1QJ8A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
b'ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj8A00
3QRCA 2M07A 2LHFA 2K0LA 1MM4A 1G90A 4PUXA 2F1TA 1Q9GA 3GP6A 1Q9FA 3G7GA 2JMMA 1BXWA 2MNHA 1THQA 2N2LA 1QJ8A 1P4TA 1MM5A 2N2MA 3QRAA 4RLCA 2X27X 2F1VA 2GE4A 2ERVA 2M06A 1ORMA 1QJ9A 2MHLA 1QJPA 3C5OA
chains in the Genus database with same CATH superfamily
2Y2XA 2ODJA 2YPVA 3KZIO 2FGRA 4K3BA 4AKRB 3LK2B 3AAAA 3SZDA 3T0SA 3AAEB 5G3AA 4PUXA 2KZ7B 4N74A 5GV0A 3UPGA 5DL5A 2OMFA 5G26A 4UB6O 4KR4A 4E1TA 5TISO 1H6S1 1IZNA 5DL7A 2IWWA 5B5EO 2XG6A 2XE3A 4KR8A 1BXWA 4FT6A 3HOEA 5JDPA 1MM5A 1P4TA 3QRAA 4FRTA 2R89A 2WJQA 3A2SX 1S5LO 2XE2A 3AA1A 4FSPA 4XNLA 4Z3TA 4F4BA 3WI4A 2XE1A 5E79O 4D65A 2GE4A 4K3CA 3PRNA 4AUIA 1T1LA 2Y0HA 3BS0A 4D64A 2R88A 4AYMC 2KDYA 3A0BO 3PF1A 2JQYA 3KVDD 3LK42 3T24A 1OSMA 2X9KA 3VZTX 4C00A 5KAFO 4FZLA 4UB8O 2R8AA 3AA0A 3V8UA 2F1CX 3A0HO 3PQSA 3TZGA 2R4PA 4FESA 3AA1B 4D5UA 1GFQA 2F1TA 3GP6A 4FUVA 4QQ1A 3WU2O 4G76A 2LFUA 4BUMX 4C4VB 3POXA 3T20A 4O3ZA 3PGUA 1PRNA 3VY8X 1GFNA 2AXTO 3K19A 2ZLDA 2XE5A 2Y0LA 5G39A 6PRNA 2N2MA 2PORA 3SYSA 1GFOA 5PRNA 4AYID 1ZHTA 2J4UP 3LK41 4O3WA 4FRXA 3HWBA 1E54A 5FVNA 4FSOA 3AA7A 4AFKA 3AAAB 4U9CA 3DWNA 5AFUL 4CTDA 3RBHA 1PHOA 4N58A 3O0EA 3AA6A 2WVPA 3LK3A 3WI5A 2XMXA 1ZHYA 1T16A 4FMSA 3SYBA 2M07A 1HXTA 5B66O 1HXUA 1IZNB 2K0LA 4FQEA 5DL8A 4AYDC 7PRNA 5GTIO 2IWVA 2XTQA 4JCHA 3JTYA 4AZLA 3DA3A 3AA7B 4O3YA 1ZHXA 1GFMA 3SY9A 2W81C 2XTRA 2JMMA 2KC0A 4LSFA 3UAQA 1GFPA 2MNHA 3PQUA 3AAEA 3PORA 1QJ8A 4AKMA 4IL6O 2KXPA 5EE2A 2R4NA 2R4OA 2KZ7A 5AFUK 5H2FO 3JCUO 1BH3A 4N75A 3AA0B 4O4XA 8PRNA 4AYEC 3FYXA 2X27X 2ERVA 3DZMA 4G75A 2M06A 3UU2A 1QJ9A 5ADXL 1YS5A 2W80C 5DL6A 3VY9X 4GF4A 5KAIO 4RLBA 3QRCA 1ZHZA 1OPFA 2LHFA 4GCQA 2PRNA 4LSEA 4RJXA 2QTKA 2J1NA 3PGSA 4FZMA 3NSGA 2KXPB 4GHBA 4LSHA 4PR7A 5G38A 4AYNA 3POQA 1MM4A 4C69X 5IYUA 1G90A 3VZUX 1Q9GA 3PGRA 5T5FA 