3SY9A

Crystal structure of pseudomonas aeruginosa occd2 (opdc)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
416
structure length
371
Chain Sequence
EGFIEGSSLQLLTRNYYFNHDRRSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLSNPVVAGGESRMLPQTFRGVSLTNNSFEDLTLTAGQVSFTKYYNDSHHLSWLGGTWGGIEGFTSSLYAAELQNVWKQYYADVDYTYEIDDNWSLNPGAHYYKTVDSGDSLLGRIDNNTYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQYDYDFVALGVPGLSASASYSRGKLDLTRVDPDSPGYGGWYSADGKNAKHWERDLDLQYVVQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Histidine porin OpdC
total genus 101
structure length 371
sequence length 416
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sy9A01
1OSMA 2O4VA 1GFPA 3PORA 2K4TA 1HXXA 2Y0HA 4BUMX 3UPGA 4FOZA 3JTYA 4FMSA 2XE3A 5DL7A 2Y0LA 3SYBA 2QTKA 4RJWA 2J1NA 2XE1A 3O0EA 7PRNA 1MPFA 3VY9X 4GCQA 5PRNA 2PRNA 3POQA 4D64A 1BT9A 3T20A 2XE5A 2ZFGA 2Y2XA 1HXTA 4D65A 5DL6A 3FYXA 4D5UA 4FRTA 4C69X 3HWBA 1PRNA 3T24A 3UU2A 4LSFA 5JDPA 1GFQA 3POUA 4RJXA 2Y0KA 5DL8A 1GFOA 4FSOA 2FGQX 1GFMA 3WI5A 4GCPA 3A2SX 3PRNA 2J4UP 3VZWX 1BH3A 4FRXA 3SY9A 2PORA 3SZDA 2XG6A 4FT6A 4LSIA 2OMFA 3NSGA 3SZVA 5FVNA 3SYSA 4KR8A 3POXA 2XE2A 4LSHA 3EMNX 3HW9A 3VZUX 4FSPA 3SY7A 5DL5A 4JFBA 1H6S1 4GCSA 1HXUA 1PHOA 8PRNA 3T0SA 3VY8X 4AUIA 4KR4A 4LSEA 2ODJA 3WI4A 2ZLDA 1OPFA 4KRAA 6PRNA 1GFNA 1E54A 3VZTX 3K19A 2FGRA
chains in the Genus database with same CATH superfamily
1OSMA 1Q9FA 1YS5A 2O4VA 1GFPA 2W80C 2K4TA 3PORA 2GE4A 3AA6B 2R8AA 4O3ZA 1HXXA 2XMXA 5G26A 2Y0HA 2WJQA 3KZIO 4BUMX 5KAIO 4CTDA 1P4TA 3LK2A 3DA3A 1MM4A 3UPGA 4FOZA 3JTYA 4RL9A 3LK3B 4FMSA 4O49A 2XE3A 2KZ7A 5TISO 5DL7A 2Y0LA 3SYBA 1G90A 2QTKA 4RJWA 3PGSA 1Q9GA 4FQEA 5IYUA 3HOEA 4GHBA 2J1NA 2R4LA 2XE1A 4IL6O 2YNKA 4RLBA 5EE2A 3V8UA 3O0EA 1ZHXA 4O3YA 1THQA 7PRNA 1MPFA 3JCUO 1QJPA 1ZHWA 4GCQA 3QRCA 5E79O 2PRNA 3POQA 5G38A 5PRNA 3VY9X 4C4VA 1BT9A 4D64A 3VE1A 3T20A 2XE5A 2ZFGA 2YPVA 1ZHTA 4PUXA 2Y2XA 1HXTA 4FESA 4N58A 4C00A 4D65A 4UB8O 3LK42 5DL6A 3FYXA 4D5UA 4FRTA 4U9CA 2IWVA 3AA0A 4E1SA 5AFUL 2X9KA 2JQYA 2Y7SA 4C69X 3PF1A 3HWBA 2KXPB 2M07A 1PRNA 3AAAB 3T24A 4LSFA 2X27X 3UU2A 5JDPA 3LK41 2N2LA 1GFQA 3POUA 4G76A 2Y0KA 4O3WA 4RJXA 5DL8A 4AKRA 4AFKA 4FZLA 3UAQA 4K3CA 4K3BA 4AKMA 2W81C 1GFOA 2LHFA 4FSOA 