1QJ8A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN X
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj8A00
3C5OA 2F1TA 2N2LA 3GP6A 4PUXA 1MM5A 1ORMA 2MNHA 1P4TA 2F1VA 1G90A 2LHFA 1MM4A 2M06A 1QJ8A 2M07A 1THQA 1Q9GA 1QJPA 2MHLA 2JMMA 2GE4A 3QRAA 3G7GA 1BXWA 3QRCA 2K0LA 4RLCA 2ERVA 2X27X 1Q9FA 1QJ9A 2N2MA
chains in the Genus database with same CATH superfamily
4XNLA 3VZUX 1MPFA 5KAFO 2F1TA 2Y0KA 3SY9A 4G76A 4O49A 4AUIA 4AYEC 3NJTA 2MNHA 6PRNA 2IWWA 2FGRA 5H2FO 1ZHXA 1GFOA 1GFNA 2W81C 3AA6A 3UAQA 2PRNA 3LK3A 5D5DA 1G90A 3DWNA 2JQYA 2XMXA 3LK3B 3PGRA 4KR4A 3T20A 2ZLDA 3AA6B 5DL8A 4IL6O 2YPVA 5E79O 3DZMA 4PR7A 5FVNA 4AFKA 1THQA 3JCUO 4E1SA 4O3YA 1Q9GA 4AKMA 3VY8X 3UPGA 3SZDA 3DA3A 1H6S1 4FRTA 3LK2A 3T0SA 2KXPA 4FQEA 2XE3A 5B5EO 3RBHA 3G7GA 3POXA 1BXWA 3PGUA 1GFMA 2KXPB 3A2SX 4AKRA 2XTQA 1YS5A 7PRNA 3AAAB 3SY7A 4CTDA 2Y0LA 4FUVA 4LSEA 2R89A 3BRYA 2R4PA 2N2LA 3BRZA 3AAEB 3AA0A 5G38A 3VE2A 1HXUA 1OSMA 4PUXA 3HOLA 5JDPA 4FMSA 5G26A 5PRNA 2LHFA 2F1CX 2R8AA 3AA7A 1OPFA 2M06A 3PF1A 4G75A 2AXTO 4FZNA 1PHOA 1QJ8A 4E1TA 3O0EA 2M07A 2XE1A 3VZTX 4AYDC 4D64A 2J1NA 4C4VB 3LK42 1ZHTA 5IYUA 1QJPA 2MHLA 3BS0A 3HW9A 5EE2A 3AAAA 4KR8A 1ZHWA 5G39A 5GTHO 1PRNA 3SYSA 2W80C 2GE4A 1HXXA 3K19A 4RLBA 4B61A 2K0LA 4K3CA 5B66O 5GV0A 1Q9FA 3A0BO 5GTIO 4Z3TA 4LSIA 1T1LA 4FSOA 4N75A 3DWOX 5DL5A 2Y7SA 2ZFGA 5TISO 3TZGA 1ZHZA 3VE1A 3AA1A 3HWBA 3DA4A 2WJQA 2XE2A 4FZLA 3V8UA 8PRNA 4GHBA 1MM5A 1ORMA 1P4TA 4FT6A 3SYBA 3WU2O 5ADXK 4GCSA 1E54A 2F1VA 4N59A 1BH3A 3UU2A 2Y2XA 5AFUL 3PORA 3WI4A 3VZWX 3KVDD 4N58A 5AFUK 2KDYA 2WVPA 3AA1B 4F4BA 5KAIO 4FOZA 3HOEA 4GCPA 4C69X 1HXTA 2R88A 2JMMA 2K4TA 3SZVA 5ADXL 2Y0HA 4D5UA 2O4VA 3EMNX 1ZHYA 3FYXA 1GFQA 3POUA 3QRCA 2YNKA 4D65A 4O3ZA 2ERVA 2KZ7B 2OMFA 2PORA 4O4XA 2X27X 3A0HO 4UB6O 2N2MA 4JFBA 4O3XB 2X9KA 1IZNB 4JCHA 4C00A 5DL7A 3VY9X 3C5OA 2XTRA 3GP6A 2R4LA 4XNKA 3PRNA 4FESA 2WJRA 5T5FA 4AYMC 