1QJ8A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj8A00
1Q9GA 1BXWA 2F1TA 2MNHA 1Q9FA 1P4TA 1ORMA 3GP6A 1QJPA 3C5OA 2ERVA 2JMMA 1G90A 2F1VA 2N2MA 2X27X 2LHFA 1QJ9A 1MM5A 2GE4A 4PUXA 3G7GA 1MM4A 2M06A 2K0LA 2MHLA 4RLCA 2N2LA 1THQA 3QRCA 2M07A 3QRAA 1QJ8A
chains in the Genus database with same CATH superfamily
1GFPA 3HOLA 4C4VB 3WI5A 3BRYA 4KR8A 3HW9A 4LSEA 2KDYA 3PGUA 4KR4A 3VZWX 1P4TA 2R88A 4FESA 2X9KA 4O3XB 3A0HO 3C5OA 4FQEA 5DL8A 2XTRA 4FZMA 4GCPA 3DWOX 3UAQA 1G90A 2F1VA 2YPVA 5G26A 4K3CA 3AAAA 4N75A 2R8AA 4CTDA 1QJ9A 5ADXK 5E79O 3AA6B 3SZDA 4GCQA 3SYBA 1ZHZA 4PR7A 2XTQA 4XNLA 1PHOA 4Z3TA 1E54A 1MPFA 5T5FA 3POUA 5B66O 3EMNX 5TISO 1BH3A 3O0EA 2IWWA 3SY9A 3LK2A 3TZGA 2Y0LA 2KXPA 6PRNA 4D5UA 2ZLDA 2XE1A 4AYID 1H6S1 3SZVA 3T24A 4AYEC 1IZNA 4B61A 4N59A 4F4BA 2MNHA 1GFMA 1Q9FA 1BT9A 1ORMA 4FOZA 4JCHA 5G39A 2R4LA 3SYSA 3AA0A 5DL7A 2FGQX 2WJRA 3GP6A 3K19A 1OPFA 2R4PA 3DWNA 4LSIA 2JMMA 4C00A 4GF4A 2W81C 2N2MA 4KRAA 3PORA 3PGRA 4O4UA 2PORA 3HOEA 3DZMA 1HXXA 4FRTA 3WI4A 5GV0A 1ZHYA 4AUIA 4AYNA 3FYXA 4O49A 3KVDD 2PRNA 2XE2A 2Y0HA 4LSHA 5EE2A 5H2FO 5IYUA 2K0LA 4U9CA 1ZHTA 2R4OA 8PRNA 2MHLA 2XE3A 5DL6A 3AAAB 3VZUX 3WU2O 3AAEA 4FSPA 4E1TA 2N2LA 4LSFA 4FMSA 4PJ0O 4C69X 2Y2XA 4RLBA 5GTIO 4O4XA 3PRNA 1Q9GA 4O3YA 3VY8X 2Y7SA 2F1TA 4FUVA 1PRNA 4UB6O 1HXTA 2AXTO 1HXUA 3KZIO 2FGRA 3T0SA 2F1CX 1YS5A 3AAEB 4GCSA 5AFUK 4D64A 2W80C 5JDPA 3LK3A 3LK2B 4GHBA 1OSMA 2OMFA 2KXPB 3VE2A 4AKRA 3NJTA 3PQUA 2X27X 4AZLA 1ZHWA 5KAFO 4O3ZA 1IZNB 2ZFGA 4AYMC 5AFUL 1MM5A 2GE4A 2WVPA 2XE5A 3A2SX 3BS0A 2R4NA 2XMXA 3G7GA 3HWBA 3AA0B 3PF1A 4IL6O 2J1NA 5G3AA 3POQA 4FSOA 1MM4A 1GFNA 3UPGA 2IWVA 2M06A 3JCUO 4N74A 2R89A 2KC0A 3POXA 4G75A 4C4VA 4FRXA 2QTKA 3A0BO 3PGSA 3VY9X 4RLCA 3LK42 1ZHXA 4JFBA 4AYDC 1GFOA 3V8UA 4E1SA 3UU2A 3NSGA 4K3BA 3RBHA 5GTHO 2XG6A 2M07A 4AKMA 2O4VA 1S5LO 1QJ8A 3PQSA 3QRAA 4PUXA 2Y0KA 1BXWA 3AA7A 3BRZA 2YNKA 