2MHLA

Nmr solution structure of the e.coli outer membrane protein w
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
192
structure length
192
Chain Sequence
b'MHEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein W
publication title NMR Polypeptide Backbone Conformation of the E. coli Outer Membrane Protein W.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 19
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mhlA00
3C5OA 2N2MA 3G7GA 4RLCA 2MNHA 1QJ8A 2ERVA 2M06A 1P4TA 2K0LA 3QRCA 3GP6A 2GE4A 3QRAA 1THQA 1ORMA 2X27X 1G90A 1QJPA 1Q9FA 2MHLA 1MM4A 2N2LA 2JMMA 4PUXA 1BXWA 2F1VA 1Q9GA 2M07A 2F1TA 2LHFA 1MM5A 1QJ9A
chains in the Genus database with same CATH superfamily
1IZNB 3C5OA 4GCPA 5DL7A 3WI4A 5GTIO 3JTYA 2YPVA 2XMXA 3K19A 4O3XB 5FVNA 1P4TA 2WJQA 4K3CA 5G39A 3VZUX 5TISO 2J4UP 2XE2A 4QQ1A 3GP6A 4XNKA 1ORMA 1OPFA 2KXPA 2PORA 2X27X 1YS5A 5B66O 4CTDA 4FQEA 3VE1A 4C4VA 1BT9A 3KZIO 3O0EA 5D5DA 3A2SX 2R89A 3AA7A 3DA3A 3LK3B 4C69X 1H6S1 1MPFA 2PRNA 1BXWA 4PUXA 4AKMA 5IYUA 3LK2A 2R4OA 3EMNX 4F4BA 2O4VA 2F1VA 3PGRA 4FZMA 1ZHXA 4GF4A 3AA1B 4RJWA 3UPGA 4AFKA 3PGSA 5DL8A 5KAIO 2LHFA 2J1NA 2YNKA 1QJ9A 4O4XA 4RLBA 4D5UA 4KRAA 4PR7A 2K4TA 2N2MA 2XTQA 4RLCA 1GFOA 2MNHA 3KVDD 3AAAA 4AKRB 4FSPA 3VY8X 2WVPA 4AYID 2K0LA 4FESA 3WU2O 4FMSA 4G75A 4LSFA 2F1CX 3AA0B 3FYXA 3T20A 2R4NA 3PRNA 3NSGA 3QRAA 2OMFA 3HOEA 3PF1A 1Q9FA 5G26A 4O4UA 4O3ZA 4U9CA 5ADXL 4N74A 3JCUO 3SYBA 3VE2A 2MHLA 4RL9A 4AUIA 4KR4A 3SZVA 1ZHYA 4C4VB 4D64A 1HXXA 5JDPA 2KZ7A 4FZLA 4GCSA 2Y0KA 4IL6O 3BS0A 4FSOA 5AFUL 3AA7B 3SYSA 2FGRA 4UB6O 3WI5A 1IZNA 3PGUA 4B61A 3AAEA 4AYEC 2R8AA 4XNLA 3LK2B 4E1TA 5B5EO 2WJRA 2X9KA 4AZLA 3SY9A 3DZMA 5G38A 3AA6A 4Z3TA 3DWNA 3G7GA 5T5FA 1HXTA 4KR8A 4O3YA 5DL6A 1QJ8A 2ERVA 4FZNA 4PJ0O 1T16A 4LSEA 4UB8O 4BUMX 4FRXA 2KDYA 4FOZA 4C00A 4GCQA 3POUA 2XE3A 5GTHO 1G90A 1GFQA 4FRTA 3UU2A 8PRNA 3LK3A 4N75A 3HWBA 5ADXK 5G3AA 4RJXA 5GV0A 2KC0A 2LFUA 1MM4A 2KXPB 4N59A 4GHBA 5DL5A 1OSMA 