1QJ8A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN X
total genus 42
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj8A00
2F1VA 2GE4A 3GP6A 1P4TA 1BXWA 2JMMA 3C5OA 2N2LA 1QJ9A 1ORMA 1Q9FA 2MHLA 2LHFA 2MNHA 3QRCA 4PUXA 1THQA 4RLCA 3G7GA 2M07A 2F1TA 1Q9GA 1MM5A 2K0LA 2N2MA 3QRAA 1MM4A 1G90A 2M06A 2X27X 1QJPA 1QJ8A 2ERVA
chains in the Genus database with same CATH superfamily
2XE3A 2F1CX 3AAAB 2K4TA 3VZTX 3DA3A 2XTQA 3DA4A 4GF4A 4XNLA 3PORA 5IYUA 4FESA 3VE1A 2JMMA 5DL8A 4AYEC 2XMXA 3A2SX 2QTKA 2ZFGA 4JFBA 1QJ9A 3FYXA 1ORMA 4GHBA 4N74A 5TISO 4AKRB 4C4VA 8PRNA 5G3AA 2KZ7B 4AYID 5G26A 5B66O 1PHOA 3LK2B 4FZLA 2IWWA 2J1NA 1Q9FA 1GFNA 5KAFO 2MNHA 1THQA 3DWNA 2XG6A 3LK42 3VZUX 4KRAA 3T24A 2X9KA 4FSPA 2R4PA 2J4UP 3LK3B 2O4VA 3SY9A 3AAAA 4RJWA 1HXUA 2N2MA 2Y0LA 4FZMA 4F4BA 5B5EO 3T20A 3HW9A 2KC0A 1E54A 3AA7B 1G90A 3EMNX 2KXPB 2ERVA 1QJ8A 5FVNA 2F1VA 1ZHWA 4GCPA 1YS5A 4GCQA 3AA1B 3KVDD 3GP6A 3DZMA 4O3ZA 4AZLA 3POUA 6PRNA 3AA1A 2FGRA 2W80C 4FOZA 4UB8O 1MPFA 2YNKA 2XE2A 4CTDA 4AKMA 3AA6B 3O0EA 2FGQX 2ZLDA 4AUIA 3UPGA 3K19A 4JCHA 5EE2A 3SYBA 2MHLA 5DL7A 4RLBA 3AA0B 4RLCA 3PGRA 1OPFA 4FQEA 2F1TA 2R4NA 1GFOA 2Y2XA 4G75A 2WJRA 4AFKA 2LFUA 3PF1A 3V8UA 4O3YA 5T5FA 3TZGA 4K3BA 2WJQA 2IWVA 2M06A 3POQA 1IZNB 2X27X 2XTRA 4LSFA 1S5LO 4FSOA 2Y7SA 4PR7A 2OMFA 2GE4A 1IZNA 4FRTA 4O4UA 4FZNA 2Y0KA 3RBHA 3WI4A 4C4VB 3HOEA 2KZ7A 4N75A 3PQSA 1P4TA 3AA6A 5G39A 5GTIO 1BXWA 3VE2A 4N59A 2W81C 3SYSA 3AA7A 3BRZA 5DL6A 2R4OA 5PRNA 1ZHZA 4O4XA 5KAIO 4O49A 3AAEB 4LSEA 1T1LA 4FUVA 5AFUL 4D5UA 4RJXA 2JQYA 2LHFA 3JTYA 4PUXA 4C69X 5AFUK 4K3CA 4N58A 1GFQA 1H6S1 2PRNA 3A0HO 3SZVA 4AKRA 5JDPA 2Y0HA 4KR8A 2WVPA 3UAQA 3PGSA 1PRNA 4FT6A 5G38A 1MM5A 3BRYA 1HXXA 2K0LA 4IL6O 2AXTO 4PJ0O 3QRAA 3NSGA 4U9CA 1MM4A 3VY8X 4E1TA 3POXA 2XE1A 3C5OA 3PGUA 5ADXK 3UU2A 5GV0A 3SY7A 4C00A 3NJTA 3LK2A 3LK3A 4QQ1A 1OSMA 1ZHYA 3JCUO 2R89A 4G76A 1BH3A 3WI5A 4LSHA 