2MHLA

Nmr solution structure of the e.coli outer membrane protein w
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
192
structure length
192
Chain Sequence
MHEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein W
publication title NMR Polypeptide Backbone Conformation of the E. coli Outer Membrane Protein W.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mhlA00
2GE4A 2X27X 2N2MA 1QJ9A 2MHLA 3QRAA 2K0LA 2M07A 2LHFA 1Q9GA 1THQA 1QJ8A 4RLCA 1MM4A 1BXWA 2N2LA 2MNHA 1P4TA 2JMMA 3GP6A 1Q9FA 1G90A 3C5OA 3QRCA 2ERVA 1ORMA 2F1TA 2F1VA 3G7GA 2M06A 1MM5A 4PUXA 1QJPA
chains in the Genus database with same CATH superfamily
3V8UA 3LK3B 3TZGA 4O4XA 3WU2O 2X27X 2N2MA 2KZ7A 4AYNA 5ADXL 4N75A 1GFNA 2MHLA 3A0HO 3DWNA 4AFKA 4AYID 3EMNX 1HXTA 3HW9A 4FT6A 2WJRA 8PRNA 1PRNA 3BRZA 2LFUA 5G38A 3VZUX 3T20A 4C4VB 3A0BO 3UAQA 4Z3TA 4FUVA 1BT9A 3LK2B 3AA0A 3KVDD 4LSHA 1MM4A 2Y7SA 1GFMA 2KXPA 3RBHA 3VY9X 4AUIA 1H6S1 5T5FA 4N59A 1IZNB 2XE3A 2Y0KA 4UB6O 5FVNA 3SY7A 3VE1A 3C5OA 4JFBA 2J1NA 3AA1B 2Y0HA 1ORMA 3DWOX 5AFUL 2R88A 1ZHWA 2YPVA 3DZMA 2F1TA 5H2FO 4AKMA 4GF4A 3G7GA 3NJTA 2M06A 5DL8A 4G76A 2ZFGA 4PUXA 5DL6A 3SYBA 3PRNA 3T24A 4BUMX 4F4BA 3LK3A 4O3ZA 2GE4A 2ODJA 4O3WA 5G39A 4C69X 1GFQA 3AA7B 3JTYA 5E79O 3QRAA 2XTQA 2XTRA 3PGRA 2M07A 4PJ0O 4XNKA 4AYMC 4AKRB 5GTHO 3AAAB 3BRYA 1ZHTA 3LK41 1OPFA 3LK42 3POXA 3LK2A 3HWBA 1Q9GA 3PQUA 4FOZA 2FGQX 2IWVA 2Y0LA 2F1CX 3AA6B 3K19A 4RLCA 2R4LA 5G3AA 2JQYA 1BXWA 4FSOA 3VY8X 1MPFA 2N2LA 2W81C 2XG6A 1IZNA 3PORA 3SY9A 1P4TA 3SZDA 2XMXA 4C00A 6PRNA 2R4NA 2O4VA 3AA1A 3QRCA 3JCUO 2R8AA 4LSIA 2K4TA 3AAEB 3KZIO 3PGSA 4FRTA 5PRNA 4FMSA 4C4VA 2W80C 1PHOA 4GHBA 3HOEA 1ZHZA 2ZLDA 5EE2A 5GV0A 3AA7A 2WVPA 4O3XB 4RLBA 4GCPA 4RJWA 5KAIO 2YNKA 4D5UA 1QJ9A 5JDPA 1ZHXA 5ADXK 1T16A 4FZNA 4K3BA 2PRNA 2XE2A 5DL7A 1T1LA 4N74A 3VZWX 3AAAA 4AKRA 4CTDA 2WJQA 3PGUA 5DL5A 2AXTO 4U9CA 5GTIO 3AA6A 4O3YA 1E54A 5TISO 1S5LO 1BH3A 1QJ8A 3NSGA 3O0EA 4KR4A 3VE2A 