3HW9A 3EMNX 2K4TA 4LSIA 2ZFGA 4XNKA 3BRZA 1Q9FA 2FGQX 3G7GA 4GCSA 4KRAA 2Y7SA 1MPFA 1HXXA 2WJRA 3DA4A 3SZVA 4AKRA 1THQA 3LK2A 2N2LA 2Y0KA 4GCPA 5ADXK 3DWOX 3AA6B 4RLCA 4O4UA 3SY7A 3VE1A 4C4VA 3LK3B 3VZWX 4RL9A 4E1SA 4PJ0O 4FZNA 1ZHWA 3BRYA 3POUA 2F1VA 3NJTA 4N59A 1ORMA 4O3XB 5D5DA 4B61A 2MHLA 3HOLA 3VE2A 5GTHO 1QJPA 1BT9A 4FOZA 4JFBA 2YNKA 4O49A 2O4VA 3C5OA 2R4LA 4RJWA
chains in the Genus database with same CATH topology
2Y2XA 2ODJA 2YPVA 2FGRA 4AKRB 3LK2B 3AAAA 3SZDA 3T0SA 3AAEB 4PUXA 2KZ7B 5GV0A 2OMFA 5G26A 4KR4A 4E1TA 1H6S1 1IZNA 5DL7A 3UPGA 2XG6A 2XE3A 4KR8A 1BXWA 4FT6A 3HOEA 5JDPA 1MM5A 1P4TA 3QRAA 4FRTA 3A2SX 4FSPA 3AA1A 2XE2A 4XNLA 5DL5A 4Z3TA 4F4BA 3WI4A 2XE1A 4D65A 2GE4A 4AUIA 3PRNA 2Y0HA 4D64A 4AYMC 2KDYA 3KVDD 3LK42 3T24A 1OSMA 3VZTX 4FZLA 3AA0A 3V8UA 3PQSA 3TZGA 4FESA 3AA1B 4D5UA 1GFQA 2F1TA 3GP6A 4FUVA 4QQ1A 3T20A 4G76A 2LFUA 4BUMX 3POXA 4O3ZA 3VY8X 1PRNA 1GFNA 3K19A 2ZLDA 2XE5A 2Y0LA 6PRNA 2N2MA 2PORA 3SYSA 1GFOA 5PRNA 4AYID 1ZHTA 2J4UP 3LK41 4O3WA 4FRXA 3HWBA 1E54A 5FVNA 4FSOA 3AA7A 4AFKA 3AAAB 4U9CA 5AFUL 3RBHA 1PHOA 4N58A 3O0EA 3AA6A 3LK3A 3WI5A 2XMXA 1ZHYA 4FMSA 3SYBA 2M07A 1HXTA 1HXUA 1IZNB 2K0LA 5DL8A 4AYDC 7PRNA 2XTQA 4JCHA 3JTYA 4AZLA 3DA3A 3AA7B 4O3YA 1ZHXA 1GFMA 3SY9A 2W81C 2XTRA 2JMMA 2KC0A 4LSFA 3UAQA 1GFPA 2MNHA 3PQUA 3AAEA 3PORA 1QJ8A 4AKMA 5AFUK 2KXPA 5EE2A 2KZ7A 1BH3A 8PRNA 3AA0B 4O4XA 4AYEC 3FYXA 2X27X 2ERVA 4G75A 2M06A 3UU2A 1QJ9A 5ADXL 1YS5A 2W80C 5DL6A 3VY9X 4GF4A 4RLBA 3QRCA 1ZHZA 1OPFA 2LHFA 4GCQA 2PRNA 4LSEA 4RJXA 2QTKA 2J1NA 4LSHA 4FZMA 3NSGA 2KXPB 4GHBA 4AYNA 5IYUA 3POQA 1MM4A 4C69X 1G90A 3VZUX 1Q9GA 5T5FA 3HW9A 3EMNX 2K4TA 4LSIA 2ZFGA 4XNKA 1Q9FA 2FGQX 3G7GA 4GCSA 4KRAA 2Y7SA 1MPFA 1HXXA 3DA4A 3SZVA 4AKRA 1THQA 3LK2A 2N2LA 2Y0KA 4GCPA 5ADXK 3SY7A 3AA6B 4RLCA 4O4UA 3VE1A 3LK3B 3VZWX 4RL9A 4E1SA 4FZNA 1ZHWA 3POUA 2F1VA 4N59A 1ORMA 4O3XB 5D5DA 4B61A 2MHLA 3HOLA 3VE2A 