4D65A

Structure of porin omp-pst2 from p. stuartii; the asymmetric unit contains a dimer of trimers.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
343
structure length
343
Chain Sequence
AEVYNKDGNKLDVYGQIDVRHYFADAKSGEDGDDSRVRLGFKGDTQITDQLIGFGRFEWETSTNKAETSNDNQNRLAYAGLKFADYGSLDYGRNYGVIYDTNAWTDVLPLWGADTMDQEDTFMMGRNRNLLTYRNNNGFGYIDGLSFALQYQGKNGDQNKSTGSSALDNNGDGYGFSTAYELGWGLSIGGGYSNSSRTPSQNNIKTGATGKRAEAWNVGSKLELDELYLAAMYGQTLNTTRFGDDDAEAIANKTENLELVALYSFDFGLTPSIGYNQSKGKNLGNYGNKDLVKYIAVGASYDFNKNMAAVIDYKINLLKDNQFTDDYGINTDNVLGLGLIYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PORIN 2
publication title Porin self-association enables cell-to-cell contact inProvidencia stuartiifloating communities.
pubmed doi rcsb
source organism Providencia stuartii
total genus 104
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d65A00
4D5UA 3EMNX 1BH3A 3K19A 3VZUX 1GFNA 2XG6A 4GCSA 2K4TA 3FYXA 3PRNA 1PHOA 4FSOA 2ZFGA 3SZVA 3VZWX 4FT6A 2QTKA 3POQA 4KR8A 4JFBA 1GFOA 1HXTA 2J4UP 3POXA 4FOZA 4KR4A 2ZLDA 3A2SX 2OMFA 5JDPA 2PRNA 5PRNA 4LSEA 2J1NA 4D64A 1GFMA 1GFQA 4LSHA 2O4VA 1GFPA 1OSMA 4FRTA 3NSGA 4D65A 3WI5A 3SY7A 3VZTX 3SZDA 2Y0LA 7PRNA 1H6S1 5FVNA 5DL8A 3POUA 1HXUA 4BUMX 3T20A 2PORA 3SYSA 2XE2A 3HW9A 3O0EA 5DL7A 4C69X 1BT9A 1OPFA 3UPGA 2FGRA 3UU2A 1MPFA 4KRAA 2Y2XA 4LSIA 1E54A 2Y0HA 3SYBA 1HXXA 1PRNA 3T0SA 2XE5A 3VY9X 4FMSA 3WI4A 4AUIA 3HWBA 4GCPA 3SY9A 4RJXA 3T24A 3JTYA 3VY8X 4FRXA 4RJWA 3PORA 4FSPA 8PRNA 2XE3A 6PRNA 2ODJA 2Y0KA 4LSFA 5DL6A 5DL5A 2XE1A 2FGQX 4GCQA
chains in the Genus database with same CATH superfamily
4FZNA 4RL9A 2R89A 3LK3A 2R8AA 1YS5A 1MM5A 3DWNA 4IL6O 4D5UA 3EMNX 1BH3A 4N74A 5AFUL 3K19A 5GV0A 4AKRA 3VZUX 3C5OA 4Z3TA 1GFNA 2KZ7B 5G26A 2MNHA 2XG6A 4GCSA 2K4TA 4AKMA 4E1SA 1QJ8A 3FYXA 5AFUK 3PRNA 1PHOA 4FQEA 5KAFO 2KXPB 4FSOA 2KC0A 4GF4A 2ZFGA 2AXTO 3A0BO 4C4VB 3SZVA 1S5LO 2IWWA 3DA4A 3JCUO 