOA 4LSHA 4UB8O 4AKMA 8PRNA 4AUIA 1GFPA 3JCUO 4PR7A 3AAAB 3T0SA 1HXTA 2J1NA 3QRAA 3RBHA 3VZUX 4O3ZA 4FT6A 5DL6A 5EE2A 3UU2A 2X9KA 2XE1A 4FESA 2FGRA 4GF4A 4AYEC 1ZHWA 4G75A 5G38A 2Y2XA 3NJTA 1GFQA 2JQYA 3VZWX 4AKRA 4F4BA 2MHLA 3WU2O 2Y0KA 2R88A 4RJXA 2KZ7A 3PRNA 2O4VA 3BS0A 1T1LA 5G39A 4LSEA 4G76A 4D64A 1ZHYA 3BRZA 4FZMA 4GCSA 4N75A 4U9CA 5FVNA 3AAEB 3POUA 4XNKA 4AZLA 1Q9FA 2MNHA 1MM4A 3VE1A 4B61A 4BUMX 2IWWA 3UPGA 1PHOA 3PQSA 2PORA 6PRNA 2OMFA 1ZHTA 4PJ0O 4FRXA 1H6S1 2XE2A 2ZFGA 4FZLA 3VE2A 5DL7A 4CTDA 2Y7SA 4GCQA 1BT9A 3DZMA 5PRNA 3AA0B 4N74A 4AYMC 2PRNA 2WJRA 3O0EA 3AA7A 2F1CX 4FZNA 2K4TA 4AKRB 2QTKA 2R4OA 4K3CA 4E1TA 3BRYA 5GV0A 3VY8X 3SZDA 1GFOA 2X27X 3DWOX 2JMMA 1QJ8A 4FOZA 1ZHXA 4O3WA 2KZ7B 2ZLDA 1GFNA 2IWVA 4Z3TA 3DA4A 1S5LO 3VZTX 2R4LA 3SYBA 3A2SX 4FUVA 4O4UA 2Y0HA 4GHBA 4O4XA 2M06A 3PGUA 4K3BA 4O3YA 3VY9X 5G26A 5ADXL 3HW9A 5E79O 3POQA 2XE3A 3FYXA 2XG6A 1BXWA 3G7GA 4C69X 3LK41 4JCHA 4LSIA 1MPFA 2KXPA 2XMXA 3A0HO 5GTHO 3PGRA 1YS5A 3DWNA 2M07A 3HWBA 4AYNA 3T20A 3HOLA 7PRNA 2R4PA 3AA7B 3POXA 4D65A 5IYUA 2FGQX 2ODJA 3DA3A 2YNKA 2R8AA 3JTYA 4FMSA 3LK3A 3AA6A 3KVDD 2WJQA 2R4NA
chains in the Genus database with same CATH topology
2K0LA 3LK2A 3T24A 4PUXA 3TZGA 4KRAA 1ORMA 3C5OA 1IZNA 4QQ1A 3SY7A 1HXXA 2XTQA 2YPVA 5T5FA 4AYID 4RLCA 3SZVA 2W81C 2XE5A 3WI4A 1THQA 2ERVA 2GE4A 4JFBA 4RL9A 3AA1A 1P4TA 1QJ9A 2LFUA 2XTRA 5AFUL 1BH3A 1OPFA 5ADXK 3K19A 2KXPB 1GFMA 4KR8A 4E1SA 3PORA 2N2LA 3V8UA 4O49A 1E54A 4XNLA 2W80C 3AA0A 3AAAA 4LSFA 3LK3B 3AA6B 1G90A 3LK2B 4FRTA 2F1VA 4GCPA 3LK42 1IZNB 2KDYA 3HOEA 4RJWA 2Y0LA 4N59A 1HXUA 4AFKA 3PQUA 3UAQA 2J4UP 3SY9A 1PRNA 3GP6A 1QJPA 1Q9GA 1MM5A 2KC0A 3EMNX 3QRCA 5DL5A 3NSGA 4D5UA 3AA1B 2LHFA 4RLBA 3WI5A 1OSMA 5JDPA 1ZHZA 5DL8A 3SYSA 5AFUK 5D5DA 2F1TA 4O3XB 3AAEA 4FSPA 2N2MA 4N58A 4AYDC 4FSOA 4LSHA 4AKMA 8PRNA 4AUIA 1GFPA 3AAAB 3T0SA 1HXTA 2J1NA 3QRAA 3RBHA 3VZUX 4O3ZA 4FT6A 5DL6A 5EE2A 3UU2A 2XE1A 4FESA 2FGRA 4GF4A 4AYEC 1ZHWA 4G75A 2Y2XA 3VZWX 1GFQA 4AKRA 4F4BA 2MHLA 2Y0KA 4RJXA 2KZ7A 3PRNA 2O4VA 4LSEA 4G76A 4D64A 1ZHYA 4FZMA 4GCSA 4U9CA 5FVNA 3AAEB 3POUA 4XNKA 4AZLA 1Q9FA 2MNHA 1MM4A 3VE1A 4B61A 4BUMX 3UPGA 1PHOA 3PQSA 2PORA 6PRNA 2OMFA 1ZHTA 4FRXA 1H6S1 2XE2A 2ZFGA 4FZLA 3VE2A 5DL7A 2Y7SA 4GCQA 1BT9A 5PRNA 3AA0B 