4B61A 4AYDC 5D5DA 2YPVA 4BUMX 3WU2O 2N2LA 3AA0A 5DL5A 4FRXA 2R8AA 5E79O 4UB6O 4E1SA 2PORA 4GCSA 4Z3TA 3A0BO 3HOLA 2R4LA 3VZWX 5H2FO 3LK41 3PQUA 1BT9A 1ZHTA 3DWOX 3QRCA 1HXTA 2KXPA 3VY9X 2R88A 5GTHO 4XNKA 3G7GA 4D65A 4O3WA 1GFPA 2M07A 4AYMC 1GFMA 4AYNA 4O3XB 1T16A 2KDYA 2XE5A 3HWBA 3KZIO 4LSIA 2ODJA 3AAEA 3SZDA 3BS0A 5ADXL 4RL9A 1ZHXA 3T0SA 4FMSA 4D64A 1QJPA 4KR4A 1Q9GA 3PRNA 7PRNA
chains in the Genus database with same CATH topology
2XE3A 3AAAB 3VZTX 2K4TA 3DA3A 2XTQA 3DA4A 4GF4A 4XNLA 3PORA 5IYUA 4FESA 3VE1A 2JMMA 5DL8A 4AYEC 2XMXA 3A2SX 2QTKA 2ZFGA 4JFBA 1QJ9A 3FYXA 1ORMA 4GHBA 4AKRB 8PRNA 2KZ7B 4AYID 5G26A 1PHOA 3LK2B 4FZLA 2J1NA 1Q9FA 1GFNA 2MNHA 1THQA 2XG6A 3LK42 3VZUX 4KRAA 3T24A 4FSPA 2J4UP 3LK3B 2O4VA 3SY9A 3AAAA 4RJWA 1HXUA 2N2MA 2Y0LA 4FZMA 4F4BA 3T20A 3HW9A 2KC0A 1E54A 3AA7B 1G90A 3EMNX 2KXPB 2ERVA 1QJ8A 5FVNA 2F1VA 1ZHWA 4GCPA 1YS5A 4GCQA 3AA1B 3KVDD 3GP6A 4AZLA 4O3ZA 3POUA 6PRNA 3AA1A 2FGRA 2W80C 4FOZA 1MPFA 2YNKA 2XE2A 4AKMA 3AA6B 3O0EA 2FGQX 2ZLDA 4AUIA 3UPGA 3K19A 4JCHA 5EE2A 3SYBA 2MHLA 5DL7A 4RLBA 3AA0B 4RLCA 1OPFA 2F1TA 1GFOA 2Y2XA 4G75A 4AFKA 2LFUA 3V8UA 4O3YA 5T5FA 3TZGA 3POQA 2M06A 4LSFA 2XTRA 2X27X 1IZNB 4FSOA 2Y7SA 2OMFA 2GE4A 1IZNA 4FRTA 4O4UA 4FZNA 2Y0KA 3RBHA 3WI4A 3HOEA 2KZ7A 3PQSA 1P4TA 3AA6A 3VE2A 1BXWA 4N59A 2W81C 3SYSA 3AA7A 5DL6A 5PRNA 1ZHZA 4O4XA 4O49A 3AAEB 4LSEA 4FUVA 5AFUL 4D5UA 4RJXA 2LHFA 3JTYA 4PUXA 4C69X 5AFUK 4N58A 1GFQA 1H6S1 2PRNA 4AKRA 3SZVA 5JDPA 2Y0HA 4KR8A 3UAQA 1PRNA 4FT6A 1MM5A 1HXXA 2K0LA 4U9CA 3VY8X 3QRAA 3NSGA 1MM4A 4E1TA 3POXA 2XE1A 3C5OA 5ADXK 3UU2A 5GV0A 3SY7A 3LK2A 3LK3A 4QQ1A 1OSMA 1ZHYA 4G76A 1BH3A 3WI5A 4LSHA 4B61A 4AYDC 5D5DA 2YPVA 4BUMX 2N2LA 3AA0A 5DL5A 4FRXA 4E1SA 2PORA 4GCSA 4Z3TA 3HOLA 3VZWX 3LK41 3PQUA 1BT9A 1ZHTA 3QRCA 1HXTA 2KXPA 3VY9X 4XNKA 3G7GA 4D65A 4O3WA 1GFPA 2M07A 4AYMC 1GFMA 4AYNA 4O3XB 2KDYA 2XE5A 3HWBA 4LSIA 2ODJA 3AAEA 3SZDA 