4D65A

Structure of porin omp-pst2 from p. stuartii; the asymmetric unit contains a dimer of trimers.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
343
structure length
343
Chain Sequence
AEVYNKDGNKLDVYGQIDVRHYFADAKSGEDGDDSRVRLGFKGDTQITDQLIGFGRFEWETSTNKAETSNDNQNRLAYAGLKFADYGSLDYGRNYGVIYDTNAWTDVLPLWGADTMDQEDTFMMGRNRNLLTYRNNNGFGYIDGLSFALQYQGKNGDQNKSTGSSALDNNGDGYGFSTAYELGWGLSIGGGYSNSSRTPSQNNIKTGATGKRAEAWNVGSKLELDELYLAAMYGQTLNTTRFGDDDAEAIANKTENLELVALYSFDFGLTPSIGYNQSKGKNLGNYGNKDLVKYIAVGASYDFNKNMAAVIDYKINLLKDNQFTDDYGINTDNVLGLGLIYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN 2
publication title Porin self-association enables cell-to-cell contact inProvidencia stuartiifloating communities.
pubmed doi rcsb
source organism Providencia stuartii
molecule tags Transport protein
total genus 104
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d65A00
4GCQA 3SYSA 2FGRA 3T0SA 2Y0KA 4AUIA 2O4VA 2XE2A 3T20A 3UU2A 2ODJA 2XE3A 3HW9A 3UPGA 3FYXA 3WI4A 4LSIA 2Y0LA 5DL8A 4D5UA 2FGQX 4RJXA 3SZDA 3SY9A 1BH3A 1GFPA 4KR4A 7PRNA 3POUA 3WI5A 2PORA 4FSOA 1OPFA 6PRNA 3A2SX 4C69X 1HXUA 2XE5A 4LSFA 3POXA 1GFMA 4KRAA 5FVNA 5DL5A 1GFQA 3PRNA 8PRNA 3T24A 3SYBA 1PRNA 4D65A 3K19A 1MPFA 5JDPA 1H6S1 2Y0HA 2XE1A 4FSPA 2J4UP 4GCPA 3VZUX 2XG6A 3SY7A 1PHOA 3SZVA 4FMSA 4BUMX 1BT9A 2K4TA 3O0EA 4LSEA 1OSMA 3JTYA 2PRNA 1GFNA 4FRTA 5DL7A 4RJWA 1GFOA 2QTKA 3VY9X 2ZLDA 3HWBA 3PORA 1HXTA 3VZWX 3EMNX 4D64A 4FT6A 5DL6A 2J1NA 4FOZA 3VZTX 4JFBA 2OMFA 2ZFGA 4FRXA 4GCSA 3NSGA 3POQA 1HXXA 5PRNA 3VY8X 4LSHA 1E54A 2Y2XA 4KR8A
chains in the Genus database with same CATH superfamily