2XE5A 4LSFA 4AKRB 2KC0A 2KZ7A 2FGQX 1MM4A 3PGSA 2R4OA 4LSHA 3KZIO 4N74A 2LFUA 3LK41 4RL9A 5DL6A 4AYNA 1GFPA 4AZLA 4PJ0O 3LK2B 3WI5A 3AA0B 4RJWA 3PQSA 4C4VA 3PQUA 4FZMA 4O3WA 4GF4A 2J4UP 4RJXA 1IZNA 4K3BA 3JTYA 3AA7B 4BUMX 3QRAA 4UB8O 4U9CA 4QQ1A 4FRXA 4RLCA 2QTKA 1BT9A 2R4NA 5G3AA 1T16A 1S5LO 2XG6A 2ODJA 1QJ9A 3AAEA 3NSGA 2IWVA 3POQA 4GCQA 4KRAA 4O4UA 4AYID 3T24A 4FSPA
chains in the Genus database with same CATH topology
4XNLA 1MPFA 3SY9A 2F1TA 2Y0KA 4G76A 4O49A 4AYEC 6PRNA 2MNHA 2FGRA 1ZHXA 1GFOA 1GFNA 2W81C 3AA6A 3UAQA 2PRNA 3LK3A 5D5DA 1G90A 2XMXA 3LK3B 4KR4A 3T20A 2ZLDA 3AA6B 5DL8A 2YPVA 4AFKA 1THQA 4E1SA 4O3YA 1Q9GA 4AKMA 3VY8X 3UPGA 3SZDA 3DA3A 1H6S1 4FRTA 3LK2A 3T0SA 2KXPA 2XE3A 3RBHA 3G7GA 3POXA 1BXWA 1GFMA 2KXPB 3A2SX 4AKRA 2XTQA 1YS5A 7PRNA 3AAAB 3SY7A 2Y0LA 4FUVA 4LSEA 4AUIA 2N2LA 3VE2A 3AAEB 3AA0A 1HXUA 1OSMA 4PUXA 3HOLA 4FMSA 5G26A 5PRNA 2LHFA 3AA7A 3VZUX 4G75A 1OPFA 2M06A 4E1TA 5JDPA 4FZNA 1PHOA 1QJ8A 3O0EA 2M07A 2XE1A 3VZTX 4AYDC 4D64A 2J1NA 3LK42 1ZHTA 5IYUA 1QJPA 2MHLA 3HW9A 5EE2A 3AAAA 4KR8A 1ZHWA 1PRNA 3SYSA 2W80C 2GE4A 1HXXA 3K19A 4RLBA 4B61A 2K0LA 5GV0A 1Q9FA 4Z3TA 4LSIA 4FSOA 5DL5A 2ZFGA 2Y7SA 3TZGA 1ZHZA 3VE1A 3AA1A 3HWBA 3DA4A 4FZLA 2XE2A 3V8UA 8PRNA 4GHBA 1MM5A 1ORMA 1P4TA 4FT6A 3SYBA 5ADXK 4GCSA 1E54A 2F1VA 4N59A 1BH3A 3UU2A 2Y2XA 5AFUL 3PORA 3WI4A 3VZWX 3KVDD 4N58A 5AFUK 2KDYA 3AA1B 4F4BA 4FOZA 3HOEA 4GCPA 4C69X 1HXTA 2JMMA 2K4TA 3SZVA 5ADXL 2Y0HA 4D5UA 2O4VA 3EMNX 1ZHYA 3FYXA 1GFQA 3POUA 3QRCA 2YNKA 4D65A 4O3ZA 2ERVA 2KZ7B 2OMFA 2PORA 4O4XA 2X27X 2N2MA 4JFBA 4O3XB 1IZNB 4JCHA 5DL7A 3VY9X 3C5OA 2XTRA 3GP6A 4XNKA 3PRNA 4FESA 5T5FA 4AYMC 2XE5A 4LSFA 4AKRB 2KC0A 2KZ7A 2FGQX 1MM4A 4LSHA 4RL9A 5DL6A 2LFUA 3LK41 4AYNA 1GFPA 4AZLA 3LK2B 3WI5A 3AA0B 4RJWA 3PQSA 3PQUA 4FZMA 4O3WA 4GF4A 2J4UP 4RJXA 1IZNA 3JTYA 3AA7B 4BUMX 3QRAA 4U9CA 4QQ1A 4FRXA 4RLCA 2QTKA 1BT9A 2XG6A 2ODJA 1QJ9A 3AAEA 