3VZTX 2XE5A 4GCQA 3WI4A 2XE1A 4QQ1A 2PORA 4E1TA 4UB8O 3GP6A 1HXUA 1Q9FA 5D5DA 5B66O 4XNLA 3PF1A 4AYEC 1GFPA 3HOLA 4N58A 1GFOA 4FZLA 5B5EO 3FYXA 4GCSA 1HXXA 5AFUK 4KR8A 4RJXA 4K3CA 3SYSA 3BS0A 2OMFA 3POQA 1ZHYA 2Y2XA 3DA4A 4LSFA 4JCHA 4LSEA 4AZLA 3WI5A 2QTKA 3DA3A 2KZ7B 2R89A 4O4UA 3UU2A 2K0LA 4RL9A 4O49A 5G26A 5KAFO 3UPGA 2LHFA 4FZMA 4PR7A 2R4PA 4IL6O 5IYUA 4D64A 3SZVA 2IWWA 4E1SA 1THQA 4B61A 2X9KA 3AA0B 3A2SX 3T0SA 2R4OA 4D65A 1YS5A 4G75A 4AYDC 2MNHA 2JMMA 2KDYA 2KXPB 2KC0A 1G90A 4FSPA 4FRXA 2ERVA 2J4UP 3AAEA 2FGRA 4KRAA 3PQSA 2F1VA 1MM5A 3POUA 1QJPA 4FQEA 4FESA 1OSMA 7PRNA
chains in the Genus database with same CATH topology
3V8UA 3LK3B 3TZGA 4O4XA 2X27X 2N2MA 2KZ7A 4AYNA 5ADXL 1GFNA 2MHLA 4AFKA 4AYID 3EMNX 1HXTA 3HW9A 4FT6A 8PRNA 1PRNA 3VZUX 2LFUA 3T20A 3UAQA 4Z3TA 4FUVA 1BT9A 3LK2B 3AA0A 3KVDD 4LSHA 1MM4A 2Y7SA 1GFMA 2KXPA 3RBHA 3VY9X 4AUIA 1H6S1 5T5FA 4N59A 1IZNB 2XE3A 2Y0KA 5FVNA 3SY7A 3VE1A 3C5OA 4JFBA 2J1NA 3AA1B 2Y0HA 1ORMA 5AFUL 1ZHWA 2YPVA 2F1TA 4AKMA 4GF4A 3G7GA 5DL6A 2M06A 5DL8A 4G76A 2ZFGA 4PUXA 3SYBA 4BUMX 3PRNA 4F4BA 3LK3A 4O3ZA 2GE4A 2ODJA 4O3WA 4C69X 1GFQA 3AA7B 3JTYA 3QRAA 2XTQA 2XTRA 2M07A 4XNKA 4AYMC 4AKRB 3AAAB 3LK41 1ZHTA 1OPFA 3LK42 3POXA 3LK2A 3HWBA 1Q9GA 3PQUA 4FOZA 2FGQX 2Y0LA 3AA6B 4N58A 3K19A 4RLCA 3T24A 1BXWA 4FSOA 3VY8X 1MPFA 2N2LA 2W81C 2XG6A 1IZNA 3PORA 3SY9A 1P4TA 3SZDA 2XMXA 6PRNA 2O4VA 3AA1A 3QRCA 4LSIA 2K4TA 3AAEB 4FRTA 5PRNA 4FMSA 2W80C 1PHOA 4GHBA 3HOEA 1ZHZA 2ZLDA 5EE2A 5GV0A 3AA7A 4O3XB 4RLBA 4GCPA 4RJWA 2YNKA 4D5UA 1QJ9A 5JDPA 1ZHXA 5ADXK 4FZNA 3VZWX 2PRNA 2XE2A 5DL7A 4AKRA 3AAAA 5DL5A 4U9CA 3AA6A 4O3YA 1E54A 1BH3A 1QJ8A 3NSGA 3O0EA 4KR4A 3VE2A 3VZTX 2XE5A 4GCQA 3WI4A 2XE1A 4QQ1A 2PORA 4E1TA 3GP6A 1HXUA 1Q9FA 5D5DA 4XNLA 4AYEC 1GFPA 3HOLA 1GFOA 4FZLA 3FYXA 4GCSA 1HXXA 5AFUK 4KR8A 4RJXA 3SYSA 2OMFA 3POQA 1ZHYA 2Y2XA 3DA4A 4LSFA 4JCHA 4LSEA 4AZLA 3WI5A 2QTKA 3DA3A 2KZ7B 4O4UA 3UU2A 2K0LA 4RL9A 4O49A 5G26A 3UPGA 