1QJ8A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj8A00
3QRCA 2MHLA 1THQA 2F1TA 2M07A 1P4TA 3GP6A 1Q9FA 2ERVA 2GE4A 1MM5A 1MM4A 1QJ8A 2N2MA 1QJPA 4RLCA 2X27X 3G7GA 3QRAA 1Q9GA 3C5OA 4PUXA 1QJ9A 2F1VA 2MNHA 2M06A 2LHFA 2N2LA 1BXWA 2K0LA 1ORMA 2JMMA 1G90A
chains in the Genus database with same CATH superfamily
3SYBA 3AAEA 2MHLA 2R4PA 2M07A 3LK41 1P4TA 4UB8O 2GE4A 4AYEC 3TZGA 2K4TA 4PR7A 3DA4A 2ZLDA 3PORA 1ZHYA 3LK42 1HXUA 4LSEA 3G7GA 2J1NA 3DZMA 3T0SA 4AFKA 1PHOA 3AA7A 2XE1A 4C4VA 4KRAA 4O4UA 4FMSA 3DWNA 5KAIO 4AKMA 3UU2A 8PRNA 2LFUA 2F1VA 4FESA 5B66O 3POUA 2KZ7A 3K19A 5DL8A 3LK3B 4N59A 4XNKA 2Y7SA 5TISO 3AA6B 2K0LA 4GF4A 1ORMA 2O4VA 3DA3A 3SYSA 4D5UA 5B5EO 1IZNB 3AAAA 3EMNX 4E1TA 4F4BA 1HXXA 5H2FO 3NJTA 3T24A 4AKRA 3UPGA 1G90A 1OSMA 4FZLA 3VE1A 2KXPB 2YNKA 5EE2A 1GFQA 4CTDA 4O3YA 2X9KA 2ERVA 2WVPA 3JTYA 4FSOA 3VZWX 3VZTX 4D64A 1MM4A 4AYNA 5IYUA 5JDPA 4LSHA 2N2MA 3PGUA 2R89A 2X27X 3QRAA 2F1CX 2XG6A 3HWBA 4FSPA 4GHBA 4O49A 4XNLA 5PRNA 3WI4A 5GV0A 4JFBA 4N58A 3SY7A 1ZHTA 4GCSA 5AFUK 1MPFA 2J4UP 3SY9A 4B61A 3PF1A 3HOEA 1T1LA 3A0BO 4UB6O 4LSIA 3UAQA 3POQA 3A0HO 3LK3A 2N2LA 4FRTA 3VY8X 3O0EA 5GTIO 3AA1B 2WJQA 3NSGA 4G75A 2R4NA 3AA6A 4K3CA 3LK2B 6PRNA 4QQ1A 2Y0KA 2JQYA 3PGRA 2FGQX 1IZNA 4RLBA 2ODJA 4AUIA 4K3BA 4N75A 2W81C 3KZIO 3QRCA 4RJWA 4PJ0O 4D65A 3VY9X 2FGRA 1OPFA 2KXPA 1Q9FA 3GP6A 4GCQA 1MM5A 5G38A 2OMFA 4LSFA 4FQEA 2PORA 4BUMX 3V8UA 3VE2A 4O4XA 5AFUL 1GFNA 2R8AA 1GFPA 2XTQA 1YS5A 1BT9A 4FZMA 1GFOA 1ZHZA 3HOLA 4AYID 4O3XB 3C5OA 4RL9A 4O3ZA 3RBHA 4PUXA 5D5DA 4AYDC 3BRZA 1QJ9A 3A2SX 2QTKA 2KC0A 2Y2XA 5KAFO 2MNHA 4G76A 2M06A 1H6S1 2LHFA 4IL6O 3WI5A 2R4OA 5E79O 2R4LA 3BS0A 5G39A 1ZHWA 3BRYA 4C69X 4FZNA 5DL5A 3DWOX 2WJRA 1BXWA 4N74A 4O3WA 4E1SA 3AA1A 5T5FA 1T16A 3KVDD 2Y0LA 3AA0B 3LK2A 3FYXA 3SZVA 2IWVA 3AAEB 4FOZA 4FT6A 4GCPA 4JCHA 1THQA 1S5LO 2F1TA 3VZUX 5DL7A 1PRNA 4KR4A 2KDYA 4RJXA 1QJ8A 