3NSGA 3POQA 4GCQA 4KRAA 4O4UA 5FVNA 4AYID 3T24A 4FSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5O A;  2F1T A;  2N2L A;  3GP6 A;  4PUX A;  1MM5 A;  1ORM A;  2MNH A;  1P4T A;  2F1V A;  1G90 A;  2LHF A;  1MM4 A;  2M06 A;  1QJ8 A;  2M07 A;  1THQ A;  1Q9G A;  1QJP A;  2MHL A;  2JMM A;  2GE4 A;  3QRA A;  3G7G A;  1BXW A;  3QRC A;  2K0L A;  4RLC A;  2ERV A;  2X27 X;  1Q9F A;  1QJ9 A;  2N2M A; 
#chains in the Genus database with same CATH topology
 4XNL A;  3VZU X;  1MPF A;  5KAF O;  2F1T A;  2Y0K A;  3SY9 A;  4G76 A;  4O49 A;  4AUI A;  4AYE C;  3NJT A;  2MNH A;  6PRN A;  2IWW A;  2FGR A;  5H2F O;  1ZHX A;  1GFO A;  1GFN A;  2W81 C;  3AA6 A;  3UAQ A;  2PRN A;  3LK3 A;  5D5D A;  1G90 A;  3DWN A;  2JQY A;  2XMX A;  3LK3 B;  3PGR A;  4KR4 A;  3T20 A;  2ZLD A;  3AA6 B;  5DL8 A;  4IL6 O;  2YPV A;  5E79 O;  3DZM A;  4PR7 A;  5FVN A;  4AFK A;  1THQ A;  3JCU O;  4E1S A;  4O3Y A;  1Q9G A;  4AKM A;  3VY8 X;  3UPG A;  3SZD A;  3DA3 A;  1H6S 1;  4FRT A;  3LK2 A;  3T0S A;  2KXP A;  4FQE A;  2XE3 A;  5B5E O;  3RBH A;  3G7G A;  3POX A;  1BXW A;  3PGU A;  1GFM A;  2KXP B;  3A2S X;  4AKR A;  2XTQ A;  1YS5 A;  7PRN A;  3AAA B;  3SY7 A;  4CTD A;  2Y0L A;  4FUV A;  4LSE A;  2R89 A;  3BRY A;  2R4P A;  2N2L A;  3BRZ A;  3AAE B;  3AA0 A;  5G38 A;  3VE2 A;  1HXU A;  1OSM A;  4PUX A;  3HOL A;  5JDP A;  4FMS A;  5G26 A;  5PRN A;  2LHF A;  2F1C X;  2R8A A;  3AA7 A;  1OPF A;  2M06 A;  3PF1 A;  4G75 A;  2AXT O;  4FZN A;  1PHO A;  1QJ8 A;  4E1T A;  3O0E A;  2M07 A;  2XE1 A;  3VZT X;  4AYD C;  4D64 A;  2J1N A;  4C4V B;  3LK4 2;  1ZHT A;  5IYU A;  1QJP A;  2MHL A;  3BS0 A;  3HW9 A;  5EE2 A;  3AAA A;  4KR8 A;  1ZHW A;  5G39 A;  5GTH O;  1PRN A;  3SYS A;  2W80 C;  2GE4 A;  1HXX A;  3K19 A;  4RLB A;  4B61 A;  2K0L A;  4K3C A;  5B66 O;  5GV0 A;  1Q9F A;  3A0B O;  5GTI O;  4Z3T A;  4LSI A;  1T1L A;  4FSO A;  4N75 A;  3DWO X;  5DL5 A;  