3DWOX 2XTQA 2JMMA 3PQSA 2MHLA 3DWNA 5B66O 2FGQX 1QJ9A 1GFMA 3GP6A 4PJ0O 4GF4A 3WI5A 2K0LA 3AAEB 4FZMA 3A2SX 3PRNA 2KDYA 4GCPA 5G3AA 3VE2A 2N2MA 3DZMA 3LK3A 3VZWX 2J4UP 1BH3A 5G39A 3NJTA 1IZNB 2F1CX 3AA7B 4FRXA 3AA6A 2PORA 3AA1A 1ZHZA 2XG6A 2XTRA 3SY9A 3SZDA 4FT6A 4Z3TA 4LSIA 2OMFA 2LFUA 2MNHA 3NSGA 2WJRA 4PR7A 3SZVA 1T16A 4O4XA 2F1TA 5FVNA 3WU2O 1ORMA 4B61A 4G75A 4FUVA 2IWWA 3SYSA 4KR8A 3C5OA 3POXA 2XE2A 1QJ8A 4LSHA 4O4UA 3EMNX 3HW9A 5KAFO 3LK2B 4XNLA 4FSPA 3VZUX 4UB6O 4AYDC 3SY7A 2KXPA 4F4BA 2WVPA 4JCHA 3TZGA 4AKRB 5T5FA 3A0BO 5ADXK 3AA0B 3G7GA 1BXWA 2KZ7B 5DL5A 4C4VB 1ZHYA 4RLCA 2M06A 4FZNA 2R4OA 4N74A 5GV0A 4JFBA 5B5EO 1H6S1 2KC0A 1T1LA 4GCSA 3PGRA 1HXUA 3BRYA 1PHOA 4AYMC 3HOLA 3DA4A 5AFUK 2ERVA 1IZNA 3PGUA 4N59A 4XNKA 3QRAA 1MM5A 3AA1B 4AZLA 8PRNA 5GTHO 3BS0A 3PQUA 3T0SA 3VY8X 4AUIA 2F1VA 2R4PA 5D5DA 4AYID 3AAEA 4O3XB 4AYEC 2R88A 4KR4A 2R89A 4LSEA 5ADXL 5H2FO 2ODJA 4N75A 3RBHA 3WI4A 2ZLDA 1OPFA 2AXTO 4KRAA 2R4NA 3KVDD 4AYNA 4E1TA 3AA7A 3BRZA 6PRNA 3AAAA 1GFNA 4QQ1A 1E54A 5GTIO 3A0HO 3VZTX 1S5LO 3K19A 2FGRA
chains in the Genus database with same CATH topology
1OSMA 1Q9FA 1YS5A 2O4VA 1GFPA 2W80C 2K4TA 3PORA 2GE4A 3AA6B 4O3ZA 1HXXA 2XMXA 5G26A 2Y0HA 4BUMX 1P4TA 3LK2A 3DA3A 1MM4A 3UPGA 4FOZA 3JTYA 4RL9A 3LK3B 4FMSA 4O49A 2XE3A 2KZ7A 5DL7A 2Y0LA 3SYBA 1G90A 2QTKA 4RJWA 5IYUA 1Q9GA 3HOEA 4GHBA 2J1NA 2XE1A 4RLBA 3V8UA 2YNKA 5EE2A 3O0EA 1ZHXA 4O3YA 1THQA 7PRNA 1MPFA 1QJPA 1ZHWA 4GCQA 3QRCA 5PRNA 2PRNA 3POQA 3VY9X 4D64A 1BT9A 3VE1A 3T20A 2XE5A 2ZFGA 2YPVA 1ZHTA 4PUXA 2Y2XA 1HXTA 4FESA 4N58A 4D65A 3LK42 5DL6A 3FYXA 4D5UA 4FRTA 4U9CA 3AA0A 4E1SA 5AFUL 2Y7SA 4C69X 3HWBA 2KXPB 2M07A 1PRNA 3AAAB 3T24A 4LSFA 2X27X 3UU2A 5JDPA 3LK41 2N2LA 1GFQA 3POUA 4G76A 2Y0KA 4O3WA 4RJXA 5DL8A 4AKRA 4AFKA 4FZLA 3UAQA 4AKMA 2W81C 1GFOA 2LHFA 4FSOA 2XTQA 2JMMA 3PQSA 2MHLA 2FGQX 1QJ9A 1GFMA 3GP6A 4GF4A 3WI5A 2K0LA 3AAEB 4FZMA 3A2SX 3PRNA 2KDYA 4GCPA 3VE2A 2N2MA 3LK3A 3VZWX 2J4UP 1BH3A 4QQ1A 1IZNB 4FRXA 3AA7B 3SY9A 3AA6A 2PORA 3AA1A 2XG6A 2XTRA 1ZHZA 3SZDA 4FT6A 4Z3TA 4LSIA 2OMFA 2LFUA 2MNHA 3NSGA 3SZVA 4O4XA 5FVNA 2F1TA 1ORMA 4B61A 4G75A 4FUVA 3SYSA 4KR8A 3C5OA 3POXA 2XE2A 1QJ8A 4LSHA 4O4UA 3EMNX 3HW9A 3LK2B 4XNLA 4FSPA 3VZUX 4AYDC 3SY7A 2KXPA 4F4BA 4JCHA 