1QJPA 4RLCA 2Y0HA 3AA7B 4C4VB 2W80C 4Z3TA 2AXTO 3JCUO 4KR8A 1ZHXA 1Q9GA 2YPVA 1BH3A 2ZFGA 3POXA 4FUVA 5DL6A 4AZLA 5ADXL 7PRNA 2KZ7B 5G26A 1E54A 1GFMA 3HW9A 1HXTA 3PQUA 3PRNA 3PQSA 2XE2A 2XTRA 2XE5A 2R88A 3T20A 3SZDA 2XMXA 4C00A 4FRXA 5GTHO 3AAAB 2JMMA 2XE3A 2PRNA 4U9CA 5G3AA 4AKRB 2IWWA 3WU2O 5ADXK 4AYMC 3AA0A 5FVNA 3PGSA
chains in the Genus database with same CATH topology
3SYBA 3AAEA 2MHLA 2M07A 3LK41 1P4TA 2GE4A 4AYEC 3TZGA 2K4TA 3DA4A 2ZLDA 3PORA 1ZHYA 3LK42 1HXUA 4LSEA 3G7GA 2J1NA 3T0SA 4AFKA 1PHOA 3AA7A 2XE1A 4KRAA 4O4UA 4FMSA 4AKMA 3UU2A 8PRNA 2LFUA 2F1VA 4FESA 3POUA 2KZ7A 3K19A 5DL8A 3LK3B 4N59A 4XNKA 2Y7SA 3AA6B 2K0LA 4GF4A 1ORMA 2O4VA 3DA3A 3SYSA 4D5UA 1IZNB 3AAAA 3EMNX 4E1TA 4F4BA 1HXXA 3UPGA 4AKRA 3T24A 1G90A 1OSMA 4FZLA 3VE1A 2KXPB 2YNKA 5EE2A 1GFQA 4O3YA 2ERVA 3JTYA 4FSOA 3VZWX 3VZTX 4D64A 5IYUA 1MM4A 4AYNA 5JDPA 4LSHA 2N2MA 2X27X 3QRAA 2XG6A 3HWBA 4FSPA 4GHBA 4O49A 4XNLA 5PRNA 3WI4A 5GV0A 4JFBA 4N58A 3SY7A 1ZHTA 4GCSA 5AFUK 1MPFA 2J4UP 3SY9A 4B61A 3HOEA 3UAQA 4LSIA 3POQA 3LK3A 3VY8X 2N2LA 4FRTA 3O0EA 4D65A 3AA1B 4G75A 3NSGA 6PRNA 3AA6A 3LK2B 4QQ1A 2Y0KA 4RLBA 4AUIA 2FGQX 1IZNA 2ODJA 4RJWA 2W81C 3QRCA 3VY9X 2FGRA 1OPFA 2KXPA 1Q9FA 3GP6A 4GCQA 1MM5A 2OMFA 4LSFA 2PORA 4BUMX 3V8UA 3VE2A 4O4XA 5AFUL 1GFNA 1GFPA 2XTQA 1YS5A 1BT9A 4FZMA 1GFOA 1ZHZA 3HOLA 4AYID 4O3XB 3C5OA 4RL9A 4O3ZA 3RBHA 4PUXA 5D5DA 4AYDC 1QJ9A 3A2SX 2QTKA 2KC0A 2Y2XA 2MNHA 4G76A 2M06A 1H6S1 2LHFA 3WI5A 1ZHWA 4C69X 4FZNA 5DL5A 1BXWA 4E1SA 4O3WA 3AA1A 5T5FA 3KVDD 2Y0LA 3AA0B 3LK2A 3FYXA 3SZVA 3AAEB 4FOZA 4FT6A 4GCPA 4JCHA 1THQA 2F1TA 3VZUX 5DL7A 1PRNA 4KR4A 2KDYA 4RJXA 1QJ8A 1QJPA 4RLCA 2Y0HA 3AA7B 4Z3TA 2W80C 4KR8A 1ZHXA 1Q9GA 2YPVA 1BH3A 2ZFGA 3POXA 4FUVA 5DL6A 4AZLA 5ADXL 7PRNA 2KZ7B 5G26A 1E54A 1GFMA 3HW9A 1HXTA 3PQUA 3PRNA 3PQSA 2XE2A 2XTRA 2XE5A 3T20A 3SZDA 2XMXA 4FRXA 3AAAB 2JMMA 2XE3A 2PRNA 4U9CA 4AKRB 5ADXK 