4GCQA 1Q9GA 3BS0A 3DWOX 3PGSA 1THQA 4O49A 2FGRA 3SYSA 3T0SA 4K3BA 2Y0KA 4GF4A 4AYNA 5E79O 3AA0A 4AUIA 1G90A 2WJRA 2O4VA 2XE2A 5KAFO 3PGUA 4AYDC 3UU2A 4E1SA 3T20A 3C5OA 4AYEC 5H2FO 2ODJA 2XE3A 3AAAB 3HW9A 3TZGA 3PQUA 1T16A 3AA6A 3FYXA 4LSIA 2Y0LA 3WI4A 3UPGA 1S5LO 3BRYA 2KC0A 3QRAA 3AAAA 5DL8A 4D5UA 2YNKA 2FGQX 4XNKA 2R89A 3VE2A 2XTRA 4G76A 5G39A 4RJXA 3SZDA 4AKMA 2KZ7B 3A0HO 5ADXL 3PF1A 3SY9A 1BH3A 3PGRA 1GFPA 4FUVA 4KR4A 4AYID 4RLCA 4AYMC 3DZMA 4B61A 3POUA 5EE2A 3NJTA 3WI5A 5B66O 7PRNA 5GTHO 2PORA 2R4LA 4FSOA 3HOEA 2LHFA 2JQYA 4O4UA 2WJQA 5AFUL 3KVDD 1OPFA 2MNHA 4N58A 1QJ9A 6PRNA 3A0BO 2M07A 3A2SX 1ZHZA 4C69X 1HXUA 2R4NA 2XE5A 4PJ0O 1MM4A 4AFKA 2X27X 4LSFA 4C4VB 5GV0A 2F1VA 4UB6O 4AZLA 3POXA 3DA4A 1GFMA 2KDYA 1IZNB 4KRAA 4PR7A 4UB8O 4FQEA 4U9CA 5G38A 4G75A 4C4VA 5FVNA 1ZHWA 5DL5A 1GFQA 3PRNA 8PRNA 2WVPA 3T24A 3HOLA 3JCUO 1IZNA 5D5DA 3SYBA 2W80C 1PRNA 2R88A 4N59A 3G7GA 4D65A 3K19A 1MPFA 2KZ7A 2YPVA 1QJ8A 2LFUA 5T5FA 1H6S1 4Z3TA 2Y0HA 5TISO 2XE1A 3LK2B 2X9KA 4FSPA 3UAQA 2K0LA 2J4UP 4FESA 4GCPA 2F1TA 3LK3B 5ADXK 5G3AA 3VZUX 2XG6A 2F1CX 3LK42 3SY7A 3WU2O 3LK2A 1PHOA 4RLBA 2GE4A 5G26A 3RBHA 3LK3A 2R4PA 3SZVA 4GHBA 4FMSA 2Y7SA 4BUMX 4IL6O 3AAEB 1BT9A 2K4TA 3O0EA 4LSEA 1OSMA 4E1TA 5AFUK 2R4OA 4O3YA 2XMXA 3JTYA 2ERVA 2PRNA 4JCHA 4CTDA 4O3WA 1ZHXA 5GTIO 1GFNA 3KZIO 3AAEA 4QQ1A 4FRTA 4O3ZA 5JDPA 4AKRB 3PQSA 2AXTO 2N2LA 3DA3A 1YS5A 3V8UA 4F4BA 2R8AA 5DL7A 4RJWA 5B5EO 2XTQA 3AA6B 1GFOA 2QTKA 3VY9X 3AA7B 3BRZA 3AA1B 2ZLDA 4O3XB 4AKRA 3HWBA 1ZHTA 4FZLA 1QJPA 3PORA 4N75A 1HXTA 4O4XA 2JMMA 3VZWX 3EMNX 5KAIO 4D64A 4N74A 4FT6A 5DL6A 1T1LA 3AA7A 3AA1A 2M06A 1ORMA 2J1NA 3DWNA 4FOZA 4RL9A 3VZTX 4K3CA 1MM5A 2OMFA 2ZFGA 4JFBA 4FZMA 2KXPB 1P4TA 4FRXA 3VE1A 4GCSA 2IWWA 3NSGA 1ZHYA 3LK41 3POQA 4XNLA 1HXXA 5PRNA 2N2MA 3VY8X 4LSHA 1E54A 2KXPA 2W81C 1Q9FA 2MHLA 2IWVA 3QRCA 2Y2XA 3GP6A 4FZNA 3AA0B 1BXWA 4PUXA 4C00A 4KR8A 5IYUA
chains in the Genus database with same CATH topology