3TZGA 4AKRB 5T5FA 5ADXK 3AA0B 3G7GA 1BXWA 2KZ7B 5DL5A 1ZHYA 4RLCA 2M06A 4FZNA 5GV0A 4JFBA 1H6S1 2KC0A 4GCSA 4AYMC 1HXUA 1PHOA 3HOLA 3DA4A 5AFUK 2ERVA 1IZNA 4N59A 4AZLA 4XNKA 3QRAA 1MM5A 3AA1B 8PRNA 3PQUA 3T0SA 3VY8X 4AUIA 2F1VA 4AYID 5D5DA 3AAEA 4O3XB 4AYEC 5ADXL 4KR4A 4LSEA 2ODJA 3RBHA 3WI4A 2ZLDA 1OPFA 4KRAA 4E1TA 6PRNA 3KVDD 4AYNA 3AA7A 3AAAA 1GFNA 1E54A 3VZTX 3K19A 2FGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OSM A;  2O4V A;  1GFP A;  3POR A;  2K4T A;  1HXX A;  2Y0H A;  4BUM X;  3UPG A;  4FOZ A;  3JTY A;  4FMS A;  2XE3 A;  5DL7 A;  2Y0L A;  3SYB A;  2QTK A;  4RJW A;  2J1N A;  2XE1 A;  3O0E A;  7PRN A;  1MPF A;  3VY9 X;  4GCQ A;  5PRN A;  2PRN A;  3POQ A;  4D64 A;  1BT9 A;  3T20 A;  2XE5 A;  2ZFG A;  2Y2X A;  1HXT A;  4D65 A;  5DL6 A;  3FYX A;  4D5U A;  4FRT A;  4C69 X;  3HWB A;  1PRN A;  3T24 A;  3UU2 A;  4LSF A;  5JDP A;  1GFQ A;  3POU A;  4RJX A;  2Y0K A;  5DL8 A;  1GFO A;  4FSO A;  2FGQ X;  1GFM A;  3WI5 A;  4GCP A;  3A2S X;  3PRN A;  2J4U P;  3VZW X;  1BH3 A;  4FRX A;  3SY9 A;  2POR A;  3SZD A;  2XG6 A;  4FT6 A;  4LSI A;  2OMF A;  3NSG A;  3SZV A;  5FVN A;  3SYS A;  4KR8 A;  3POX A;  2XE2 A;  4LSH A;  3EMN X;  3HW9 A;  3VZU X;  4FSP A;  3SY7 A;  5DL5 A;  4JFB A;  1H6S 1;  4GCS A;  1HXU A;  1PHO A;  8PRN A;  3T0S A;  3VY8 X;  4AUI A;  4KR4 A;  4LSE A;  2ODJ A;  3WI4 A;  2ZLD A;  1OPF A;  4KRA A;  6PRN A;  1GFN A;  1E54 A;  3VZT X;  3K19 A;  2FGR A; 
#chains in the Genus database with same CATH topology
 1OSM A;  1Q9F A;  1YS5 A;  2O4V A;  1GFP A;  2W80 C;  2K4T A;  3POR A;  2GE4 A;  3AA6 B;  2R8A A;  4O3Z A;  1HXX A;  2XMX A;  5G26 A;  2Y0H A;  2WJQ A;  3KZI O;  4BUM X;  5KAI O;  4CTD A;  1P4T A;  3LK2 A;  3DA3 A;  1MM4 A;  3UPG A;  4FOZ A;  3JTY A;  4RL9 A;  3LK3 B;  4FMS A;  4O49 A;  2XE3 A;  2KZ7 A;  5TIS O;  5DL7 A;  2Y0L A;  3SYB A;  1G90 A;  2QTK A;  4RJW A;  3PGS A;  1Q9G A;  4FQE A;  5IYU A;  3HOE A;  4GHB A;  2J1N A;  2R4L A;  2XE1 A;  4IL6 O;  2YNK A;  4RLB A;  5EE2 A;  3V8U A;  3O0E A;  1ZHX A;  4O3Y A;  1THQ A;  7PRN A;  1MPF A;  3JCU O;  1QJP A;  1ZHW A;  4GCQ A;  3QRC A;  5E79 O;  2PRN A;  3POQ A;  5G38 A;  5PRN A;  3VY9 X;  4C4V A;  1BT9 A;  4D64 A;  3VE1 A;  3T20 A;  2XE5 A;  2ZFG A;  2YPV A;  