4AYMC 3AA0A 5FVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRC A;  2MHL A;  1THQ A;  2F1T A;  2M07 A;  1P4T A;  3GP6 A;  1Q9F A;  2ERV A;  2GE4 A;  1MM5 A;  1MM4 A;  1QJ8 A;  2N2M A;  1QJP A;  4RLC A;  2X27 X;  3G7G A;  3QRA A;  1Q9G A;  3C5O A;  4PUX A;  1QJ9 A;  2F1V A;  2MNH A;  2M06 A;  2LHF A;  2N2L A;  1BXW A;  2K0L A;  1ORM A;  2JMM A;  1G90 A; 
#chains in the Genus database with same CATH topology
 3SYB A;  3AAE A;  2MHL A;  2R4P A;  2M07 A;  3LK4 1;  1P4T A;  4UB8 O;  2GE4 A;  4AYE C;  3TZG A;  2K4T A;  4PR7 A;  3DA4 A;  2ZLD A;  3POR A;  1ZHY A;  3LK4 2;  1HXU A;  4LSE A;  3G7G A;  2J1N A;  3DZM A;  3T0S A;  4AFK A;  1PHO A;  3AA7 A;  2XE1 A;  4C4V A;  4KRA A;  4O4U A;  4FMS A;  3DWN A;  5KAI O;  4AKM A;  3UU2 A;  8PRN A;  2LFU A;  2F1V A;  4FES A;  5B66 O;  3POU A;  2KZ7 A;  3K19 A;  5DL8 A;  3LK3 B;  4N59 A;  4XNK A;  2Y7S A;  5TIS O;  3AA6 B;  2K0L A;  4GF4 A;  1ORM A;  2O4V A;  3DA3 A;  3SYS A;  4D5U A;  5B5E O;  1IZN B;  3AAA A;  3EMN X;  4E1T A;  4F4B A;  1HXX A;  5H2F O;  3NJT A;  3T24 A;  4AKR A;  3UPG A;  1G90 A;  1OSM A;  4FZL A;  3VE1 A;  2KXP B;  2YNK A;  5EE2 A;  1GFQ A;  4CTD A;  4O3Y A;  2X9K A;  2ERV A;  2WVP A;  3JTY A;  4FSO A;  3VZW X;  3VZT X;  4D64 A;  1MM4 A;  4AYN A;  5IYU A;  5JDP A;  4LSH A;  2N2M A;  3PGU A;  2R89 A;  2X27 X;  3QRA A;  2F1C X;  2XG6 A;  3HWB A;  4FSP A;  4GHB A;  4O49 A;  4XNL A;  5PRN A;  3WI4 A;  5GV0 A;  4JFB A;  4N58 A;  3SY7 A;  1ZHT A;  4GCS A;  5AFU K;  1MPF A;  2J4U P;  3SY9 A;  4B61 A;  3PF1 A;  3HOE A;  1T1L A;  3A0B O;  4UB6 O;  4LSI A;  3UAQ A;  3POQ A;  3A0H O;  3LK3 A;  2N2L A;  4FRT A;  3VY8 X;  3O0E A;  5GTI O;  3AA1 B;  2WJQ A;  3NSG A;  4G75 A;  2R4N A;  3AA6 A;  4K3C A;  3LK2 B;  6PRN A;  4QQ1 A;  2Y0K A;  2JQY A;  3PGR A;  2FGQ X;  1IZN A;  4RLB A;  2ODJ A;  4AUI A;  4K3B A;  4N75 A;  2W81 C;  3KZI O;  3QRC