4N58A 4O3WA 4XNKA 5FVNA 4D65A 7PRNA 1GFQA 5KAIO 3AA6A 4RJXA 4AFKA 1QJPA 2ERVA 3JTYA 3SY7A 5DL5A 5G38A 2ODJA 2KZ7A 3AA1A 3AA7B 1T1LA 2LHFA 5B5EO 2K4TA 2WJQA 2LFUA 4UB8O 4FT6A 4RJWA 3DA3A 5PRNA 3VZTX 3LK3B 2KZ7B 3AA1B 3LK41 4AKRB 3T20A 4RL9A 3DA4A 4FZLA 4FZNA 3VE1A 5ADXL 2J4UP 1T16A 4QQ1A 1THQA 3QRCA 4G76A 5D5DA 4BUMX 2JQYA
chains in the Genus database with same CATH topology
1GFPA 3HOLA 3WI5A 4KR8A 3HW9A 4LSEA 2KDYA 4KR4A 3VZWX 1P4TA 4FESA 4O3XB 3UAQA 3C5OA 5DL8A 2XTRA 4FZMA 4GCPA 1G90A 2F1VA 2YPVA 5G26A 3AAAA 1QJ9A 5ADXK 3AA6B 3SZDA 4GCQA 3SYBA 1ZHZA 2XTQA 4XNLA 1PHOA 4Z3TA 1E54A 1MPFA 5T5FA 3POUA 3EMNX 1BH3A 3O0EA 3SY9A 3LK2A 3TZGA 2Y0LA 2KXPA 6PRNA 4D5UA 2ZLDA 2XE1A 4AYID 1H6S1 3SZVA 3T24A 4AYEC 1IZNA 4B61A 4N59A 4F4BA 2MNHA 1GFMA 1Q9FA 1BT9A 1ORMA 4FOZA 4JCHA 3SYSA 3AA0A 5DL7A 2FGQX 3GP6A 3K19A 1OPFA 4LSIA 2JMMA 4GF4A 2W81C 2N2MA 4KRAA 3PORA 4O4UA 2PORA 3HOEA 1HXXA 4FRTA 3WI4A 5GV0A 1ZHYA 4AUIA 4AYNA 3FYXA 4O49A 3KVDD 2PRNA 2XE2A 2Y0HA 4LSHA 5EE2A 5IYUA 2K0LA 4U9CA 1ZHTA 8PRNA 2MHLA 2XE3A 5DL6A 3AAAB 3VZUX 3AAEA 4FSPA 4E1TA 2N2LA 4LSFA 4FMSA 4C69X 2Y2XA 4O4XA 3PRNA 1Q9GA 4O3YA 3VY8X 2Y7SA 2F1TA 4FUVA 1PRNA 1HXTA 1HXUA 2FGRA 3T0SA 5AFUK 1YS5A 3AAEB 4GCSA 5JDPA 4D64A 2W80C 3LK3A 3LK2B 4GHBA 1OSMA 2OMFA 2KXPB 3VE2A 4AKRA 3PQUA 2X27X 4AZLA 1ZHWA 4O3ZA 1IZNB 2ZFGA 4AYMC 5AFUL 1MM5A 2GE4A 2XE5A 4PUXA 3A2SX 3HWBA 4RLBA 2XMXA 3G7GA 4BUMX 3AA0B 4E1SA 2J1NA 3UPGA 3POQA 4FSOA 1MM4A 1GFNA 2M06A 2KC0A 3POXA 4G75A 4FRXA 2QTKA 3VY9X 4RLCA 3LK42 1ZHXA 4JFBA 4AYDC 1GFOA 3V8UA 3UU2A 3NSGA 3RBHA 2XG6A 2M07A 2O4VA 1QJ8A 3PQSA 3QRAA 2Y0KA 1BXWA 3AA7A 4N58A 2YNKA 4O3WA 4XNKA 5FVNA 4D65A 7PRNA 1GFQA 3AA6A 4RJXA 4AFKA 1QJPA 2ERVA 3JTYA 3SY7A 5DL5A 2ODJA 2KZ7A 3AA1A 3AA7B 2LHFA 2K4TA 2LFUA 4FT6A 4RJWA 3DA3A 5PRNA 3VZTX 3LK3B 2KZ7B 3AA1B 3LK41 4AKRB 3T20A 4RL9A 3DA4A 4FZLA 4FZNA 3VE1A 5ADXL 2J4UP 4QQ1A 1THQA 3QRCA 