4N58A 4PUXA 3VZWX 4G76A 4O49A 4PJ0O 4FT6A 4UB6O 2QTKA 4O3XB 3POQA 2KXPA 4KR8A 3A0HO 3AAEB 4JFBA 1GFOA 1HXTA 4XNLA 2F1CX 2J4UP 4E1TA 2ERVA 3POXA 4FOZA 4RLCA 4KR4A 2ZLDA 3A2SX 3GP6A 4AKRB 1ZHZA 2OMFA 5JDPA 4G75A 2PRNA 1ZHTA 2N2MA 3DWOX 2MHLA 3KZIO 2J1NA 4LSEA 5PRNA 4D64A 1GFMA 3TZGA 3AA0A 3AAAB 1GFQA 3DA3A 4LSHA 2JMMA 2O4VA 2X9KA 5D5DA 2X27X 1GFPA 1OSMA 4FRTA 3NSGA 1T16A 3HOLA 4D65A 3WI5A 3SY7A 3VZTX 3SZDA 2Y0LA 5G38A 5G39A 3AAAA 4AZLA 7PRNA 1H6S1 5FVNA 5DL8A 2IWVA 3POUA 4O3ZA 1HXUA 4BUMX 1ZHWA 2XTQA 3AA6A 4AYEC 4B61A 3T20A 2PORA 2R4PA 3SYSA 2R4OA 3PGSA 2XE2A 3HW9A 3O0EA 4K3CA 3LK2B 2N2LA 1IZNB 5DL7A 5GTHO 4C69X 3HOEA 1BT9A 5B66O 5TISO 1ORMA 1P4TA 1OPFA 3BS0A 4F4BA 5ADXL 3UPGA 4RLBA 3AA1B 3AA0B 5T5FA 2YNKA 2KDYA 1IZNA 2FGRA 2R88A 3AA7B 3DZMA 3LK2A 4O4XA 4JCHA 2LHFA 5H2FO 3UU2A 3AA1A 2XTRA 3AA7A 4FZMA 3LK42 5ADXK 2W81C 1QJ9A 4O3WA 1THQA 1MPFA 4KRAA 3LK41 3AA6B 2Y2XA 4LSIA 4N75A 1E54A 5B5EO 2JQYA 2WVPA 5GTIO 2Y0HA 1MM4A 3SYBA 3QRAA 2F1TA 4AYNA 2LFUA 1HXXA 4AYID 1ZHXA 4PR7A 1PRNA 4N59A 3T0SA 4AFKA 1QJPA 2XE5A 2M06A 3UAQA 1BXWA 1T1LA 4FESA 3VE2A 3VY9X 4FMSA 4O4UA 3WI4A 1ZHYA 4AUIA 3HWBA 4GCPA 2Y7SA 2W80C 4RJXA 4U9CA 3NJTA 3SY9A 2YPVA 3T24A 4CTDA 4K3BA 3PQUA 3JTYA 3V8UA 3VY8X 4QQ1A 4FRXA 4UB8O 4RJWA 4AYMC 2WJQA 2M07A 3PORA 3G7GA 4O3YA 4FSPA 5KAIO 1Q9FA 2KZ7A 3BRYA 3PF1A 8PRNA 5IYUA 2F1VA 2XE3A 2K0LA 3PQSA 2R4NA 4FZLA 3RBHA 6PRNA 2ODJA 1G90A 3PGRA 4XNKA 3WU2O 2XMXA 4C4VA 2GE4A 4AYDC 2Y0KA 2R4LA 3PGUA 3QRCA 3LK3B 2WJRA 4LSFA 3BRZA 4GHBA 5EE2A 5DL6A 5DL5A 1Q9GA 2FGQX 2XE1A 3KVDD 5E79O 5G3AA 3VE1A 4C00A 4FUVA 4GCQA 3AAEA
chains in the Genus database with same CATH topology