1QJPA 1BT9A 4FOZA 4JFBA 2YNKA 4O49A 2O4VA 3C5OA 4RJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRC A;  2M07 A;  2LHF A;  2K0L A;  1MM4 A;  1G90 A;  4PUX A;  2F1T A;  1Q9G A;  3GP6 A;  1Q9F A;  3G7G A;  2JMM A;  1BXW A;  2MNH A;  1THQ A;  2N2L A;  1QJ8 A;  1P4T A;  1MM5 A;  2N2M A;  3QRA A;  4RLC A;  2X27 X;  2F1V A;  2GE4 A;  2ERV A;  2M06 A;  1ORM A;  1QJ9 A;  2MHL A;  1QJP A;  3C5O A; 
#chains in the Genus database with same CATH topology
 2Y2X A;  2ODJ A;  2YPV A;  3KZI O;  2FGR A;  4K3B A;  4AKR B;  3LK2 B;  3AAA A;  3SZD A;  3T0S A;  3AAE B;  5G3A A;  4PUX A;  2KZ7 B;  4N74 A;  5GV0 A;  3UPG A;  5DL5 A;  2OMF A;  5G26 A;  4UB6 O;  4KR4 A;  4E1T A;  5TIS O;  1H6S 1;  1IZN A;  5DL7 A;  2IWW A;  5B5E O;  2XG6 A;  2XE3 A;  4KR8 A;  1BXW A;  4FT6 A;  3HOE A;  5JDP A;  1MM5 A;  1P4T A;  3QRA A;  4FRT A;  2R89 A;  2WJQ A;  3A2S X;  1S5L O;  2XE2 A;  3AA1 A;  4FSP A;  4XNL A;  4Z3T A;  4F4B A;  3WI4 A;  2XE1 A;  5E79 O;  4D65 A;  2GE4 A;  4K3C A;  3PRN A;  4AUI A;  1T1L A;  2Y0H A;  3BS0 A;  4D64 A;  2R88 A;  4AYM C;  2KDY A;  3A0B O;  3PF1 A;  2JQY A;  3KVD D;  3LK4 2;  3T24 A;  1OSM A;  2X9K A;  3VZT X;  4C00 A;  5KAF O;  4FZL A;  4UB8 O;  2R8A A;  3AA0 A;  3V8U A;  2F1C X;  3A0H O;  3PQS A;  3TZG A;  2R4P A;  4FES A;  3AA1 B;  4D5U A;  1GFQ A;  2F1T A;  3GP6 A;  4FUV A;  4QQ1 A;  3WU2 O;  4G76 A;  2LFU A;  4BUM X;  4C4V B;  3POX A;  3T20 A;  4O3Z A;  3PGU A;  1PRN A;  3VY8 X;  1GFN A;  2AXT O;  3K19 A;  2ZLD A;  2XE5 A;  2Y0L A;  5G39 A;  6PRN A;  2N2M A;  2POR A;  3SYS A;  1GFO A;  5PRN A;  4AYI D;  1ZHT A;  2J4U P;  3LK4 1;  4O3W A;  4FRX A;  3HWB A;  1E54 A;  5FVN A;  4FSO A;  3AA7 A;  4AFK A;  3AAA B;  4U9C A;  3DWN A;  5AFU L;  4CTD A;  3RBH A;  1PHO A;  4N58 A;  3O0E A;  3AA6 A;  2WVP A;  3LK3 A;  3WI5 A;  2XMX A;  1ZHY A;  1T16 A;  4FMS A;  3SYB A;  2M07 A;  1HXT A;  5B66 O;  1HXU A;  