2LHFA 4FZMA 5IYUA 4D64A 3SZVA 4E1SA 1THQA 4B61A 3T0SA 3AA0B 3A2SX 4D65A 1YS5A 4G75A 4AYDC 2MNHA 2JMMA 2KDYA 2KXPB 2KC0A 1G90A 4FSPA 4FRXA 2ERVA 2J4UP 3AAEA 2FGRA 4KRAA 3PQSA 2F1VA 1MM5A 3POUA 1QJPA 4FESA 1OSMA 7PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  2X27 X;  2N2M A;  1QJ9 A;  2MHL A;  3QRA A;  2K0L A;  2M07 A;  2LHF A;  1Q9G A;  1THQ A;  1QJ8 A;  4RLC A;  1MM4 A;  1BXW A;  2N2L A;  2MNH A;  1P4T A;  2JMM A;  3GP6 A;  1Q9F A;  1G90 A;  3C5O A;  3QRC A;  2ERV A;  1ORM A;  2F1T A;  2F1V A;  3G7G A;  2M06 A;  1MM5 A;  4PUX A;  1QJP A; 
#chains in the Genus database with same CATH topology
 3V8U A;  3LK3 B;  3TZG A;  4O4X A;  3WU2 O;  2X27 X;  2N2M A;  2KZ7 A;  4AYN A;  5ADX L;  4N75 A;  1GFN A;  2MHL A;  3A0H O;  3DWN A;  4AFK A;  4AYI D;  3EMN X;  1HXT A;  3HW9 A;  4FT6 A;  2WJR A;  8PRN A;  1PRN A;  3BRZ A;  2LFU A;  5G38 A;  3VZU X;  3T20 A;  4C4V B;  3A0B O;  3UAQ A;  4Z3T A;  4FUV A;  1BT9 A;  3LK2 B;  3AA0 A;  3KVD D;  4LSH A;  1MM4 A;  2Y7S A;  1GFM A;  2KXP A;  3RBH A;  3VY9 X;  4AUI A;  1H6S 1;  5T5F A;  4N59 A;  1IZN B;  2XE3 A;  2Y0K A;  4UB6 O;  5FVN A;  3SY7 A;  3VE1 A;  3C5O A;  4JFB A;  2J1N A;  3AA1 B;  2Y0H A;  1ORM A;  3DWO X;  5AFU L;  2R88 A;  1ZHW A;  2YPV A;  3DZM A;  2F1T A;  5H2F O;  4AKM A;  4GF4 A;  3G7G A;  3NJT A;  2M06 A;  5DL8 A;  4G76 A;  2ZFG A;  4PUX A;  5DL6 A;  3SYB A;  3PRN A;  3T24 A;  4BUM X;  4F4B A;  3LK3 A;  4O3Z A;  2GE4 A;  2ODJ A;  4O3W A;  5G39 A;  4C69 X;  1GFQ A;  3AA7 B;  3JTY A;  5E79 O;  3QRA A;  2XTQ A;  2XTR A;  3PGR A;  2M07 A;  4PJ0 O;  4XNK A;  4AYM C;  4AKR B;  5GTH O;  3AAA B;  3BRY A;  1ZHT A;  3LK4 1;  1OPF A;  3LK4 2;  3POX A;  3LK2 A;  3HWB A;  1Q9G A;  3PQU A;  4FOZ A;  2FGQ X;  2IWV A;  2Y0L A;  2F1C X;  3AA6 B;  3K19 A;  4RLC A;  2R4L A;  5G3A A;  2JQY A;  1BXW A;  4FSO A;  3VY8 X;  1MPF A;  2N2L A;  2W81 C;  2XG6 A;  1IZN A;  3POR A;  3SY9 A;  1P4T A;  3SZD A;  2XMX A;  4C00 A;  