4G76A 5D5DA 4AKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9G A;  1BXW A;  2F1T A;  2MNH A;  1Q9F A;  1P4T A;  1ORM A;  3GP6 A;  1QJP A;  3C5O A;  2ERV A;  2JMM A;  1G90 A;  2F1V A;  2N2M A;  2X27 X;  2LHF A;  1QJ9 A;  1MM5 A;  2GE4 A;  4PUX A;  3G7G A;  1MM4 A;  2M06 A;  2K0L A;  2MHL A;  4RLC A;  2N2L A;  1THQ A;  3QRC A;  2M07 A;  3QRA A;  1QJ8 A; 
#chains in the Genus database with same CATH topology
 1GFP A;  3HOL A;  4C4V B;  3WI5 A;  3BRY A;  4KR8 A;  3HW9 A;  4LSE A;  2KDY A;  3PGU A;  4KR4 A;  3VZW X;  1P4T A;  2R88 A;  4FES A;  2X9K A;  4O3X B;  3A0H O;  3C5O A;  4FQE A;  5DL8 A;  2XTR A;  4FZM A;  4GCP A;  3DWO X;  3UAQ A;  1G90 A;  2F1V A;  2YPV A;  5G26 A;  4K3C A;  3AAA A;  4N75 A;  2R8A A;  4CTD A;  1QJ9 A;  5ADX K;  5E79 O;  3AA6 B;  3SZD A;  4GCQ A;  3SYB A;  1ZHZ A;  4PR7 A;  2XTQ A;  4XNL A;  1PHO A;  4Z3T A;  1E54 A;  1MPF A;  5T5F A;  3POU A;  5B66 O;  3EMN X;  5TIS O;  1BH3 A;  3O0E A;  2IWW A;  3SY9 A;  3LK2 A;  3TZG A;  2Y0L A;  2KXP A;  6PRN A;  4D5U A;  2ZLD A;  2XE1 A;  4AYI D;  1H6S 1;  3SZV A;  3T24 A;  4AYE C;  1IZN A;  4B61 A;  4N59 A;  4F4B A;  2MNH A;  1GFM A;  1Q9F A;  1BT9 A;  1ORM A;  4FOZ A;  4JCH A;  5G39 A;  2R4L A;  3SYS A;  3AA0 A;  5DL7 A;  2FGQ X;  2WJR A;  3GP6 A;  3K19 A;  1OPF A;  2R4P A;  3DWN A;  4LSI A;  2JMM A;  4C00 A;  4GF4 A;  2W81 C;  2N2M A;  4KRA A;  3POR A;  3PGR A;  4O4U A;  2POR A;  3HOE A;  3DZM A;  1HXX A;  4FRT A;  3WI4 A;  5GV0 A;  1ZHY A;  4AUI A;  4AYN A;  3FYX A;  4O49 A;  3KVD D;  2PRN A;  2XE2 A;  2Y0H A;  4LSH A;  5EE2 A;  5H2F O;  5IYU A;  2K0L A;  4U9C A;  1ZHT A;  2R4O A;  8PRN A;  2MHL A;  2XE3 A;  5DL6 A;  3AAA B;  3VZU X;  3WU2 O;  3AAE A;  4FSP A;  4E1T A;  2N2L A;  4LSF A;  4FMS A;  4PJ0 O;  4C69 X;  2Y2X A;  4RLB A;  5GTI O;  4O4X A;  3PRN A;  1Q9G A;  4O3Y A;  3VY8 X;  2Y7S A;  2F1T A;  4FUV A;  1PRN