4GCQA 1Q9GA 4O49A 3SYSA 1THQA 2FGRA 3T0SA 4AYNA 2Y0KA 4GF4A 3AA0A 4AUIA 1G90A 2O4VA 2XE2A 4AYDC 3T20A 3UU2A 4E1SA 3C5OA 4AYEC 2ODJA 2XE3A 3AAAB 3HW9A 3TZGA 3PQUA 3AA6A 3FYXA 3WI4A 4LSIA 2Y0LA 3UPGA 2KC0A 3QRAA 3AAAA 5DL8A 4D5UA 2YNKA 2FGQX 4XNKA 3VE2A 2XTRA 4G76A 4RJXA 3SZDA 4AKMA 2KZ7B 5ADXL 3SY9A 1BH3A 4FUVA 1GFPA 4KR4A 4AYID 4RLCA 4AYMC 4B61A 3POUA 5EE2A 3WI5A 7PRNA 2PORA 4FSOA 3HOEA 2LHFA 4O4UA 5AFUL 3KVDD 1OPFA 2MNHA 4N58A 1QJ9A 6PRNA 2M07A 3A2SX 1ZHZA 4C69X 1HXUA 2XE5A 1MM4A 4AFKA 2X27X 4LSFA 5GV0A 2F1VA 4AZLA 3POXA 3DA4A 1GFMA 2KDYA 1IZNB 4KRAA 4U9CA 4G75A 5FVNA 1ZHWA 5DL5A 1GFQA 3PRNA 8PRNA 3T24A 3HOLA 3SYBA 1IZNA 5D5DA 2W80C 1PRNA 4N59A 3G7GA 4D65A 3K19A 1MPFA 2KZ7A 2YPVA 1QJ8A 2LFUA 5T5FA 1H6S1 4Z3TA 2Y0HA 5JDPA 2XE1A 3LK2B 4FSPA 3UAQA 2K0LA 2J4UP 4FESA 4GCPA 2F1TA 3LK3B 5ADXK 3VZUX 2XG6A 3LK42 3SY7A 3LK2A 1PHOA 4RLBA 2GE4A 5G26A 3RBHA 3LK3A 3SZVA 4GHBA 4FMSA 2Y7SA 4BUMX 3AAEB 1BT9A 2K4TA 3O0EA 4LSEA 1OSMA 4E1TA 5AFUK 4O3YA 2XMXA 3JTYA 2ERVA 2PRNA 4JCHA 4O3WA 1ZHXA 1GFNA 3AAEA 4QQ1A 4FRTA 4O3ZA 4AKRB 3PQSA 2N2LA 3DA3A 1YS5A 3V8UA 4F4BA 5DL7A 4RJWA 2XTQA 3AA6B 1GFOA 2QTKA 3VY9X 3AA7B 4AKRA 3AA1B 2ZLDA 4O3XB 3HWBA 1ZHTA 4FZLA 1QJPA 3PORA 1HXTA 4O4XA 2JMMA 3VZWX 3EMNX 4D64A 4FT6A 5DL6A 3AA7A 3AA1A 2M06A 1ORMA 2J1NA 4FOZA 4RL9A 3VZTX 1MM5A 2OMFA 2ZFGA 4JFBA 4FZMA 2KXPB 1P4TA 4FRXA 3VE1A 4GCSA 3NSGA 1ZHYA 3LK41 3POQA 4XNLA 1HXXA 5PRNA 2N2MA 3VY8X 4LSHA 1E54A 2KXPA 2W81C 1Q9FA 2MHLA 3QRCA 4FZNA 2Y2XA 3GP6A 4PUXA 3AA0B 1BXWA 4KR8A 5IYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCQ A;  3SYS A;  2FGR A;  3T0S A;  2Y0K A;  4AUI A;  2O4V A;  2XE2 A;  3T20 A;  3UU2 A;  2ODJ A;  2XE3 A;  3HW9 A;  3UPG A;  3FYX A;  3WI4 A;  4LSI A;  2Y0L A;  5DL8 A;  4D5U A;  2FGQ X;  4RJX A;  3SZD A;  3SY9 A;  1BH3 A;  1GFP A;  4KR4 A;  7PRN A;  3POU A;  3WI5 A;  2POR A;  4FSO A;  1OPF A;  6PRN A;  3A2S X;  4C69 X;  1HXU A;  2XE5 A;  4LSF A;  3POX A;  1GFM A;  4KRA A;  5FVN A;  5DL5 A;  1GFQ A;  3PRN A;  8PRN A;  3T24 A;  3SYB A;  1PRN A;  4D65 A;  3K19 A;  1MPF A;  5JDP A;  1H6S 1;  2Y0H A;  2XE1 A;  4FSP A;  2J4U P;  4GCP A;  3VZU X;  