2Y7S A;  2ZFG A;  5TIS O;  3TZG A;  1ZHZ A;  3VE1 A;  3AA1 A;  3HWB A;  3DA4 A;  2WJQ A;  2XE2 A;  4FZL A;  3V8U A;  8PRN A;  4GHB A;  1MM5 A;  1ORM A;  1P4T A;  4FT6 A;  3SYB A;  3WU2 O;  5ADX K;  4GCS A;  1E54 A;  2F1V A;  4N59 A;  1BH3 A;  3UU2 A;  2Y2X A;  5AFU L;  3POR A;  3WI4 A;  3VZW X;  3KVD D;  4N58 A;  5AFU K;  2KDY A;  2WVP A;  3AA1 B;  4F4B A;  5KAI O;  4FOZ A;  3HOE A;  4GCP A;  4C69 X;  1HXT A;  2R88 A;  2JMM A;  2K4T A;  3SZV A;  5ADX L;  2Y0H A;  4D5U A;  2O4V A;  3EMN X;  1ZHY A;  3FYX A;  1GFQ A;  3POU A;  3QRC A;  2YNK A;  4D65 A;  4O3Z A;  2ERV A;  2KZ7 B;  2OMF A;  2POR A;  4O4X A;  2X27 X;  3A0H O;  4UB6 O;  2N2M A;  4JFB A;  4O3X B;  2X9K A;  1IZN B;  4JCH A;  4C00 A;  5DL7 A;  3VY9 X;  3C5O A;  2XTR A;  3GP6 A;  2R4L A;  4XNK A;  3PRN A;  4FES A;  2WJR A;  5T5F A;  4AYM C;  2XE5 A;  4LSF A;  4AKR B;  2KC0 A;  2KZ7 A;  2FGQ X;  1MM4 A;  3PGS A;  2R4O A;  4LSH A;  3KZI O;  4N74 A;  2LFU A;  3LK4 1;  4RL9 A;  5DL6 A;  4AYN A;  1GFP A;  4AZL A;  4PJ0 O;  3LK2 B;  3WI5 A;  3AA0 B;  4RJW A;  3PQS A;  4C4V A;  3PQU A;  4FZM A;  4O3W A;  4GF4 A;  2J4U P;  4RJX A;  1IZN A;  4K3B A;  3JTY A;  3AA7 B;  4BUM X;  3QRA A;  4UB8 O;  4U9C A;  4QQ1 A;  4FRX A;  4RLC A;  2QTK A;  1BT9 A;  2R4N A;  5G3A A;  1T16 A;  1S5L O;  2XG6 A;  2ODJ A;  1QJ9 A;  3AAE A;  3NSG A;  2IWV A;  3POQ A;  4GCQ A;  4KRA A;  4O4U A;  4AYI D;  3T24 A;  4FSP A; 
#chains in the Genus database with same CATH homology
 4XNL A;  1MPF A;  3SY9 A;  2F1T A;  2Y0K A;  4G76 A;  4O49 A;  4AYE C;  6PRN A;  2MNH A;  2FGR A;  1ZHX A;  1GFO A;  1GFN A;  2W81 C;  3AA6 A;  3UAQ A;  2PRN A;  3LK3 A;  5D5D A;  1G90 A;  2XMX A;  3LK3 B;  4KR4 A;  3T20 A;  2ZLD A;  3AA6 B;  5DL8 A;  2YPV A;  4AFK A;  1THQ A;  4E1S A;  4O3Y A;  1Q9G A;  4AKM A;  3VY8 X;  3UPG A;  3SZD A;  3DA3 A;  1H6S 1;  4FRT A;  3LK2 A;  3T0S A;  2KXP A;  2XE3 A;  3RBH A;  