A;  4UB6 O;  1HXT A;  2AXT O;  1HXU A;  3KZI O;  2FGR A;  3T0S A;  2F1C X;  1YS5 A;  3AAE B;  4GCS A;  5AFU K;  4D64 A;  2W80 C;  5JDP A;  3LK3 A;  3LK2 B;  4GHB A;  1OSM A;  2OMF A;  2KXP B;  3VE2 A;  4AKR A;  3NJT A;  3PQU A;  2X27 X;  4AZL A;  1ZHW A;  5KAF O;  4O3Z A;  1IZN B;  2ZFG A;  4AYM C;  5AFU L;  1MM5 A;  2GE4 A;  2WVP A;  2XE5 A;  3A2S X;  3BS0 A;  2R4N A;  2XMX A;  3G7G A;  3HWB A;  3AA0 B;  3PF1 A;  4IL6 O;  2J1N A;  5G3A A;  3POQ A;  4FSO A;  1MM4 A;  1GFN A;  3UPG A;  2IWV A;  2M06 A;  3JCU O;  4N74 A;  2R89 A;  2KC0 A;  3POX A;  4G75 A;  4C4V A;  4FRX A;  2QTK A;  3A0B O;  3PGS A;  3VY9 X;  4RLC A;  3LK4 2;  1ZHX A;  4JFB A;  4AYD C;  1GFO A;  3V8U A;  4E1S A;  3UU2 A;  3NSG A;  4K3B A;  3RBH A;  5GTH O;  2XG6 A;  2M07 A;  4AKM A;  2O4V A;  1S5L O;  1QJ8 A;  3PQS A;  3QRA A;  4PUX A;  2Y0K A;  1BXW A;  3AA7 A;  3BRZ A;  2YNK A;  4N58 A;  4O3W A;  4XNK A;  5FVN A;  4D65 A;  7PRN A;  1GFQ A;  5KAI O;  3AA6 A;  4RJX A;  4AFK A;  1QJP A;  2ERV A;  3JTY A;  3SY7 A;  5DL5 A;  5G38 A;  2ODJ A;  2KZ7 A;  3AA1 A;  3AA7 B;  1T1L A;  2LHF A;  5B5E O;  2K4T A;  2WJQ A;  2LFU A;  4UB8 O;  4FT6 A;  4RJW A;  3DA3 A;  5PRN A;  3VZT X;  3LK3 B;  2KZ7 B;  3AA1 B;  3LK4 1;  4AKR B;  3T20 A;  4RL9 A;  3DA4 A;  4FZL A;  4FZN A;  3VE1 A;  5ADX L;  2J4U P;  1T16 A;  4QQ1 A;  1THQ A;  3QRC A;  4G76 A;  5D5D A;  4BUM X;  2JQY A; 
#chains in the Genus database with same CATH homology
 1GFP A;  3HOL A;  3WI5 A;  4KR8 A;  3HW9 A;  4LSE A;  2KDY A;  4KR4 A;  3VZW X;  1P4T A;  4FES A;  4O3X B;  3UAQ A;  3C5O A;  5DL8 A;  2XTR A;  4FZM A;  4GCP A;  1G90 A;  2F1V A;  2YPV A;  5G26 A;  3AAA A;  1QJ9 A;  5ADX K;  3AA6 B;  3SZD A;  4GCQ A;  3SYB A;  1ZHZ A;  2XTQ A;  4XNL A;  1PHO A;  4Z3T A;  1E54 A;  1MPF A;  5T5F A;  3POU A;  3EMN X;  1BH3 A;  3O0E A;  3SY9 A;  3LK2 A;  3TZG A;  2Y0L A;  2KXP A;  6PRN A;  