5ADXL 4RL9A 1ZHXA 3T0SA 4FMSA 4D64A 1QJPA 4KR4A 1Q9GA 3PRNA 7PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1V A;  2GE4 A;  3GP6 A;  1P4T A;  1BXW A;  2JMM A;  3C5O A;  2N2L A;  1QJ9 A;  1ORM A;  1Q9F A;  2MHL A;  2LHF A;  2MNH A;  3QRC A;  4PUX A;  1THQ A;  4RLC A;  3G7G A;  2M07 A;  2F1T A;  1Q9G A;  1MM5 A;  2K0L A;  2N2M A;  3QRA A;  1MM4 A;  1G90 A;  2M06 A;  2X27 X;  1QJP A;  1QJ8 A;  2ERV A; 
#chains in the Genus database with same CATH topology
 2XE3 A;  2F1C X;  3AAA B;  2K4T A;  3VZT X;  3DA3 A;  2XTQ A;  3DA4 A;  4GF4 A;  4XNL A;  3POR A;  5IYU A;  4FES A;  3VE1 A;  2JMM A;  5DL8 A;  4AYE C;  2XMX A;  3A2S X;  2QTK A;  2ZFG A;  4JFB A;  1QJ9 A;  3FYX A;  1ORM A;  4GHB A;  4N74 A;  5TIS O;  4AKR B;  4C4V A;  8PRN A;  5G3A A;  2KZ7 B;  4AYI D;  5G26 A;  5B66 O;  1PHO A;  3LK2 B;  4FZL A;  2IWW A;  2J1N A;  1Q9F A;  1GFN A;  5KAF O;  2MNH A;  1THQ A;  3DWN A;  2XG6 A;  3LK4 2;  3VZU X;  4KRA A;  3T24 A;  2X9K A;  4FSP A;  2R4P A;  2J4U P;  3LK3 B;  2O4V A;  3SY9 A;  3AAA A;  4RJW A;  1HXU A;  2N2M A;  2Y0L A;  4FZM A;  4F4B A;  5B5E O;  3T20 A;  3HW9 A;  2KC0 A;  1E54 A;  3AA7 B;  1G90 A;  3EMN X;  2KXP B;  2ERV A;  1QJ8 A;  5FVN A;  2F1V A;  1ZHW A;  4GCP A;  1YS5 A;  4GCQ A;  3AA1 B;  3KVD D;  3GP6 A;  3DZM A;  4O3Z A;  4AZL A;  3POU A;  6PRN A;  3AA1 A;  2FGR A;  2W80 C;  4FOZ A;  4UB8 O;  1MPF A;  2YNK A;  2XE2 A;  4CTD A;  4AKM A;  3AA6 B;  3O0E A;  2FGQ X;  2ZLD A;  4AUI A;  3UPG A;  3K19 A;  4JCH A;  5EE2 A;  3SYB A;  2MHL A;  5DL7 A;  4RLB A;  3AA0 B;  4RLC A;  3PGR A;  1OPF A;  4FQE A;  2F1T A;  2R4N A;  1GFO A;  2Y2X A;  4G75 A;  2WJR A;  4AFK A;  2LFU A;  3PF1 A;  3V8U A;  4O3Y A;  5T5F A;  3TZG A;  4K3B A;  2WJQ A;  2IWV A;  2M06 A;  3POQ A;  1IZN B;  2X27 X;  2XTR A;  4LSF A;  1S5L O;  4FSO A;  2Y7S A;  4PR7 A;  2OMF A;  2GE4 A;  1IZN A;  4FRT A;  4O4U A;  4FZN A;  2Y0K A;  3RBH