2XG6 A;  3SY7 A;  1PHO A;  3SZV A;  4FMS A;  4BUM X;  1BT9 A;  2K4T A;  3O0E A;  4LSE A;  1OSM A;  3JTY A;  2PRN A;  1GFN A;  4FRT A;  5DL7 A;  4RJW A;  1GFO A;  2QTK A;  3VY9 X;  2ZLD A;  3HWB A;  3POR A;  1HXT A;  3VZW X;  3EMN X;  4D64 A;  4FT6 A;  5DL6 A;  2J1N A;  4FOZ A;  3VZT X;  4JFB A;  2OMF A;  2ZFG A;  4FRX A;  4GCS A;  3NSG A;  3POQ A;  1HXX A;  5PRN A;  3VY8 X;  4LSH A;  1E54 A;  2Y2X A;  4KR8 A; 
#chains in the Genus database with same CATH topology
 4GCQ A;  1Q9G A;  3BS0 A;  3DWO X;  3PGS A;  1THQ A;  4O49 A;  2FGR A;  3SYS A;  3T0S A;  4K3B A;  2Y0K A;  4GF4 A;  4AYN A;  5E79 O;  3AA0 A;  4AUI A;  1G90 A;  2WJR A;  2O4V A;  2XE2 A;  5KAF O;  3PGU A;  4AYD C;  3UU2 A;  4E1S A;  3T20 A;  3C5O A;  4AYE C;  5H2F O;  2ODJ A;  2XE3 A;  3AAA B;  3HW9 A;  3TZG A;  3PQU A;  1T16 A;  3AA6 A;  3FYX A;  4LSI A;  2Y0L A;  3WI4 A;  3UPG A;  1S5L O;  3BRY A;  2KC0 A;  3QRA A;  3AAA A;  5DL8 A;  4D5U A;  2YNK A;  2FGQ X;  4XNK A;  2R89 A;  3VE2 A;  2XTR A;  4G76 A;  5G39 A;  4RJX A;  3SZD A;  4AKM A;  2KZ7 B;  3A0H O;  5ADX L;  3PF1 A;  3SY9 A;  1BH3 A;  3PGR A;  1GFP A;  4FUV A;  4KR4 A;  4AYI D;  4RLC A;  4AYM C;  3DZM A;  4B61 A;  3POU A;  5EE2 A;  3NJT A;  3WI5 A;  5B66 O;  7PRN A;  5GTH O;  2POR A;  2R4L A;  4FSO A;  3HOE A;  2LHF A;  2JQY A;  4O4U A;  2WJQ A;  5AFU L;  3KVD D;  1OPF A;  2MNH A;  4N58 A;  1QJ9 A;  6PRN A;  3A0B O;  2M07 A;  3A2S X;  1ZHZ A;  4C69 X;  1HXU A;  2R4N A;  2XE5 A;  4PJ0 O;  1MM4 A;  4AFK A;  2X27 X;  4LSF A;  4C4V B;  5GV0 A;  2F1V A;  4UB6 O;  4AZL A;  3POX A;  3DA4 A;  1GFM A;  2KDY A;  1IZN B;  4KRA A;  4PR7 A;  4UB8 O;  4FQE A;  4U9C A;  5G38 A;  4G75 A;  4C4V A;  5FVN A;  1ZHW A;  5DL5 A;  1GFQ A;  3PRN A;  8PRN A;  2WVP A;  3T24 A;  3HOL A;  3JCU O;  1IZN A;  5D5D A;  3SYB A;  2W80 C;  1PRN A;  2R88 A;  4N59 A;  3G7G A;  4D65 A;  3K19 A;  1MPF A;  2KZ7 A;  2YPV A;  1QJ8 