3LK42 4AYDC 1PHOA 3BRYA 3LK41 2JMMA 2JQYA 3SY7A 6PRNA 5AFUK 4E1SA 3PQSA 1GFNA 7PRNA 3UAQA 2KZ7B 3POXA 2XTRA 1PRNA 4AYMC 5H2FO 3PQUA 2F1TA 1Q9GA 3HW9A 2XG6A 3AAEB 4FUVA 3AA0A 1GFPA 2R4LA 3A0HO 3HOLA 4LSHA 4AYNA 1ZHZA 2IWVA 2Y0LA 2M06A 5E79O 3AA6B 2R4PA 3QRCA 3VY9X 3DA4A 5EE2A 2W81C 2GE4A 2XE5A 2ODJA 2W80C 3AAAB 1THQA 1QJPA 2Y0HA 4JCHA 2XE1A 4LSIA 2Y7SA 4O49A 3POQA 3A0BO 1E54A 1T1LA 3TZGA 2ZLDA 2IWWA 3V8UA 3VZTX 1HXUA 2N2LA 1ZHTA 2QTKA 2FGQX 4JFBA 2ZFGA 1ZHWA 3BRZA 3AA1A 3PORA 5KAFO 1S5LO 3SZDA 3DWOX 4FT6A 5PRNA 4N58A 2Y2XA 3NJTA 4G76A 1GFMA 2AXTO 4K3BA 3VZWX 2R88A 4D65A 4O3WA 2M07A 3T24A 4AKRA 3T0SA 1MM5A 1BH3A 3RBHA
chains in the Genus database with same CATH topology
1IZNB 3C5OA 4GCPA 5DL7A 3WI4A 3JTYA 2YPVA 2XMXA 3K19A 4O3XB 5FVNA 1P4TA 2J4UP 3VZUX 2XE2A 4QQ1A 3GP6A 4XNKA 1ORMA 1OPFA 2KXPA 2PORA 2X27X 1YS5A 3VE1A 1BT9A 3O0EA 5D5DA 3A2SX 3AA7A 3DA3A 3LK3B 4C69X 1H6S1 1MPFA 2PRNA 1BXWA 4PUXA 4AKMA 5IYUA 3LK2A 3EMNX 4F4BA 2O4VA 2F1VA 4FZMA 4GF4A 1ZHXA 3AA1B 4RJWA 3UPGA 4AFKA 5DL8A 2LHFA 2J1NA 2YNKA 1QJ9A 4O4XA 4RLBA 4D5UA 4KRAA 2K4TA 2N2MA 2XTQA 4RLCA 1GFOA 2MNHA 3KVDD 3AAAA 4AKRB 4FSPA 3VY8X 4AYID 2K0LA 4FESA 3T20A 4FMSA 4G75A 4LSFA 3AA0B 3FYXA 3PRNA 3QRAA 3NSGA 2OMFA 3HOEA 1Q9FA 5G26A 4O4UA 4O3ZA 4U9CA 5ADXL 3SYBA 3VE2A 2MHLA 4RL9A 4KR4A 3SZVA 1ZHYA 4D64A 5JDPA 1HXXA 2KZ7A 4FZLA 4GCSA 2Y0KA 4FSOA 5AFUL 3AA7B 3SYSA 2FGRA 3WI5A 1IZNA 4B61A 3AAEA 4AYEC 4XNLA 3LK2B 4E1TA 4AZLA 3SY9A 3AA6A 4Z3TA 3G7GA 5T5FA 1HXTA 4KR8A 4O3YA 5DL6A 1QJ8A 2ERVA 4FZNA 4BUMX 4LSEA 4FRXA 2KDYA 4FOZA 4GCQA 3POUA 2XE3A 1G90A 1GFQA 4FRTA 3UU2A 8PRNA 3LK3A 5ADXK 3HWBA 4RJXA 5GV0A 2KC0A 2LFUA 1MM4A 2KXPB 4N59A 4GHBA 5DL5A 1OSMA 3LK42 4AYDC 1PHOA 3LK41 6PRNA 2JMMA 3SY7A 5AFUK 4E1SA 3PQSA 1GFNA 7PRNA 3UAQA 2KZ7B 3POXA 2XTRA 1PRNA 4AYMC 3PQUA 2F1TA 1Q9GA 3HW9A 2XG6A 3AAEB 4FUVA 3AA0A 1GFPA 3HOLA 4AYNA 4LSHA 1ZHZA 2Y0LA 2M06A 3AA6B 3QRCA 3VY9X 3DA4A 5EE2A 2W81C 2GE4A 2XE5A 2ODJA 2W80C 3AAAB 1THQA 