6PRN A;  2R4N A;  2O4V A;  3AA1 A;  3QRC A;  3JCU O;  2R8A A;  4LSI A;  2K4T A;  3AAE B;  3KZI O;  3PGS A;  4FRT A;  5PRN A;  4FMS A;  4C4V A;  2W80 C;  1PHO A;  4GHB A;  3HOE A;  1ZHZ A;  2ZLD A;  5EE2 A;  5GV0 A;  3AA7 A;  2WVP A;  4O3X B;  4RLB A;  4GCP A;  4RJW A;  5KAI O;  2YNK A;  4D5U A;  1QJ9 A;  5JDP A;  1ZHX A;  5ADX K;  1T16 A;  4FZN A;  4K3B A;  2PRN A;  2XE2 A;  5DL7 A;  1T1L A;  4N74 A;  3VZW X;  3AAA A;  4AKR A;  4CTD A;  2WJQ A;  3PGU A;  5DL5 A;  2AXT O;  4U9C A;  5GTI O;  3AA6 A;  4O3Y A;  1E54 A;  5TIS O;  1S5L O;  1BH3 A;  1QJ8 A;  3NSG A;  3O0E A;  4KR4 A;  3VE2 A;  3VZT X;  2XE5 A;  4GCQ A;  3WI4 A;  2XE1 A;  4QQ1 A;  2POR A;  4E1T A;  4UB8 O;  3GP6 A;  1HXU A;  1Q9F A;  5D5D A;  5B66 O;  4XNL A;  3PF1 A;  4AYE C;  1GFP A;  3HOL A;  4N58 A;  1GFO A;  4FZL A;  5B5E O;  3FYX A;  4GCS A;  1HXX A;  5AFU K;  4KR8 A;  4RJX A;  4K3C A;  3SYS A;  3BS0 A;  2OMF A;  3POQ A;  1ZHY A;  2Y2X A;  3DA4 A;  4LSF A;  4JCH A;  4LSE A;  4AZL A;  3WI5 A;  2QTK A;  3DA3 A;  2KZ7 B;  2R89 A;  4O4U A;  3UU2 A;  2K0L A;  4RL9 A;  4O49 A;  5G26 A;  5KAF O;  3UPG A;  2LHF A;  4FZM A;  4PR7 A;  2R4P A;  4IL6 O;  5IYU A;  4D64 A;  3SZV A;  2IWW A;  4E1S A;  1THQ A;  4B61 A;  2X9K A;  3AA0 B;  3A2S X;  3T0S A;  2R4O A;  4D65 A;  1YS5 A;  4G75 A;  4AYD C;  2MNH A;  2JMM A;  2KDY A;  2KXP B;  2KC0 A;  1G90 A;  4FSP A;  4FRX A;  2ERV A;  2J4U P;  3AAE A;  2FGR A;  4KRA A;  3PQS A;  2F1V A;  1MM5 A;  3POU A;  1QJP A;  4FQE A;  4FES A;  1OSM A;  7PRN A; 
#chains in the Genus database with same CATH homology
 3V8U A;  3LK3 B;  3TZG A;  4O4X A;  2X27 X;  2N2M A;  2KZ7 A;  4AYN A;  5ADX L;  1GFN A;  2MHL A;  4AFK A;  4AYI D;  3EMN X;  1HXT A;  3HW9 A;  4FT6 A;  8PRN A;  1PRN A;  3VZU X;  2LFU A;  3T20 A;  3UAQ A;  4Z3T A;  4FUV A;  1BT9 A;  3LK2 B;  3AA0 A;  3KVD D;  4LSH A;  1MM4 A;  2Y7S A;  1GFM A;  2KXP A;  3RBH A;  3VY9 X;  4AUI A;  1H6S 1;  5T5F A;  4N59 A;  