A;  2LFU A;  5T5F A;  1H6S 1;  4Z3T A;  2Y0H A;  5TIS O;  2XE1 A;  3LK2 B;  2X9K A;  4FSP A;  3UAQ A;  2K0L A;  2J4U P;  4FES A;  4GCP A;  2F1T A;  3LK3 B;  5ADX K;  5G3A A;  3VZU X;  2XG6 A;  2F1C X;  3LK4 2;  3SY7 A;  3WU2 O;  3LK2 A;  1PHO A;  4RLB A;  2GE4 A;  5G26 A;  3RBH A;  3LK3 A;  2R4P A;  3SZV A;  4GHB A;  4FMS A;  2Y7S A;  4BUM X;  4IL6 O;  3AAE B;  1BT9 A;  2K4T A;  3O0E A;  4LSE A;  1OSM A;  4E1T A;  5AFU K;  2R4O A;  4O3Y A;  2XMX A;  3JTY A;  2ERV A;  2PRN A;  4JCH A;  4CTD A;  4O3W A;  1ZHX A;  5GTI O;  1GFN A;  3KZI O;  3AAE A;  4QQ1 A;  4FRT A;  4O3Z A;  5JDP A;  4AKR B;  3PQS A;  2AXT O;  2N2L A;  3DA3 A;  1YS5 A;  3V8U A;  4F4B A;  2R8A A;  5DL7 A;  4RJW A;  5B5E O;  2XTQ A;  3AA6 B;  1GFO A;  2QTK A;  3VY9 X;  3AA7 B;  3BRZ A;  3AA1 B;  2ZLD A;  4O3X B;  4AKR A;  3HWB A;  1ZHT A;  4FZL A;  1QJP A;  3POR A;  4N75 A;  1HXT A;  4O4X A;  2JMM A;  3VZW X;  3EMN X;  5KAI O;  4D64 A;  4N74 A;  4FT6 A;  5DL6 A;  1T1L A;  3AA7 A;  3AA1 A;  2M06 A;  1ORM A;  2J1N A;  3DWN A;  4FOZ A;  4RL9 A;  3VZT X;  4K3C A;  1MM5 A;  2OMF A;  2ZFG A;  4JFB A;  4FZM A;  2KXP B;  1P4T A;  4FRX A;  3VE1 A;  4GCS A;  2IWW A;  3NSG A;  1ZHY A;  3LK4 1;  3POQ A;  4XNL A;  1HXX A;  5PRN A;  2N2M A;  3VY8 X;  4LSH A;  1E54 A;  2KXP A;  2W81 C;  1Q9F A;  2MHL A;  2IWV A;  3QRC A;  2Y2X A;  3GP6 A;  4FZN A;  3AA0 B;  1BXW A;  4PUX A;  4C00 A;  4KR8 A;  5IYU A; 
#chains in the Genus database with same CATH homology
 4GCQ A;  1Q9G A;  4O49 A;  3SYS A;  1THQ A;  2FGR A;  3T0S A;  4AYN A;  2Y0K A;  4GF4 A;  3AA0 A;  4AUI A;  1G90 A;  2O4V A;  2XE2 A;  4AYD C;  3T20 A;  3UU2 A;  4E1S A;  3C5O A;  4AYE C;  2ODJ A;  2XE3 A;  3AAA B;  3HW9 A;  3TZG A;  3PQU A;  3AA6 A;  3FYX A;  3WI4 A;  4LSI A;  2Y0L A;  3UPG A;  2KC0 A;  3QRA A;  3AAA A;  5DL8 A;  4D5U A;  2YNK A;  2FGQ X;  4XNK A;  3VE2 A;  2XTR A;  4G76 A;  4RJX A;  3SZD