A;  4RJW A;  4PJ0 O;  4D65 A;  3VY9 X;  2FGR A;  1OPF A;  2KXP A;  1Q9F A;  3GP6 A;  4GCQ A;  1MM5 A;  5G38 A;  2OMF A;  4LSF A;  4FQE A;  2POR A;  4BUM X;  3V8U A;  3VE2 A;  4O4X A;  5AFU L;  1GFN A;  2R8A A;  1GFP A;  2XTQ A;  1YS5 A;  1BT9 A;  4FZM A;  1GFO A;  1ZHZ A;  3HOL A;  4AYI D;  4O3X B;  3C5O A;  4RL9 A;  4O3Z A;  3RBH A;  4PUX A;  5D5D A;  4AYD C;  3BRZ A;  1QJ9 A;  3A2S X;  2QTK A;  2KC0 A;  2Y2X A;  5KAF O;  2MNH A;  4G76 A;  2M06 A;  1H6S 1;  2LHF A;  4IL6 O;  3WI5 A;  2R4O A;  5E79 O;  2R4L A;  3BS0 A;  5G39 A;  1ZHW A;  3BRY A;  4C69 X;  4FZN A;  5DL5 A;  3DWO X;  2WJR A;  1BXW A;  4N74 A;  4O3W A;  4E1S A;  3AA1 A;  5T5F A;  1T16 A;  3KVD D;  2Y0L A;  3AA0 B;  3LK2 A;  3FYX A;  3SZV A;  2IWV A;  3AAE B;  4FOZ A;  4FT6 A;  4GCP A;  4JCH A;  1THQ A;  1S5L O;  2F1T A;  3VZU X;  5DL7 A;  1PRN A;  4KR4 A;  2KDY A;  4RJX A;  1QJ8 A;  1QJP A;  4RLC A;  2Y0H A;  3AA7 B;  4C4V B;  2W80 C;  4Z3T A;  2AXT O;  3JCU O;  4KR8 A;  1ZHX A;  1Q9G A;  2YPV A;  1BH3 A;  2ZFG A;  3POX A;  4FUV A;  5DL6 A;  4AZL A;  5ADX L;  7PRN A;  2KZ7 B;  5G26 A;  1E54 A;  1GFM A;  3HW9 A;  1HXT A;  3PQU A;  3PRN A;  3PQS A;  2XE2 A;  2XTR A;  2XE5 A;  2R88 A;  3T20 A;  3SZD A;  2XMX A;  4C00 A;  4FRX A;  5GTH O;  3AAA B;  2JMM A;  2XE3 A;  2PRN A;  4U9C A;  5G3A A;  4AKR B;  2IWW A;  3WU2 O;  5ADX K;  4AYM C;  3AA0 A;  5FVN A;  3PGS A; 
#chains in the Genus database with same CATH homology
 3SYB A;  3AAE A;  2MHL A;  2M07 A;  3LK4 1;  1P4T A;  2GE4 A;  4AYE C;  3TZG A;  2K4T A;  3DA4 A;  2ZLD A;  3POR A;  1ZHY A;  3LK4 2;  1HXU A;  4LSE A;  3G7G A;  2J1N A;  3T0S A;  4AFK A;  1PHO A;  3AA7 A;  2XE1 A;  4KRA A;  4O4U A;  4FMS A;  4AKM A;  3UU2 A;  8PRN A;  2LFU A;  2F1V A;  4FES A;  3POU A;  2KZ7 A;  3K19 A;  5DL8 A;  3LK3 B;  4N59 A;  4XNK A;  2Y7S A;  3AA6 B;  2K0L A;  4GF4 A;  1ORM A;  2O4V A;  3DA3 A;  