4AYMC 2PRNA 3O0EA 3AA7A 4FZNA 2K4TA 4AKRB 2QTKA 4E1TA 5GV0A 3VY8X 3SZDA 1GFOA 2X27X 2JMMA 1QJ8A 4FOZA 1ZHXA 4O3WA 2KZ7B 2ZLDA 1GFNA 4Z3TA 3DA4A 3VZTX 3SYBA 3A2SX 4FUVA 4O4UA 2Y0HA 4GHBA 4O4XA 2M06A 4O3YA 3VY9X 5G26A 5ADXL 3HW9A 3POQA 2XE3A 3FYXA 2XG6A 1BXWA 3G7GA 4C69X 3LK41 4JCHA 4LSIA 1MPFA 2KXPA 2XMXA 1YS5A 3HWBA 2M07A 3T20A 4AYNA 3HOLA 7PRNA 3AA7B 3POXA 4D65A 5IYUA 2FGQX 2ODJA 3DA3A 2YNKA 3JTYA 4FMSA 4KR4A 3LK3A 3AA6A 3KVDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T24 A;  4KRA A;  3SY7 A;  1HXX A;  3SZV A;  2XE5 A;  3WI4 A;  4JFB A;  1BH3 A;  1OPF A;  3K19 A;  4KR8 A;  1GFM A;  3POR A;  1E54 A;  4LSF A;  4FRT A;  4GCP A;  4RJW A;  2Y0L A;  1HXU A;  2J4U P;  3SY9 A;  1PRN A;  5DL5 A;  3EMN X;  4D5U A;  3NSG A;  3WI5 A;  1OSM A;  5JDP A;  5DL8 A;  3SYS A;  4FSP A;  4FSO A;  4LSH A;  8PRN A;  4AUI A;  1GFP A;  3T0S A;  1HXT A;  2J1N A;  3VZU X;  4FT6 A;  5DL6 A;  3UU2 A;  2XE1 A;  2FGR A;  2Y2X A;  3VZW X;  1GFQ A;  2Y0K A;  4RJX A;  3PRN A;  2O4V A;  4LSE A;  4D64 A;  4GCS A;  5FVN A;  3POU A;  4BUM X;  3UPG A;  1PHO A;  2POR A;  6PRN A;  2OMF A;  4FRX A;  1H6S 1;  2XE2 A;  2ZFG A;  5DL7 A;  4GCQ A;  1BT9 A;  5PRN A;  2PRN A;  3O0E A;  2K4T A;  2QTK A;  3VY8 X;  3SZD A;  1GFO A;  4FOZ A;  2ZLD A;  1GFN A;  3VZT X;  3SYB A;  3A2S X;  2Y0H A;  3VY9 X;  3HW9 A;  3POQ A;  2XE3 A;  3FYX A;  2XG6 A;  4C69 X;  1MPF A;  3HWB A;  3T20 A;  7PRN A;  3POX A;  4D65 A;  2FGQ X;  2ODJ A;  3JTY A;  4FMS A;  4KR4 A;  4LSI A; 
#chains in the Genus database with same CATH topology
 2K0L A;  3LK2 A;  3T24 A;  4PUX A;  3TZG A;  4KRA A;  1ORM A;  3C5O A;  1IZN A;  4QQ1 A;  3SY7 A;  1HXX A;  2XTQ A;  2YPV A;  4UB6 O;  5T5F A;  4AYI D;  4RLC A;  3KZI O;  3SZV A;  2W81 C;  5GTI O;  2XE5 A;  3WI4 A;  1THQ A;  2ERV A;  2GE4 A;  4JFB A;  4RL9 A;  3PGS A;  4C4V B;  3AA1 A;  1P4T A;  1QJ9 A;  2LFU A;  5H2F O;  2XTR A;  5AFU L;  1BH3 A;  1OPF A;  5ADX K;  3K19 A;  4IL6 O;  2AXT O;  2KXP B;  1GFM A;  4KR8 A;  4E1S A;  2WVP A;  3PF1 A;  5B5E O;  4KR4 A;  3POR A;  2N2L A;  3V8U A;  4FQE A;  4O49 A;  1E54 A;  4XNL A;  4C4V A;  2W80 C;  3AA0 A;  3AAA A;  3A0B O;  3LK3 B;  3AA6 B;  4LSF A;  5B66 O;  1G90 A;  3LK2 B;  2R89 A;  4FRT A;  2F1V A;  4GCP A;  3LK4 2;  1IZN B;  