1IZN B;  2XE3 A;  2Y0K A;  5FVN A;  3SY7 A;  3VE1 A;  3C5O A;  4JFB A;  2J1N A;  3AA1 B;  2Y0H A;  1ORM A;  5AFU L;  1ZHW A;  2YPV A;  2F1T A;  4AKM A;  4GF4 A;  3G7G A;  5DL6 A;  2M06 A;  5DL8 A;  4G76 A;  2ZFG A;  4PUX A;  3SYB A;  4BUM X;  3PRN A;  4F4B A;  3LK3 A;  4O3Z A;  2GE4 A;  2ODJ A;  4O3W A;  4C69 X;  1GFQ A;  3AA7 B;  3JTY A;  3QRA A;  2XTQ A;  2XTR A;  2M07 A;  4XNK A;  4AYM C;  4AKR B;  3AAA B;  3LK4 1;  1ZHT A;  1OPF A;  3LK4 2;  3POX A;  3LK2 A;  3HWB A;  1Q9G A;  3PQU A;  4FOZ A;  2FGQ X;  2Y0L A;  3AA6 B;  4N58 A;  3K19 A;  4RLC A;  3T24 A;  1BXW A;  4FSO A;  3VY8 X;  1MPF A;  2N2L A;  2W81 C;  2XG6 A;  1IZN A;  3POR A;  3SY9 A;  1P4T A;  3SZD A;  2XMX A;  6PRN A;  2O4V A;  3AA1 A;  3QRC A;  4LSI A;  2K4T A;  3AAE B;  4FRT A;  5PRN A;  4FMS A;  2W80 C;  1PHO A;  4GHB A;  3HOE A;  1ZHZ A;  2ZLD A;  5EE2 A;  5GV0 A;  3AA7 A;  4O3X B;  4RLB A;  4GCP A;  4RJW A;  2YNK A;  4D5U A;  1QJ9 A;  5JDP A;  1ZHX A;  5ADX K;  4FZN A;  3VZW X;  2PRN A;  2XE2 A;  5DL7 A;  4AKR A;  3AAA A;  5DL5 A;  4U9C A;  3AA6 A;  4O3Y A;  1E54 A;  1BH3 A;  1QJ8 A;  3NSG A;  3O0E A;  4KR4 A;  3VE2 A;  3VZT X;  2XE5 A;  4GCQ A;  3WI4 A;  2XE1 A;  4QQ1 A;  2POR A;  4E1T A;  3GP6 A;  1HXU A;  1Q9F A;  5D5D A;  4XNL A;  4AYE C;  1GFP A;  3HOL A;  1GFO A;  4FZL A;  3FYX A;  4GCS A;  1HXX A;  5AFU K;  4KR8 A;  4RJX A;  3SYS A;  2OMF A;  3POQ A;  1ZHY A;  2Y2X A;  3DA4 A;  4LSF A;  4JCH A;  4LSE A;  4AZL A;  3WI5 A;  2QTK A;  3DA3 A;  2KZ7 B;  4O4U A;  3UU2 A;  2K0L A;  4RL9 A;  4O49 A;  5G26 A;  3UPG A;  2LHF A;  4FZM A;  5IYU A;  4D64 A;  3SZV A;  4E1S A;  1THQ A;  4B61 A;  3T0S A;  3AA0 B;  3A2S X;  4D65 A;  1YS5 A;  4G75 A;  4AYD C;  2MNH A;  2JMM A;  2KDY A;  2KXP B;  2KC0 A;  1G90 A;  4FSP A;  4FRX A;  2ERV A;  2J4U P;  3AAE A;  2FGR A;  4KRA A;  3PQS A;  2F1V A;  1MM5 A;  3POU A;  1QJP A;  4FES A;  1OSM A;  7PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...