4FZNA 4RL9A 3LK3A 1YS5A 1MM5A 4D5UA 5AFUL 3EMNX 1BH3A 3K19A 5GV0A 4AKRA 3VZUX 3C5OA 4Z3TA 1GFNA 2KZ7B 5G26A 2MNHA 2XG6A 4GCSA 2K4TA 4AKMA 4E1SA 1QJ8A 3FYXA 5AFUK 3PRNA 1PHOA 2KXPB 4FSOA 2KC0A 4GF4A 2ZFGA 3SZVA 3DA4A 4PUXA 4N58A 3VZWX 4G76A 4O49A 4FT6A 2QTKA 4O3XB 3POQA 2KXPA 4KR8A 3AAEB 4JFBA 1GFOA 1HXTA 4XNLA 2J4UP 4E1TA 2ERVA 3POXA 4FOZA 4RLCA 4KR4A 2ZLDA 3A2SX 3GP6A 4AKRB 1ZHZA 2OMFA 5JDPA 4G75A 2PRNA 1ZHTA 2N2MA 4LSEA 2MHLA 5PRNA 2J1NA 4D64A 1GFMA 3TZGA 3AA0A 3AAAB 1GFQA 3DA3A 4LSHA 2JMMA 2O4VA 5D5DA 2X27X 1GFPA 1OSMA 4FRTA 3NSGA 3HOLA 4D65A 3WI5A 3SY7A 3VZTX 3SZDA 2Y0LA 3AAAA 4AZLA 7PRNA 1H6S1 5FVNA 5DL8A 3POUA 4O3ZA 1HXUA 4BUMX 1ZHWA 2XTQA 3AA6A 4AYEC 4B61A 3T20A 2PORA 3SYSA 2XE2A 3HW9A 3O0EA 3LK2B 2N2LA 1IZNB 5DL7A 4C69X 3HOEA 1BT9A 4F4BA 1ORMA 1P4TA 1OPFA 5ADXL 3UPGA 4RLBA 3AA1B 3AA0B 5T5FA 2YNKA 2KDYA 1IZNA 2FGRA 3AA7B 3LK2A 4O4XA 4JCHA 2LHFA 3UU2A 3AA1A 2XTRA 3AA7A 4FZMA 3LK42 5ADXK 2W81C 1QJ9A 4O3WA 1THQA 1MPFA 4KRAA 3LK41 3AA6B 2Y2XA 4LSIA 1E54A 2Y0HA 1MM4A 3SYBA 3QRAA 2F1TA 4AYNA 2LFUA 1HXXA 4AYID 1ZHXA 1PRNA 4N59A 3T0SA 4AFKA 1QJPA 2XE5A 2M06A 3UAQA 1BXWA 4FESA 3VE2A 3VY9X 4FMSA 4O4UA 3WI4A 1ZHYA 4AUIA 3HWBA 4GCPA 2Y7SA 2W80C 4RJXA 4U9CA 3SY9A 2YPVA 3T24A 3PQUA 3JTYA 3V8UA 3VY8X 4QQ1A 4FRXA 4RJWA 2M07A 3PORA 3G7GA 4O3YA 4FSPA 1Q9FA 2KZ7A 8PRNA 5IYUA 2F1VA 2XE3A 2K0LA 3PQSA 4FZLA 3RBHA 6PRNA 2ODJA 1G90A 4XNKA 2XMXA 2GE4A 4AYDC 2Y0KA 4LSFA 3QRCA 5EE2A 3LK3B 4GHBA 4AYMC 5DL6A 5DL5A 1Q9GA 2FGQX 2XE1A 3KVDD 3VE1A 4FUVA 4GCQA 3AAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D5U A;  3EMN X;  1BH3 A;  3K19 A;  3VZU X;  1GFN A;  2XG6 A;  4GCS A;  2K4T A;  3FYX A;  3PRN A;  1PHO A;  4FSO A;  2ZFG A;  3SZV A;  3VZW X;  4FT6 A;  2QTK A;  3POQ A;  4KR8 A;  4JFB A;  1GFO A;  1HXT A;  2J4U P;  3POX A;  4FOZ A;  4KR4 A;  2ZLD A;  3A2S X;  2OMF A;  5JDP A;  2PRN A;  5PRN A;  4LSE A;  2J1N A;  4D64 A;  1GFM A;  1GFQ A;  4LSH A;  2O4V A;  1GFP A;  1OSM A;  4FRT A;  3NSG A;  4D65 A;  3WI5 A;  3SY7 A;  3VZT X;  3SZD A;  2Y0L A;  7PRN A;  1H6S 1;  5FVN A;  5DL8 A;  3POU A;  1HXU A;  4BUM X;  3T20 A;  2POR A;  3SYS A;  2XE2 A;  3HW9 A;  3O0E