1ZHT A;  4PUX A;  2Y2X A;  1HXT A;  4FES A;  4N58 A;  4C00 A;  4D65 A;  4UB8 O;  3LK4 2;  5DL6 A;  3FYX A;  4D5U A;  4FRT A;  4U9C A;  2IWV A;  3AA0 A;  4E1S A;  5AFU L;  2X9K A;  2JQY A;  2Y7S A;  4C69 X;  3PF1 A;  3HWB A;  2KXP B;  2M07 A;  1PRN A;  3AAA B;  3T24 A;  4LSF A;  2X27 X;  3UU2 A;  5JDP A;  3LK4 1;  2N2L A;  1GFQ A;  3POU A;  4G76 A;  2Y0K A;  4O3W A;  4RJX A;  5DL8 A;  4AKR A;  4AFK A;  4FZL A;  3UAQ A;  4K3C A;  4K3B A;  4AKM A;  2W81 C;  1GFO A;  2LHF A;  4FSO A;  3DWO X;  2XTQ A;  2JMM A;  3PQS A;  2MHL A;  3DWN A;  5B66 O;  2FGQ X;  1QJ9 A;  1GFM A;  3GP6 A;  4PJ0 O;  4GF4 A;  3WI5 A;  2K0L A;  3AAE B;  4FZM A;  3A2S X;  3PRN A;  2KDY A;  4GCP A;  5G3A A;  3VE2 A;  2N2M A;  3DZM A;  3LK3 A;  3VZW X;  2J4U P;  1BH3 A;  5G39 A;  3NJT A;  1IZN B;  2F1C X;  3AA7 B;  4FRX A;  3AA6 A;  2POR A;  3AA1 A;  1ZHZ A;  2XG6 A;  2XTR A;  3SY9 A;  3SZD A;  4FT6 A;  4Z3T A;  4LSI A;  2OMF A;  2LFU A;  2MNH A;  3NSG A;  2WJR A;  4PR7 A;  3SZV A;  1T16 A;  4O4X A;  2F1T A;  5FVN A;  3WU2 O;  1ORM A;  4B61 A;  4G75 A;  4FUV A;  2IWW A;  3SYS A;  4KR8 A;  3C5O A;  3POX A;  2XE2 A;  1QJ8 A;  4LSH A;  4O4U A;  3EMN X;  3HW9 A;  5KAF O;  3LK2 B;  4XNL A;  4FSP A;  3VZU X;  4UB6 O;  4AYD C;  3SY7 A;  2KXP A;  4F4B A;  2WVP A;  4JCH A;  3TZG A;  4AKR B;  5T5F A;  3A0B O;  5ADX K;  3AA0 B;  3G7G A;  1BXW A;  2KZ7 B;  5DL5 A;  4C4V B;  1ZHY A;  4RLC A;  2M06 A;  4FZN A;  2R4O A;  4N74 A;  5GV0 A;  4JFB A;  5B5E O;  1H6S 1;  2KC0 A;  1T1L A;  4GCS A;  3PGR A;  1HXU A;  3BRY A;  1PHO A;  4AYM C;  3HOL A;  3DA4 A;  5AFU K;  2ERV A;  1IZN A;  3PGU A;  4N59 A;  4XNK A;  3QRA A;  1MM5 A;  3AA1 B;  4AZL A;  8PRN A;  5GTH O;  3BS0 A;  3PQU A;  3T0S A;  3VY8 X;  4AUI A;  2F1V A;  2R4P A;  5D5D A;  4AYI D;  3AAE A;  4O3X B;  4AYE C;  2R88 A;  4KR4 A;  2R89 A;  4LSE A;  5ADX L;  5H2F O;  2ODJ A;  4N75 A;  3RBH A;  3WI4 A;  2ZLD A;  1OPF A;  2AXT O;  4KRA A;  2R4N A;  3KVD D;  4AYN A;  4E1T A;  3AA7 A;  3BRZ A;  6PRN A;  3AAA A;  1GFN A;  4QQ1 A;  1E54 A;  5GTI O;  3A0H O;  3VZT X;  1S5L O;  3K19 A;  2FGR A; 
#chains in the Genus database with same CATH homology