1IZN B;  2K0L A;  4FQE A;  5DL8 A;  4AYD C;  7PRN A;  5GTI O;  2IWV A;  2XTQ A;  4JCH A;  3JTY A;  4AZL A;  3DA3 A;  3AA7 B;  4O3Y A;  1ZHX A;  1GFM A;  3SY9 A;  2W81 C;  2XTR A;  2JMM A;  2KC0 A;  4LSF A;  3UAQ A;  1GFP A;  2MNH A;  3PQU A;  3AAE A;  3POR A;  1QJ8 A;  4AKM A;  4IL6 O;  2KXP A;  5EE2 A;  2R4N A;  2R4O A;  2KZ7 A;  5AFU K;  5H2F O;  3JCU O;  1BH3 A;  4N75 A;  3AA0 B;  4O4X A;  8PRN A;  4AYE C;  3FYX A;  2X27 X;  2ERV A;  3DZM A;  4G75 A;  2M06 A;  3UU2 A;  1QJ9 A;  5ADX L;  1YS5 A;  2W80 C;  5DL6 A;  3VY9 X;  4GF4 A;  5KAI O;  4RLB A;  3QRC A;  1ZHZ A;  1OPF A;  2LHF A;  4GCQ A;  2PRN A;  4LSE A;  4RJX A;  2QTK A;  2J1N A;  3PGS A;  4FZM A;  3NSG A;  2KXP B;  4GHB A;  4LSH A;  4PR7 A;  5G38 A;  4AYN A;  3POQ A;  1MM4 A;  4C69 X;  5IYU A;  1G90 A;  3VZU X;  1Q9G A;  3PGR A;  5T5F A;  3HW9 A;  3EMN X;  2K4T A;  4LSI A;  2ZFG A;  4XNK A;  3BRZ A;  1Q9F A;  2FGQ X;  3G7G A;  4GCS A;  4KRA A;  2Y7S A;  1MPF A;  1HXX A;  2WJR A;  3DA4 A;  3SZV A;  4AKR A;  1THQ A;  3LK2 A;  2N2L A;  2Y0K A;  4GCP A;  5ADX K;  3DWO X;  3AA6 B;  4RLC A;  4O4U A;  3SY7 A;  3VE1 A;  4C4V A;  3LK3 B;  3VZW X;  4RL9 A;  4E1S A;  4PJ0 O;  4FZN A;  1ZHW A;  3BRY A;  3POU A;  2F1V A;  3NJT A;  4N59 A;  1ORM A;  4O3X B;  5D5D A;  4B61 A;  2MHL A;  3HOL A;  3VE2 A;  5GTH O;  1QJP A;  1BT9 A;  4FOZ A;  4JFB A;  2YNK A;  4O49 A;  2O4V A;  3C5O A;  2R4L A;  4RJW A; 
#chains in the Genus database with same CATH homology
 2Y2X A;  2ODJ A;  2YPV A;  2FGR A;  4AKR B;  3LK2 B;  3AAA A;  3SZD A;  3T0S A;  3AAE B;  4PUX A;  2KZ7 B;  5GV0 A;  2OMF A;  5G26 A;  4KR4 A;  4E1T A;  1H6S 1;  1IZN A;  5DL7 A;  3UPG A;  2XG6 A;  2XE3 A;  4KR8 A;  1BXW A;  4FT6 A;  3HOE A;  5JDP A;  1MM5 A;  1P4T A;  3QRA A;  4FRT A;  3A2S X;  4FSP A;  3AA1 A;  2XE2 A;  4XNL A;  5DL5 A;  4Z3T A;  4F4B A;  3WI4 A;  2XE1 A;  4D65 A;  2GE4 A;  4AUI A;  3PRN A;  