1QJPA 2Y0HA 4JCHA 2XE1A 4LSIA 2Y7SA 4O49A 3POQA 1E54A 3TZGA 2ZLDA 3V8UA 3VZTX 1HXUA 2N2LA 1ZHTA 2QTKA 2FGQX 4JFBA 2ZFGA 1ZHWA 3PORA 3AA1A 4AUIA 3SZDA 5PRNA 4FT6A 4N58A 2Y2XA 4G76A 1GFMA 3VZWX 4D65A 4O3WA 2M07A 3T24A 4AKRA 3T0SA 1MM5A 1BH3A 3RBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5O A;  2N2M A;  3G7G A;  4RLC A;  2MNH A;  1QJ8 A;  2ERV A;  2M06 A;  1P4T A;  2K0L A;  3QRC A;  3GP6 A;  2GE4 A;  3QRA A;  1THQ A;  1ORM A;  2X27 X;  1G90 A;  1QJP A;  1Q9F A;  2MHL A;  1MM4 A;  2N2L A;  2JMM A;  4PUX A;  1BXW A;  2F1V A;  1Q9G A;  2M07 A;  2F1T A;  2LHF A;  1MM5 A;  1QJ9 A; 
#chains in the Genus database with same CATH topology
 1IZN B;  3C5O A;  4GCP A;  5DL7 A;  3WI4 A;  5GTI O;  3JTY A;  2YPV A;  2XMX A;  3K19 A;  4O3X B;  5FVN A;  1P4T A;  2WJQ A;  4K3C A;  5G39 A;  3VZU X;  5TIS O;  2J4U P;  2XE2 A;  4QQ1 A;  3GP6 A;  4XNK A;  1ORM A;  1OPF A;  2KXP A;  2POR A;  2X27 X;  1YS5 A;  5B66 O;  4CTD A;  4FQE A;  3VE1 A;  4C4V A;  1BT9 A;  3KZI O;  3O0E A;  5D5D A;  3A2S X;  2R89 A;  3AA7 A;  3DA3 A;  3LK3 B;  4C69 X;  1H6S 1;  1MPF A;  2PRN A;  1BXW A;  4PUX A;  4AKM A;  5IYU A;  3LK2 A;  2R4O A;  3EMN X;  4F4B A;  2O4V A;  2F1V A;  3PGR A;  4FZM A;  1ZHX A;  4GF4 A;  3AA1 B;  4RJW A;  3UPG A;  4AFK A;  3PGS A;  5DL8 A;  5KAI O;  2LHF A;  2J1N A;  2YNK A;  1QJ9 A;  4O4X A;  4RLB A;  4D5U A;  4KRA A;  4PR7 A;  2K4T A;  2N2M A;  2XTQ A;  4RLC A;  1GFO A;  2MNH A;  3KVD D;  3AAA A;  4AKR B;  4FSP A;  3VY8 X;  2WVP A;  4AYI D;  2K0L A;  4FES A;  3WU2 O;  4FMS A;  4G75 A;  4LSF A;  2F1C X;  3AA0 B;  3FYX A;  3T20 A;  2R4N A;  3PRN A;  3NSG A;  3QRA A;  2OMF A;  3HOE A;  3PF1 A;  1Q9F A;  5G26 A;  4O4U A;  4O3Z A;  4U9C A;  5ADX L;  4N74 A;  3JCU O;  3SYB A;  3VE2 A;  2MHL A;  4RL9 A;  4AUI A;  4KR4 A;  3SZV A;  1ZHY A;  4C4V B;  4D64 A;  1HXX A;  5JDP A;  2KZ7 A;  4FZL A;  4GCS A;  2Y0K A;  4IL6 O;  3BS0 A;  4FSO A;  5AFU L;  3AA7 B;  3SYS A;  2FGR A;  4UB6 O;  