A;  5DL7 A;  4C69 X;  1BT9 A;  1OPF A;  3UPG A;  2FGR A;  3UU2 A;  1MPF A;  4KRA A;  2Y2X A;  4LSI A;  1E54 A;  2Y0H A;  3SYB A;  1HXX A;  1PRN A;  3T0S A;  2XE5 A;  3VY9 X;  4FMS A;  3WI4 A;  4AUI A;  3HWB A;  4GCP A;  3SY9 A;  4RJX A;  3T24 A;  3JTY A;  3VY8 X;  4FRX A;  4RJW A;  3POR A;  4FSP A;  8PRN A;  2XE3 A;  6PRN A;  2ODJ A;  2Y0K A;  4LSF A;  5DL6 A;  5DL5 A;  2XE1 A;  2FGQ X;  4GCQ A; 
#chains in the Genus database with same CATH topology
 4FZN A;  4RL9 A;  2R89 A;  3LK3 A;  2R8A A;  1YS5 A;  1MM5 A;  3DWN A;  4IL6 O;  4D5U A;  3EMN X;  1BH3 A;  4N74 A;  5AFU L;  3K19 A;  5GV0 A;  4AKR A;  3VZU X;  3C5O A;  4Z3T A;  1GFN A;  2KZ7 B;  5G26 A;  2MNH A;  2XG6 A;  4GCS A;  2K4T A;  4AKM A;  4E1S A;  1QJ8 A;  3FYX A;  5AFU K;  3PRN A;  1PHO A;  4FQE A;  5KAF O;  2KXP B;  4FSO A;  2KC0 A;  4GF4 A;  2ZFG A;  2AXT O;  3A0B O;  4C4V B;  3SZV A;  1S5L O;  2IWW A;  3DA4 A;  3JCU O;  4N58 A;  4PUX A;  3VZW X;  4G76 A;  4O49 A;  4PJ0 O;  4FT6 A;  4UB6 O;  2QTK A;  4O3X B;  3POQ A;  2KXP A;  4KR8 A;  3A0H O;  3AAE B;  4JFB A;  1GFO A;  1HXT A;  4XNL A;  2F1C X;  2J4U P;  4E1T A;  2ERV A;  3POX A;  4FOZ A;  4RLC A;  4KR4 A;  2ZLD A;  3A2S X;  3GP6 A;  4AKR B;  1ZHZ A;  2OMF A;  5JDP A;  4G75 A;  2PRN A;  1ZHT A;  2N2M A;  3DWO X;  2MHL A;  3KZI O;  2J1N A;  4LSE A;  5PRN A;  4D64 A;  1GFM A;  3TZG A;  3AA0 A;  3AAA B;  1GFQ A;  3DA3 A;  4LSH A;  2JMM A;  2O4V A;  2X9K A;  5D5D A;  2X27 X;  1GFP A;  1OSM A;  4FRT A;  3NSG A;  1T16 A;  3HOL A;  4D65 A;  3WI5 A;  3SY7 A;  3VZT X;  3SZD A;  2Y0L A;  5G38 A;  5G39 A;  3AAA A;  4AZL A;  7PRN A;  1H6S 1;  5FVN A;  5DL8 A;  2IWV A;  3POU A;  4O3Z A;  1HXU A;  4BUM X;  1ZHW A;  2XTQ A;  3AA6 A;  4AYE C;  4B61 A;  3T20 A;  2POR A;  2R4P A;  3SYS A;  2R4O A;  3PGS A;  2XE2 A;  3HW9 A;  3O0E A;  4K3C A;  3LK2 B;  2N2L A;  1IZN B;  5DL7 A;  5GTH O;  4C69 X;  3HOE A;  1BT9 