2KDY A;  3HOE A;  4RJW A;  2Y0L A;  4N59 A;  1HXU A;  5G3A A;  3PQU A;  4AFK A;  1T16 A;  5KAI O;  3UAQ A;  2J4U P;  5KAF O;  3SY9 A;  4C00 A;  1PRN A;  3GP6 A;  1QJP A;  1Q9G A;  1MM5 A;  2KC0 A;  3EMN X;  3QRC A;  5DL5 A;  3NSG A;  4D5U A;  3AA1 B;  2LHF A;  4RLB A;  3WI5 A;  1OSM A;  5JDP A;  1ZHZ A;  5DL8 A;  3SYS A;  5AFU K;  5D5D A;  2F1T A;  5TIS O;  4O3X B;  3AAE A;  4FSP A;  2N2M A;  4N58 A;  4AYD C;  4FSO A;  4LSH A;  4UB8 O;  4AKM A;  8PRN A;  4AUI A;  1GFP A;  3JCU O;  4PR7 A;  3AAA B;  3T0S A;  1HXT A;  2J1N A;  3QRA A;  3RBH A;  3VZU X;  4O3Z A;  4FT6 A;  5DL6 A;  5EE2 A;  3UU2 A;  2X9K A;  2XE1 A;  4FES A;  2FGR A;  4GF4 A;  4AYE C;  1ZHW A;  4G75 A;  5G38 A;  2Y2X A;  3NJT A;  1GFQ A;  2JQY A;  3VZW X;  4AKR A;  4F4B A;  2MHL A;  3WU2 O;  2Y0K A;  2R88 A;  4RJX A;  2KZ7 A;  3PRN A;  2O4V A;  3BS0 A;  1T1L A;  5G39 A;  4LSE A;  4G76 A;  4D64 A;  1ZHY A;  3BRZ A;  4FZM A;  4GCS A;  4N75 A;  4U9C A;  5FVN A;  3AAE B;  3POU A;  4XNK A;  4AZL A;  1Q9F A;  2MNH A;  1MM4 A;  3VE1 A;  4B61 A;  4BUM X;  2IWW A;  3UPG A;  1PHO A;  3PQS A;  2POR A;  6PRN A;  2OMF A;  1ZHT A;  4PJ0 O;  4FRX A;  1H6S 1;  2XE2 A;  2ZFG A;  4FZL A;  3VE2 A;  5DL7 A;  4CTD A;  2Y7S A;  4GCQ A;  1BT9 A;  3DZM A;  5PRN A;  3AA0 B;  4N74 A;  4AYM C;  2PRN A;  2WJR A;  3O0E A;  3AA7 A;  2F1C X;  4FZN A;  2K4T A;  4AKR B;  2QTK A;  2R4O A;  4K3C A;  4E1T A;  3BRY A;  5GV0 A;  3VY8 X;  3SZD A;  1GFO A;  2X27 X;  3DWO X;  2JMM A;  1QJ8 A;  4FOZ A;  1ZHX A;  4O3W A;  2KZ7 B;  2ZLD A;  1GFN A;  2IWV A;  4Z3T A;  3DA4 A;  1S5L O;  3VZT X;  2R4L A;  3SYB A;  3A2S X;  4FUV A;  4O4U A;  2Y0H A;  4GHB A;  4O4X A;  2M06 A;  3PGU A;  4K3B A;  4O3Y A;  3VY9 X;  5G26 A;  5ADX L;  3HW9 A;  5E79 O;  3POQ A;  2XE3 A;  3FYX A;  2XG6 A;  1BXW A;  3G7G A;  4C69 X;  3LK4 1;  4JCH A;  4LSI A;  1MPF A;  2KXP A;  2XMX A;  3A0H O;  5GTH O;  3PGR A;  1YS5 A;  3DWN A;  2M07 A;  3HWB A;  4AYN A;  3T20 A;  3HOL A;  7PRN A;  2R4P A;  3AA7 B;  3POX A;  4D65 A;  5IYU A;  2FGQ X;  2ODJ A;  3DA3 A;  2YNK A;  2R8A A;  3JTY A;  4FMS A;  3LK3 A;  3AA6 A;  3KVD D;  2WJQ A;  2R4N A; 
#chains in the Genus database with same CATH homology