3WI5 A;  1IZN A;  3PGU A;  4B61 A;  3AAE A;  4AYE C;  2R8A A;  4XNL A;  3LK2 B;  4E1T A;  5B5E O;  2WJR A;  2X9K A;  4AZL A;  3SY9 A;  3DZM A;  5G38 A;  3AA6 A;  4Z3T A;  3DWN A;  3G7G A;  5T5F A;  1HXT A;  4KR8 A;  4O3Y A;  5DL6 A;  1QJ8 A;  2ERV A;  4FZN A;  4PJ0 O;  1T16 A;  4LSE A;  4UB8 O;  4BUM X;  4FRX A;  2KDY A;  4FOZ A;  4C00 A;  4GCQ A;  3POU A;  2XE3 A;  5GTH O;  1G90 A;  1GFQ A;  4FRT A;  3UU2 A;  8PRN A;  3LK3 A;  4N75 A;  3HWB A;  5ADX K;  5G3A A;  4RJX A;  5GV0 A;  2KC0 A;  2LFU A;  1MM4 A;  2KXP B;  4N59 A;  4GHB A;  5DL5 A;  1OSM A;  3LK4 2;  4AYD C;  1PHO A;  3BRY A;  3LK4 1;  2JMM A;  2JQY A;  3SY7 A;  6PRN A;  5AFU K;  4E1S A;  3PQS A;  1GFN A;  7PRN A;  3UAQ A;  2KZ7 B;  3POX A;  2XTR A;  1PRN A;  4AYM C;  5H2F O;  3PQU A;  2F1T A;  1Q9G A;  3HW9 A;  2XG6 A;  3AAE B;  4FUV A;  3AA0 A;  1GFP A;  2R4L A;  3A0H O;  3HOL A;  4LSH A;  4AYN A;  1ZHZ A;  2IWV A;  2Y0L A;  2M06 A;  5E79 O;  3AA6 B;  2R4P A;  3QRC A;  3VY9 X;  3DA4 A;  5EE2 A;  2W81 C;  2GE4 A;  2XE5 A;  2ODJ A;  2W80 C;  3AAA B;  1THQ A;  1QJP A;  2Y0H A;  4JCH A;  2XE1 A;  4LSI A;  2Y7S A;  4O49 A;  3POQ A;  3A0B O;  1E54 A;  1T1L A;  3TZG A;  2ZLD A;  2IWW A;  3V8U A;  3VZT X;  1HXU A;  2N2L A;  1ZHT A;  2QTK A;  2FGQ X;  4JFB A;  2ZFG A;  1ZHW A;  3BRZ A;  3AA1 A;  3POR A;  5KAF O;  1S5L O;  3SZD A;  3DWO X;  4FT6 A;  5PRN A;  4N58 A;  2Y2X A;  3NJT A;  4G76 A;  1GFM A;  2AXT O;  4K3B A;  3VZW X;  2R88 A;  4D65 A;  4O3W A;  2M07 A;  3T24 A;  4AKR A;  3T0S A;  1MM5 A;  1BH3 A;  3RBH A; 
#chains in the Genus database with same CATH homology
 1IZN B;  3C5O A;  4GCP A;  5DL7 A;  3WI4 A;  3JTY A;  2YPV A;  2XMX A;  3K19 A;  4O3X B;  5FVN A;  1P4T A;  2J4U P;  3VZU X;  2XE2 A;  4QQ1 A;  3GP6 A;  4XNK A;  1ORM A;  1OPF A;  2KXP A;  2POR A;  2X27 X;  1YS5 A;  3VE1 A;  1BT9 A;  3O0E A;  5D5D A;  3A2S X;  3AA7 A;  3DA3 A;  3LK3 B;  4C69 X;  1H6S 1;  1MPF A;  2PRN A;  1BXW A;  4PUX A;  4AKM