A;  5B66 O;  5TIS O;  1ORM A;  1P4T A;  1OPF A;  3BS0 A;  4F4B A;  5ADX L;  3UPG A;  4RLB A;  3AA1 B;  3AA0 B;  5T5F A;  2YNK A;  2KDY A;  1IZN A;  2FGR A;  2R88 A;  3AA7 B;  3DZM A;  3LK2 A;  4O4X A;  4JCH A;  2LHF A;  5H2F O;  3UU2 A;  3AA1 A;  2XTR A;  3AA7 A;  4FZM A;  3LK4 2;  5ADX K;  2W81 C;  1QJ9 A;  4O3W A;  1THQ A;  1MPF A;  4KRA A;  3LK4 1;  3AA6 B;  2Y2X A;  4LSI A;  4N75 A;  1E54 A;  5B5E O;  2JQY A;  2WVP A;  5GTI O;  2Y0H A;  1MM4 A;  3SYB A;  3QRA A;  2F1T A;  4AYN A;  2LFU A;  1HXX A;  4AYI D;  1ZHX A;  4PR7 A;  1PRN A;  4N59 A;  3T0S A;  4AFK A;  1QJP A;  2XE5 A;  2M06 A;  3UAQ A;  1BXW A;  1T1L A;  4FES A;  3VE2 A;  3VY9 X;  4FMS A;  4O4U A;  3WI4 A;  1ZHY A;  4AUI A;  3HWB A;  4GCP A;  2Y7S A;  2W80 C;  4RJX A;  4U9C A;  3NJT A;  3SY9 A;  2YPV A;  3T24 A;  4CTD A;  4K3B A;  3PQU A;  3JTY A;  3V8U A;  3VY8 X;  4QQ1 A;  4FRX A;  4UB8 O;  4RJW A;  4AYM C;  2WJQ A;  2M07 A;  3POR A;  3G7G A;  4O3Y A;  4FSP A;  5KAI O;  1Q9F A;  2KZ7 A;  3BRY A;  3PF1 A;  8PRN A;  5IYU A;  2F1V A;  2XE3 A;  2K0L A;  3PQS A;  2R4N A;  4FZL A;  3RBH A;  6PRN A;  2ODJ A;  1G90 A;  3PGR A;  4XNK A;  3WU2 O;  2XMX A;  4C4V A;  2GE4 A;  4AYD C;  2Y0K A;  2R4L A;  3PGU A;  3QRC A;  3LK3 B;  2WJR A;  4LSF A;  3BRZ A;  4GHB A;  5EE2 A;  5DL6 A;  5DL5 A;  1Q9G A;  2FGQ X;  2XE1 A;  3KVD D;  5E79 O;  5G3A A;  3VE1 A;  4C00 A;  4FUV A;  4GCQ A;  3AAE A; 
#chains in the Genus database with same CATH homology
 4FZN A;  4RL9 A;  3LK3 A;  1YS5 A;  1MM5 A;  4D5U A;  5AFU L;  3EMN X;  1BH3 A;  3K19 A;  5GV0 A;  4AKR A;  3VZU X;  3C5O A;  4Z3T A;  1GFN A;  2KZ7 B;  5G26 A;  2MNH A;  2XG6 A;  4GCS A;  2K4T A;  4AKM A;  4E1S A;  1QJ8 A;  3FYX A;  5AFU K;  3PRN A;  1PHO A;  2KXP B;  4FSO A;  2KC0 A;  4GF4 A;  2ZFG A;  3SZV A;  3DA4 A;  4PUX A;  4N58 A;  3VZW X;  4G76 A;  4O49 A;  4FT6 A;  2QTK A;  4O3X B;  3POQ A;  2KXP A;  