 2K0L A;  3LK2 A;  3T24 A;  4PUX A;  3TZG A;  4KRA A;  1ORM A;  3C5O A;  1IZN A;  4QQ1 A;  3SY7 A;  1HXX A;  2XTQ A;  2YPV A;  5T5F A;  4AYI D;  4RLC A;  3SZV A;  2W81 C;  2XE5 A;  3WI4 A;  1THQ A;  2ERV A;  2GE4 A;  4JFB A;  4RL9 A;  3AA1 A;  1P4T A;  1QJ9 A;  2LFU A;  2XTR A;  5AFU L;  1BH3 A;  1OPF A;  5ADX K;  3K19 A;  2KXP B;  1GFM A;  4KR8 A;  4E1S A;  3POR A;  2N2L A;  3V8U A;  4O49 A;  1E54 A;  4XNL A;  2W80 C;  3AA0 A;  3AAA A;  4LSF A;  3LK3 B;  3AA6 B;  1G90 A;  3LK2 B;  4FRT A;  2F1V A;  4GCP A;  3LK4 2;  1IZN B;  2KDY A;  3HOE A;  4RJW A;  2Y0L A;  4N59 A;  1HXU A;  4AFK A;  3PQU A;  3UAQ A;  2J4U P;  3SY9 A;  1PRN A;  3GP6 A;  1QJP A;  1Q9G A;  1MM5 A;  2KC0 A;  3EMN X;  3QRC A;  5DL5 A;  3NSG A;  4D5U A;  3AA1 B;  2LHF A;  4RLB A;  3WI5 A;  1OSM A;  5JDP A;  1ZHZ A;  5DL8 A;  3SYS A;  5AFU K;  5D5D A;  2F1T A;  4O3X B;  3AAE A;  4FSP A;  2N2M A;  4N58 A;  4AYD C;  4FSO A;  4LSH A;  4AKM A;  8PRN A;  4AUI A;  1GFP A;  3AAA B;  3T0S A;  1HXT A;  2J1N A;  3QRA A;  3RBH A;  3VZU X;  4O3Z A;  4FT6 A;  5DL6 A;  5EE2 A;  3UU2 A;  2XE1 A;  4FES A;  2FGR A;  4GF4 A;  4AYE C;  1ZHW A;  4G75 A;  2Y2X A;  3VZW X;  1GFQ A;  4AKR A;  4F4B A;  2MHL A;  2Y0K A;  4RJX A;  2KZ7 A;  3PRN A;  2O4V A;  4LSE A;  4G76 A;  4D64 A;  1ZHY A;  4FZM A;  4GCS A;  4U9C A;  5FVN A;  3AAE B;  3POU A;  4XNK A;  4AZL A;  1Q9F A;  2MNH A;  1MM4 A;  3VE1 A;  4B61 A;  4BUM X;  3UPG A;  1PHO A;  3PQS A;  2POR A;  6PRN A;  2OMF A;  1ZHT A;  4FRX A;  1H6S 1;  2XE2 A;  2ZFG A;  4FZL A;  3VE2 A;  5DL7 A;  2Y7S A;  4GCQ A;  1BT9 A;  5PRN A;  3AA0 B;  4AYM C;  2PRN A;  3O0E A;  3AA7 A;  4FZN A;  2K4T A;  4AKR B;  2QTK A;  4E1T A;  5GV0 A;  3VY8 X;  3SZD A;  1GFO A;  2X27 X;  2JMM A;  1QJ8 A;  4FOZ A;  1ZHX A;  4O3W A;  2KZ7 B;  2ZLD A;  1GFN A;  4Z3T A;  3DA4 A;  3VZT X;  3SYB A;  3A2S X;  4FUV A;  4O4U A;  2Y0H A;  4GHB A;  4O4X A;  2M06 A;  4O3Y A;  3VY9 X;  5G26 A;  5ADX L;  3HW9 A;  3POQ A;  2XE3 A;  3FYX A;  2XG6 A;  1BXW A;  3G7G A;  4C69 X;  3LK4 1;  4JCH A;  4LSI A;  1MPF A;  2KXP A;  2XMX A;  1YS5 A;  3HWB A;  2M07 A;  3T20 A;  4AYN A;  3HOL A;  7PRN A;  3AA7 B;  3POX A;  4D65 A;  5IYU A;  2FGQ X;  2ODJ A;  3DA3 A;  2YNK A;  3JTY A;  4FMS A;  4KR4 A;  3LK3 A;  3AA6 A;  3KVD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...