A;  5IYU A;  3LK2 A;  3EMN X;  4F4B A;  2O4V A;  2F1V A;  4FZM A;  4GF4 A;  1ZHX A;  3AA1 B;  4RJW A;  3UPG A;  4AFK A;  5DL8 A;  2LHF A;  2J1N A;  2YNK A;  1QJ9 A;  4O4X A;  4RLB A;  4D5U A;  4KRA A;  2K4T A;  2N2M A;  2XTQ A;  4RLC A;  1GFO A;  2MNH A;  3KVD D;  3AAA A;  4AKR B;  4FSP A;  3VY8 X;  4AYI D;  2K0L A;  4FES A;  3T20 A;  4FMS A;  4G75 A;  4LSF A;  3AA0 B;  3FYX A;  3PRN A;  3QRA A;  3NSG A;  2OMF A;  3HOE A;  1Q9F A;  5G26 A;  4O4U A;  4O3Z A;  4U9C A;  5ADX L;  3SYB A;  3VE2 A;  2MHL A;  4RL9 A;  4KR4 A;  3SZV A;  1ZHY A;  4D64 A;  5JDP A;  1HXX A;  2KZ7 A;  4FZL A;  4GCS A;  2Y0K A;  4FSO A;  5AFU L;  3AA7 B;  3SYS A;  2FGR A;  3WI5 A;  1IZN A;  4B61 A;  3AAE A;  4AYE C;  4XNL A;  3LK2 B;  4E1T A;  4AZL A;  3SY9 A;  3AA6 A;  4Z3T A;  3G7G A;  5T5F A;  1HXT A;  4KR8 A;  4O3Y A;  5DL6 A;  1QJ8 A;  2ERV A;  4FZN A;  4BUM X;  4LSE A;  4FRX A;  2KDY A;  4FOZ A;  4GCQ A;  3POU A;  2XE3 A;  1G90 A;  1GFQ A;  4FRT A;  3UU2 A;  8PRN A;  3LK3 A;  5ADX K;  3HWB A;  4RJX A;  5GV0 A;  2KC0 A;  2LFU A;  1MM4 A;  2KXP B;  4N59 A;  4GHB A;  5DL5 A;  1OSM A;  3LK4 2;  4AYD C;  1PHO A;  3LK4 1;  6PRN A;  2JMM A;  3SY7 A;  5AFU K;  4E1S A;  3PQS A;  1GFN A;  7PRN A;  3UAQ A;  2KZ7 B;  3POX A;  2XTR A;  1PRN A;  4AYM C;  3PQU A;  2F1T A;  1Q9G A;  3HW9 A;  2XG6 A;  3AAE B;  4FUV A;  3AA0 A;  1GFP A;  3HOL A;  4AYN A;  4LSH A;  1ZHZ A;  2Y0L A;  2M06 A;  3AA6 B;  3QRC A;  3VY9 X;  3DA4 A;  5EE2 A;  2W81 C;  2GE4 A;  2XE5 A;  2ODJ A;  2W80 C;  3AAA B;  1THQ A;  1QJP A;  2Y0H A;  4JCH A;  2XE1 A;  4LSI A;  2Y7S A;  4O49 A;  3POQ A;  1E54 A;  3TZG A;  2ZLD A;  3V8U A;  3VZT X;  1HXU A;  2N2L A;  1ZHT A;  2QTK A;  2FGQ X;  4JFB A;  2ZFG A;  1ZHW A;  3POR A;  3AA1 A;  4AUI A;  3SZD A;  5PRN A;  4FT6 A;  4N58 A;  2Y2X A;  4G76 A;  1GFM A;  3VZW X;  4D65 A;  4O3W A;  2M07 A;  3T24 A;  4AKR A;  3T0S A;  1MM5 A;  1BH3 A;  3RBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...