4KR8 A;  3AAE B;  4JFB A;  1GFO A;  1HXT A;  4XNL A;  2J4U P;  4E1T A;  2ERV A;  3POX A;  4FOZ A;  4RLC A;  4KR4 A;  2ZLD A;  3A2S X;  3GP6 A;  4AKR B;  1ZHZ A;  2OMF A;  5JDP A;  4G75 A;  2PRN A;  1ZHT A;  2N2M A;  4LSE A;  2MHL A;  5PRN A;  2J1N A;  4D64 A;  1GFM A;  3TZG A;  3AA0 A;  3AAA B;  1GFQ A;  3DA3 A;  4LSH A;  2JMM A;  2O4V A;  5D5D A;  2X27 X;  1GFP A;  1OSM A;  4FRT A;  3NSG A;  3HOL A;  4D65 A;  3WI5 A;  3SY7 A;  3VZT X;  3SZD A;  2Y0L A;  3AAA A;  4AZL A;  7PRN A;  1H6S 1;  5FVN A;  5DL8 A;  3POU A;  4O3Z A;  1HXU A;  4BUM X;  1ZHW A;  2XTQ A;  3AA6 A;  4AYE C;  4B61 A;  3T20 A;  2POR A;  3SYS A;  2XE2 A;  3HW9 A;  3O0E A;  3LK2 B;  2N2L A;  1IZN B;  5DL7 A;  4C69 X;  3HOE A;  1BT9 A;  4F4B A;  1ORM A;  1P4T A;  1OPF A;  5ADX L;  3UPG A;  4RLB A;  3AA1 B;  3AA0 B;  5T5F A;  2YNK A;  2KDY A;  1IZN A;  2FGR A;  3AA7 B;  3LK2 A;  4O4X A;  4JCH A;  2LHF A;  3UU2 A;  3AA1 A;  2XTR A;  3AA7 A;  4FZM A;  3LK4 2;  5ADX K;  2W81 C;  1QJ9 A;  4O3W A;  1THQ A;  1MPF A;  4KRA A;  3LK4 1;  3AA6 B;  2Y2X A;  4LSI A;  1E54 A;  2Y0H A;  1MM4 A;  3SYB A;  3QRA A;  2F1T A;  4AYN A;  2LFU A;  1HXX A;  4AYI D;  1ZHX A;  1PRN A;  4N59 A;  3T0S A;  4AFK A;  1QJP A;  2XE5 A;  2M06 A;  3UAQ A;  1BXW A;  4FES A;  3VE2 A;  3VY9 X;  4FMS A;  4O4U A;  3WI4 A;  1ZHY A;  4AUI A;  3HWB A;  4GCP A;  2Y7S A;  2W80 C;  4RJX A;  4U9C A;  3SY9 A;  2YPV A;  3T24 A;  3PQU A;  3JTY A;  3V8U A;  3VY8 X;  4QQ1 A;  4FRX A;  4RJW A;  2M07 A;  3POR A;  3G7G A;  4O3Y A;  4FSP A;  1Q9F A;  2KZ7 A;  8PRN A;  5IYU A;  2F1V A;  2XE3 A;  2K0L A;  3PQS A;  4FZL A;  3RBH A;  6PRN A;  2ODJ A;  1G90 A;  4XNK A;  2XMX A;  2GE4 A;  4AYD C;  2Y0K A;  4LSF A;  3QRC A;  5EE2 A;  3LK3 B;  4GHB A;  4AYM C;  5DL6 A;  5DL5 A;  1Q9G A;  2FGQ X;  2XE1 A;  3KVD D;  3VE1 A;  4FUV A;  4GCQ A;  3AAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...