A;  3WI4 A;  4C4V B;  3HOE A;  2KZ7 A;  4N75 A;  3PQS A;  1P4T A;  3AA6 A;  5G39 A;  5GTI O;  1BXW A;  3VE2 A;  4N59 A;  2W81 C;  3SYS A;  3AA7 A;  3BRZ A;  5DL6 A;  2R4O A;  5PRN A;  1ZHZ A;  4O4X A;  5KAI O;  4O49 A;  3AAE B;  4LSE A;  1T1L A;  4FUV A;  5AFU L;  4D5U A;  4RJX A;  2JQY A;  2LHF A;  3JTY A;  4PUX A;  4C69 X;  5AFU K;  4K3C A;  4N58 A;  1GFQ A;  1H6S 1;  2PRN A;  3A0H O;  3SZV A;  4AKR A;  5JDP A;  2Y0H A;  4KR8 A;  2WVP A;  3UAQ A;  3PGS A;  1PRN A;  4FT6 A;  5G38 A;  1MM5 A;  3BRY A;  1HXX A;  2K0L A;  4IL6 O;  2AXT O;  4PJ0 O;  3QRA A;  3NSG A;  4U9C A;  1MM4 A;  3VY8 X;  4E1T A;  3POX A;  2XE1 A;  3C5O A;  3PGU A;  5ADX K;  3UU2 A;  5GV0 A;  3SY7 A;  4C00 A;  3NJT A;  3LK2 A;  3LK3 A;  4QQ1 A;  1OSM A;  1ZHY A;  3JCU O;  2R89 A;  4G76 A;  1BH3 A;  3WI5 A;  4LSH A;  4B61 A;  4AYD C;  5D5D A;  2YPV A;  4BUM X;  3WU2 O;  2N2L A;  3AA0 A;  5DL5 A;  4FRX A;  2R8A A;  5E79 O;  4UB6 O;  4E1S A;  2POR A;  4GCS A;  4Z3T A;  3A0B O;  3HOL A;  2R4L A;  3VZW X;  5H2F O;  3LK4 1;  3PQU A;  1BT9 A;  1ZHT A;  3DWO X;  3QRC A;  1HXT A;  2KXP A;  3VY9 X;  2R88 A;  5GTH O;  4XNK A;  3G7G A;  4D65 A;  4O3W A;  1GFP A;  2M07 A;  4AYM C;  1GFM A;  4AYN A;  4O3X B;  1T16 A;  2KDY A;  2XE5 A;  3HWB A;  3KZI O;  4LSI A;  2ODJ A;  3AAE A;  3SZD A;  3BS0 A;  5ADX L;  4RL9 A;  1ZHX A;  3T0S A;  4FMS A;  4D64 A;  1QJP A;  4KR4 A;  1Q9G A;  3PRN A;  7PRN A; 
#chains in the Genus database with same CATH homology
 2XE3 A;  3AAA B;  3VZT X;  2K4T A;  3DA3 A;  2XTQ A;  3DA4 A;  4GF4 A;  4XNL A;  3POR A;  5IYU A;  4FES A;  3VE1 A;  2JMM A;  5DL8 A;  4AYE C;  2XMX A;  3A2S X;  2QTK A;  2ZFG A;  4JFB A;  1QJ9 A;  3FYX A;  1ORM A;  4GHB A;  4AKR B;  8PRN A;  2KZ7 B;  4AYI D;  5G26 A;  1PHO A;  3LK2 B;  4FZL A;  2J1N A;  1Q9F A;  1GFN A;  2MNH A;  1THQ A;  2XG6 A;  3LK4 2;  3VZU X;  4KRA A;  3T24 A;  4FSP A;  2J4U P;  3LK3 