 1OSM A;  1Q9F A;  1YS5 A;  2O4V A;  1GFP A;  2W80 C;  2K4T A;  3POR A;  2GE4 A;  3AA6 B;  4O3Z A;  1HXX A;  2XMX A;  5G26 A;  2Y0H A;  4BUM X;  1P4T A;  3LK2 A;  3DA3 A;  1MM4 A;  3UPG A;  4FOZ A;  3JTY A;  4RL9 A;  3LK3 B;  4FMS A;  4O49 A;  2XE3 A;  2KZ7 A;  5DL7 A;  2Y0L A;  3SYB A;  1G90 A;  2QTK A;  4RJW A;  5IYU A;  1Q9G A;  3HOE A;  4GHB A;  2J1N A;  2XE1 A;  4RLB A;  3V8U A;  2YNK A;  5EE2 A;  3O0E A;  1ZHX A;  4O3Y A;  1THQ A;  7PRN A;  1MPF A;  1QJP A;  1ZHW A;  4GCQ A;  3QRC A;  5PRN A;  2PRN A;  3POQ A;  3VY9 X;  4D64 A;  1BT9 A;  3VE1 A;  3T20 A;  2XE5 A;  2ZFG A;  2YPV A;  1ZHT A;  4PUX A;  2Y2X A;  1HXT A;  4FES A;  4N58 A;  4D65 A;  3LK4 2;  5DL6 A;  3FYX A;  4D5U A;  4FRT A;  4U9C A;  3AA0 A;  4E1S A;  5AFU L;  2Y7S A;  4C69 X;  3HWB A;  2KXP B;  2M07 A;  1PRN A;  3AAA B;  3T24 A;  4LSF A;  2X27 X;  3UU2 A;  5JDP A;  3LK4 1;  2N2L A;  1GFQ A;  3POU A;  4G76 A;  2Y0K A;  4O3W A;  4RJX A;  5DL8 A;  4AKR A;  4AFK A;  4FZL A;  3UAQ A;  4AKM A;  2W81 C;  1GFO A;  2LHF A;  4FSO A;  2XTQ A;  2JMM A;  3PQS A;  2MHL A;  2FGQ X;  1QJ9 A;  1GFM A;  3GP6 A;  4GF4 A;  3WI5 A;  2K0L A;  3AAE B;  4FZM A;  3A2S X;  3PRN A;  2KDY A;  4GCP A;  3VE2 A;  2N2M A;  3LK3 A;  3VZW X;  2J4U P;  1BH3 A;  4QQ1 A;  1IZN B;  4FRX A;  3AA7 B;  3SY9 A;  3AA6 A;  2POR A;  3AA1 A;  2XG6 A;  2XTR A;  1ZHZ A;  3SZD A;  4FT6 A;  4Z3T A;  4LSI A;  2OMF A;  2LFU A;  2MNH A;  3NSG A;  3SZV A;  4O4X A;  5FVN A;  2F1T A;  1ORM A;  4B61 A;  4G75 A;  4FUV A;  3SYS A;  4KR8 A;  3C5O A;  3POX A;  2XE2 A;  1QJ8 A;  4LSH A;  4O4U A;  3EMN X;  3HW9 A;  3LK2 B;  4XNL A;  4FSP A;  3VZU X;  4AYD C;  3SY7 A;  2KXP A;  4F4B A;  4JCH A;  3TZG A;  4AKR B;  5T5F A;  5ADX K;  3AA0 B;  3G7G A;  1BXW A;  2KZ7 B;  5DL5 A;  1ZHY A;  4RLC A;  2M06 A;  4FZN A;  5GV0 A;  4JFB A;  1H6S 1;  2KC0 A;  4GCS A;  4AYM C;  1HXU A;  1PHO A;  3HOL A;  3DA4 A;  5AFU K;  2ERV A;  1IZN A;  4N59 A;  4AZL A;  4XNK A;  3QRA A;  1MM5 A;  3AA1 B;  8PRN A;  3PQU A;  3T0S A;  3VY8 X;  4AUI A;  2F1V A;  4AYI D;  5D5D A;  3AAE A;  4O3X B;  4AYE C;  5ADX L;  4KR4 A;  4LSE A;  2ODJ A;  3RBH A;  3WI4 A;  2ZLD A;  1OPF A;  4KRA A;  4E1T A;  6PRN A;  3KVD D;  4AYN A;  3AA7 A;  3AAA A;  1GFN A;  1E54 A;  3VZT X;  3K19 A;  2FGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...