3G7G A;  3POX A;  1BXW A;  1GFM A;  2KXP B;  3A2S X;  4AKR A;  2XTQ A;  1YS5 A;  7PRN A;  3AAA B;  3SY7 A;  2Y0L A;  4FUV A;  4LSE A;  4AUI A;  2N2L A;  3VE2 A;  3AAE B;  3AA0 A;  1HXU A;  1OSM A;  4PUX A;  3HOL A;  4FMS A;  5G26 A;  5PRN A;  2LHF A;  3AA7 A;  3VZU X;  4G75 A;  1OPF A;  2M06 A;  4E1T A;  5JDP A;  4FZN A;  1PHO A;  1QJ8 A;  3O0E A;  2M07 A;  2XE1 A;  3VZT X;  4AYD C;  4D64 A;  2J1N A;  3LK4 2;  1ZHT A;  5IYU A;  1QJP A;  2MHL A;  3HW9 A;  5EE2 A;  3AAA A;  4KR8 A;  1ZHW A;  1PRN A;  3SYS A;  2W80 C;  2GE4 A;  1HXX A;  3K19 A;  4RLB A;  4B61 A;  2K0L A;  5GV0 A;  1Q9F A;  4Z3T A;  4LSI A;  4FSO A;  5DL5 A;  2ZFG A;  2Y7S A;  3TZG A;  1ZHZ A;  3VE1 A;  3AA1 A;  3HWB A;  3DA4 A;  4FZL A;  2XE2 A;  3V8U A;  8PRN A;  4GHB A;  1MM5 A;  1ORM A;  1P4T A;  4FT6 A;  3SYB A;  5ADX K;  4GCS A;  1E54 A;  2F1V A;  4N59 A;  1BH3 A;  3UU2 A;  2Y2X A;  5AFU L;  3POR A;  3WI4 A;  3VZW X;  3KVD D;  4N58 A;  5AFU K;  2KDY A;  3AA1 B;  4F4B A;  4FOZ A;  3HOE A;  4GCP A;  4C69 X;  1HXT A;  2JMM A;  2K4T A;  3SZV A;  5ADX L;  2Y0H A;  4D5U A;  2O4V A;  3EMN X;  1ZHY A;  3FYX A;  1GFQ A;  3POU A;  3QRC A;  2YNK A;  4D65 A;  4O3Z A;  2ERV A;  2KZ7 B;  2OMF A;  2POR A;  4O4X A;  2X27 X;  2N2M A;  4JFB A;  4O3X B;  1IZN B;  4JCH A;  5DL7 A;  3VY9 X;  3C5O A;  2XTR A;  3GP6 A;  4XNK A;  3PRN A;  4FES A;  5T5F A;  4AYM C;  2XE5 A;  4LSF A;  4AKR B;  2KC0 A;  2KZ7 A;  2FGQ X;  1MM4 A;  4LSH A;  4RL9 A;  5DL6 A;  2LFU A;  3LK4 1;  4AYN A;  1GFP A;  4AZL A;  3LK2 B;  3WI5 A;  3AA0 B;  4RJW A;  3PQS A;  3PQU A;  4FZM A;  4O3W A;  4GF4 A;  2J4U P;  4RJX A;  1IZN A;  3JTY A;  3AA7 B;  4BUM X;  3QRA A;  4U9C A;  4QQ1 A;  4FRX A;  4RLC A;  2QTK A;  1BT9 A;  2XG6 A;  2ODJ A;  1QJ9 A;  3AAE A;  3NSG A;  3POQ A;  4GCQ A;  4KRA A;  4O4U A;  5FVN A;  4AYI D;  3T24 A;  4FSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...