B;  2O4V A;  3SY9 A;  3AAA A;  4RJW A;  1HXU A;  2N2M A;  2Y0L A;  4FZM A;  4F4B A;  3T20 A;  3HW9 A;  2KC0 A;  1E54 A;  3AA7 B;  1G90 A;  3EMN X;  2KXP B;  2ERV A;  1QJ8 A;  5FVN A;  2F1V A;  1ZHW A;  4GCP A;  1YS5 A;  4GCQ A;  3AA1 B;  3KVD D;  3GP6 A;  4AZL A;  4O3Z A;  3POU A;  6PRN A;  3AA1 A;  2FGR A;  2W80 C;  4FOZ A;  1MPF A;  2YNK A;  2XE2 A;  4AKM A;  3AA6 B;  3O0E A;  2FGQ X;  2ZLD A;  4AUI A;  3UPG A;  3K19 A;  4JCH A;  5EE2 A;  3SYB A;  2MHL A;  5DL7 A;  4RLB A;  3AA0 B;  4RLC A;  1OPF A;  2F1T A;  1GFO A;  2Y2X A;  4G75 A;  4AFK A;  2LFU A;  3V8U A;  4O3Y A;  5T5F A;  3TZG A;  3POQ A;  2M06 A;  4LSF A;  2XTR A;  2X27 X;  1IZN B;  4FSO A;  2Y7S A;  2OMF A;  2GE4 A;  1IZN A;  4FRT A;  4O4U A;  4FZN A;  2Y0K A;  3RBH A;  3WI4 A;  3HOE A;  2KZ7 A;  3PQS A;  1P4T A;  3AA6 A;  3VE2 A;  1BXW A;  4N59 A;  2W81 C;  3SYS A;  3AA7 A;  5DL6 A;  5PRN A;  1ZHZ A;  4O4X A;  4O49 A;  3AAE B;  4LSE A;  4FUV A;  5AFU L;  4D5U A;  4RJX A;  2LHF A;  3JTY A;  4PUX A;  4C69 X;  5AFU K;  4N58 A;  1GFQ A;  1H6S 1;  2PRN A;  4AKR A;  3SZV A;  5JDP A;  2Y0H A;  4KR8 A;  3UAQ A;  1PRN A;  4FT6 A;  1MM5 A;  1HXX A;  2K0L A;  4U9C A;  3VY8 X;  3QRA A;  3NSG A;  1MM4 A;  4E1T A;  3POX A;  2XE1 A;  3C5O A;  5ADX K;  3UU2 A;  5GV0 A;  3SY7 A;  3LK2 A;  3LK3 A;  4QQ1 A;  1OSM A;  1ZHY A;  4G76 A;  1BH3 A;  3WI5 A;  4LSH A;  4B61 A;  4AYD C;  5D5D A;  2YPV A;  4BUM X;  2N2L A;  3AA0 A;  5DL5 A;  4FRX A;  4E1S A;  2POR A;  4GCS A;  4Z3T A;  3HOL A;  3VZW X;  3LK4 1;  3PQU A;  1BT9 A;  1ZHT A;  3QRC A;  1HXT A;  2KXP A;  3VY9 X;  4XNK A;  3G7G A;  4D65 A;  4O3W A;  1GFP A;  2M07 A;  4AYM C;  1GFM A;  4AYN A;  4O3X B;  2KDY A;  2XE5 A;  3HWB A;  4LSI A;  2ODJ A;  3AAE A;  3SZD A;  5ADX L;  4RL9 A;  1ZHX A;  3T0S A;  4FMS A;  4D64 A;  1QJP A;  4KR4 A;  1Q9G A;  3PRN A;  7PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...