3SYS A;  4D5U A;  1IZN B;  3AAA A;  3EMN X;  4E1T A;  4F4B A;  1HXX A;  3UPG A;  4AKR A;  3T24 A;  1G90 A;  1OSM A;  4FZL A;  3VE1 A;  2KXP B;  2YNK A;  5EE2 A;  1GFQ A;  4O3Y A;  2ERV A;  3JTY A;  4FSO A;  3VZW X;  3VZT X;  4D64 A;  5IYU A;  1MM4 A;  4AYN A;  5JDP A;  4LSH A;  2N2M A;  2X27 X;  3QRA A;  2XG6 A;  3HWB A;  4FSP A;  4GHB A;  4O49 A;  4XNL A;  5PRN A;  3WI4 A;  5GV0 A;  4JFB A;  4N58 A;  3SY7 A;  1ZHT A;  4GCS A;  5AFU K;  1MPF A;  2J4U P;  3SY9 A;  4B61 A;  3HOE A;  3UAQ A;  4LSI A;  3POQ A;  3LK3 A;  3VY8 X;  2N2L A;  4FRT A;  3O0E A;  4D65 A;  3AA1 B;  4G75 A;  3NSG A;  6PRN A;  3AA6 A;  3LK2 B;  4QQ1 A;  2Y0K A;  4RLB A;  4AUI A;  2FGQ X;  1IZN A;  2ODJ A;  4RJW A;  2W81 C;  3QRC A;  3VY9 X;  2FGR A;  1OPF A;  2KXP A;  1Q9F A;  3GP6 A;  4GCQ A;  1MM5 A;  2OMF A;  4LSF A;  2POR A;  4BUM X;  3V8U A;  3VE2 A;  4O4X A;  5AFU L;  1GFN A;  1GFP A;  2XTQ A;  1YS5 A;  1BT9 A;  4FZM A;  1GFO A;  1ZHZ A;  3HOL A;  4AYI D;  4O3X B;  3C5O A;  4RL9 A;  4O3Z A;  3RBH A;  4PUX A;  5D5D A;  4AYD C;  1QJ9 A;  3A2S X;  2QTK A;  2KC0 A;  2Y2X A;  2MNH A;  4G76 A;  2M06 A;  1H6S 1;  2LHF A;  3WI5 A;  1ZHW A;  4C69 X;  4FZN A;  5DL5 A;  1BXW A;  4E1S A;  4O3W A;  3AA1 A;  5T5F A;  3KVD D;  2Y0L A;  3AA0 B;  3LK2 A;  3FYX A;  3SZV A;  3AAE B;  4FOZ A;  4FT6 A;  4GCP A;  4JCH A;  1THQ A;  2F1T A;  3VZU X;  5DL7 A;  1PRN A;  4KR4 A;  2KDY A;  4RJX A;  1QJ8 A;  1QJP A;  4RLC A;  2Y0H A;  3AA7 B;  4Z3T A;  2W80 C;  4KR8 A;  1ZHX A;  1Q9G A;  2YPV A;  1BH3 A;  2ZFG A;  3POX A;  4FUV A;  5DL6 A;  4AZL A;  5ADX L;  7PRN A;  2KZ7 B;  5G26 A;  1E54 A;  1GFM A;  3HW9 A;  1HXT A;  3PQU A;  3PRN A;  3PQS A;  2XE2 A;  2XTR A;  2XE5 A;  3T20 A;  3SZD A;  2XMX A;  4FRX A;  3AAA B;  2JMM A;  2XE3 A;  2PRN A;  4U9C A;  4AKR B;  5ADX K;  4AYM C;  3AA0 A;  5FVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...