2Y0H A;  4D64 A;  4AYM C;  2KDY A;  3KVD D;  3LK4 2;  3T24 A;  1OSM A;  3VZT X;  4FZL A;  3AA0 A;  3V8U A;  3PQS A;  3TZG A;  4FES A;  3AA1 B;  4D5U A;  1GFQ A;  2F1T A;  3GP6 A;  4FUV A;  4QQ1 A;  3T20 A;  4G76 A;  2LFU A;  4BUM X;  3POX A;  4O3Z A;  3VY8 X;  1PRN A;  1GFN A;  3K19 A;  2ZLD A;  2XE5 A;  2Y0L A;  6PRN A;  2N2M A;  2POR A;  3SYS A;  1GFO A;  5PRN A;  4AYI D;  1ZHT A;  2J4U P;  3LK4 1;  4O3W A;  4FRX A;  3HWB A;  1E54 A;  5FVN A;  4FSO A;  3AA7 A;  4AFK A;  3AAA B;  4U9C A;  5AFU L;  3RBH A;  1PHO A;  4N58 A;  3O0E A;  3AA6 A;  3LK3 A;  3WI5 A;  2XMX A;  1ZHY A;  4FMS A;  3SYB A;  2M07 A;  1HXT A;  1HXU A;  1IZN B;  2K0L A;  5DL8 A;  4AYD C;  7PRN A;  2XTQ A;  4JCH A;  3JTY A;  4AZL A;  3DA3 A;  3AA7 B;  4O3Y A;  1ZHX A;  1GFM A;  3SY9 A;  2W81 C;  2XTR A;  2JMM A;  2KC0 A;  4LSF A;  3UAQ A;  1GFP A;  2MNH A;  3PQU A;  3AAE A;  3POR A;  1QJ8 A;  4AKM A;  5AFU K;  2KXP A;  5EE2 A;  2KZ7 A;  1BH3 A;  8PRN A;  3AA0 B;  4O4X A;  4AYE C;  3FYX A;  2X27 X;  2ERV A;  4G75 A;  2M06 A;  3UU2 A;  1QJ9 A;  5ADX L;  1YS5 A;  2W80 C;  5DL6 A;  3VY9 X;  4GF4 A;  4RLB A;  3QRC A;  1ZHZ A;  1OPF A;  2LHF A;  4GCQ A;  2PRN A;  4LSE A;  4RJX A;  2QTK A;  2J1N A;  4LSH A;  4FZM A;  3NSG A;  2KXP B;  4GHB A;  4AYN A;  5IYU A;  3POQ A;  1MM4 A;  4C69 X;  1G90 A;  3VZU X;  1Q9G A;  5T5F A;  3HW9 A;  3EMN X;  2K4T A;  4LSI A;  2ZFG A;  4XNK A;  1Q9F A;  2FGQ X;  3G7G A;  4GCS A;  4KRA A;  2Y7S A;  1MPF A;  1HXX A;  3DA4 A;  3SZV A;  4AKR A;  1THQ A;  3LK2 A;  2N2L A;  2Y0K A;  4GCP A;  5ADX K;  3SY7 A;  3AA6 B;  4RLC A;  4O4U A;  3VE1 A;  3LK3 B;  3VZW X;  4RL9 A;  4E1S A;  4FZN A;  1ZHW A;  3POU A;  2F1V A;  4N59 A;  1ORM A;  4O3X B;  5D5D A;  4B61 A;  2MHL A;  3HOL A;  3VE2 A;  1QJP A;  1BT9 A;  4FOZ A;  4JFB A;  2YNK A;  4O49 A;  2O4V A;  3C5O A;  4RJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...