4D5U A;  2ZLD A;  2XE1 A;  4AYI D;  1H6S 1;  3SZV A;  3T24 A;  4AYE C;  1IZN A;  4B61 A;  4N59 A;  4F4B A;  2MNH A;  1GFM A;  1Q9F A;  1BT9 A;  1ORM A;  4FOZ A;  4JCH A;  3SYS A;  3AA0 A;  5DL7 A;  2FGQ X;  3GP6 A;  3K19 A;  1OPF A;  4LSI A;  2JMM A;  4GF4 A;  2W81 C;  2N2M A;  4KRA A;  3POR A;  4O4U A;  2POR A;  3HOE A;  1HXX A;  4FRT A;  3WI4 A;  5GV0 A;  1ZHY A;  4AUI A;  4AYN A;  3FYX A;  4O49 A;  3KVD D;  2PRN A;  2XE2 A;  2Y0H A;  4LSH A;  5EE2 A;  5IYU A;  2K0L A;  4U9C A;  1ZHT A;  8PRN A;  2MHL A;  2XE3 A;  5DL6 A;  3AAA B;  3VZU X;  3AAE A;  4FSP A;  4E1T A;  2N2L A;  4LSF A;  4FMS A;  4C69 X;  2Y2X A;  4O4X A;  3PRN A;  1Q9G A;  4O3Y A;  3VY8 X;  2Y7S A;  2F1T A;  4FUV A;  1PRN A;  1HXT A;  1HXU A;  2FGR A;  3T0S A;  5AFU K;  1YS5 A;  3AAE B;  4GCS A;  5JDP A;  4D64 A;  2W80 C;  3LK3 A;  3LK2 B;  4GHB A;  1OSM A;  2OMF A;  2KXP B;  3VE2 A;  4AKR A;  3PQU A;  2X27 X;  4AZL A;  1ZHW A;  4O3Z A;  1IZN B;  2ZFG A;  4AYM C;  5AFU L;  1MM5 A;  2GE4 A;  2XE5 A;  4PUX A;  3A2S X;  3HWB A;  4RLB A;  2XMX A;  3G7G A;  4BUM X;  3AA0 B;  4E1S A;  2J1N A;  3UPG A;  3POQ A;  4FSO A;  1MM4 A;  1GFN A;  2M06 A;  2KC0 A;  3POX A;  4G75 A;  4FRX A;  2QTK A;  3VY9 X;  4RLC A;  3LK4 2;  1ZHX A;  4JFB A;  4AYD C;  1GFO A;  3V8U A;  3UU2 A;  3NSG A;  3RBH A;  2XG6 A;  2M07 A;  2O4V A;  1QJ8 A;  3PQS A;  3QRA A;  2Y0K A;  1BXW A;  3AA7 A;  4N58 A;  2YNK A;  4O3W A;  4XNK A;  5FVN A;  4D65 A;  7PRN A;  1GFQ A;  3AA6 A;  4RJX A;  4AFK A;  1QJP A;  2ERV A;  3JTY A;  3SY7 A;  5DL5 A;  2ODJ A;  2KZ7 A;  3AA1 A;  3AA7 B;  2LHF A;  2K4T A;  2LFU A;  4FT6 A;  4RJW A;  3DA3 A;  5PRN A;  3VZT X;  3LK3 B;  2KZ7 B;  3AA1 B;  3LK4 1;  4AKR B;  3T20 A;  4RL9 A;  3DA4 A;  4FZL A;  4FZN A;  3VE1 A;  5ADX L;  2J4U P;  4QQ1 A;  1THQ A;  3QRC A;  4G76 A;  5D5D A;  4AKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...