A;  4AKM A;  2KZ7 B;  5ADX L;  3SY9 A;  1BH3 A;  4FUV A;  1GFP A;  4KR4 A;  4AYI D;  4RLC A;  4AYM C;  4B61 A;  3POU A;  5EE2 A;  3WI5 A;  7PRN A;  2POR A;  4FSO A;  3HOE A;  2LHF A;  4O4U A;  5AFU L;  3KVD D;  1OPF A;  2MNH A;  4N58 A;  1QJ9 A;  6PRN A;  2M07 A;  3A2S X;  1ZHZ A;  4C69 X;  1HXU A;  2XE5 A;  1MM4 A;  4AFK A;  2X27 X;  4LSF A;  5GV0 A;  2F1V A;  4AZL A;  3POX A;  3DA4 A;  1GFM A;  2KDY A;  1IZN B;  4KRA A;  4U9C A;  4G75 A;  5FVN A;  1ZHW A;  5DL5 A;  1GFQ A;  3PRN A;  8PRN A;  3T24 A;  3HOL A;  3SYB A;  1IZN A;  5D5D A;  2W80 C;  1PRN A;  4N59 A;  3G7G A;  4D65 A;  3K19 A;  1MPF A;  2KZ7 A;  2YPV A;  1QJ8 A;  2LFU A;  5T5F A;  1H6S 1;  4Z3T A;  2Y0H A;  5JDP A;  2XE1 A;  3LK2 B;  4FSP A;  3UAQ A;  2K0L A;  2J4U P;  4FES A;  4GCP A;  2F1T A;  3LK3 B;  5ADX K;  3VZU X;  2XG6 A;  3LK4 2;  3SY7 A;  3LK2 A;  1PHO A;  4RLB A;  2GE4 A;  5G26 A;  3RBH A;  3LK3 A;  3SZV A;  4GHB A;  4FMS A;  2Y7S A;  4BUM X;  3AAE B;  1BT9 A;  2K4T A;  3O0E A;  4LSE A;  1OSM A;  4E1T A;  5AFU K;  4O3Y A;  2XMX A;  3JTY A;  2ERV A;  2PRN A;  4JCH A;  4O3W A;  1ZHX A;  1GFN A;  3AAE A;  4QQ1 A;  4FRT A;  4O3Z A;  4AKR B;  3PQS A;  2N2L A;  3DA3 A;  1YS5 A;  3V8U A;  4F4B A;  5DL7 A;  4RJW A;  2XTQ A;  3AA6 B;  1GFO A;  2QTK A;  3VY9 X;  3AA7 B;  4AKR A;  3AA1 B;  2ZLD A;  4O3X B;  3HWB A;  1ZHT A;  4FZL A;  1QJP A;  3POR A;  1HXT A;  4O4X A;  2JMM A;  3VZW X;  3EMN X;  4D64 A;  4FT6 A;  5DL6 A;  3AA7 A;  3AA1 A;  2M06 A;  1ORM A;  2J1N A;  4FOZ A;  4RL9 A;  3VZT X;  1MM5 A;  2OMF A;  2ZFG A;  4JFB A;  4FZM A;  2KXP B;  1P4T A;  4FRX A;  3VE1 A;  4GCS A;  3NSG A;  1ZHY A;  3LK4 1;  3POQ A;  4XNL A;  1HXX A;  5PRN A;  2N2M A;  3VY8 X;  4LSH A;  1E54 A;  2KXP A;  2W81 C;  1Q9F A;  2MHL A;  3QRC A;  4FZN A;  2Y2X A;  3GP6 A;  4PUX A;  3AA0 B;  1BXW A;  4KR8 A;  5IYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...