5EE2A

The crystal structure of the c-terminal beta-barrel of hpua from neisseria gonorrhoeae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
122
Chain Sequence
LSKGKITYQVWGIRVRNGQFVTSSVLSFITANFNSNTLAGKILGNSDYGPDVDIQNATITGPTFSGDATSGGKSGKLEGKFFEVSIGGKITFDGDRSLDTVFGGVSYEKKLDDTSQDTNHLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemoglobin-haptoglobin-utilization protein
publication title Structural analysis of haemoglobin binding by HpuA from the Neisseriaceae family.
pubmed doi rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Metal transport
total genus 27
structure length 122
sequence length 148
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5ee2A00
4QQ1A 2YPVA 3HOLA 1YS5A 2KDYA 3PQSA 2W81C 2Y7SA 4U9CA 2LFUA 4AYMC 4AYDC 3UAQA 5T5FA 3KVDD 4O4XA 4AYEC 4O3XB 3PQUA 4O3YA 4O3ZA 2KC0A 3VE1A 5EE2A 4AYID 4O49A 4O4UA 3V8UA 3HOEA 4Z3TA 4AYNA 3VE2A 4O3WA 2W80C
chains in the Genus database with same CATH superfamily
2F1CX 2Y0LA 3HOLA 4FESA 4N75A 4E1TA 5ADXK 2R4PA 1GFMA 1P4TA 5G26A 4KRAA 2KZ7A 1BT9A 1THQA 3HW9A 2MHLA 4G76A 4GHBA 4CTDA 1BH3A 1ZHWA 5G38A 1BXWA 1GFOA 2LHFA 4IL6O 2XG6A 3C5OA 4JCHA 2MNHA 2XTRA 3PQUA 3WU2O 2KZ7B 2Y0KA 1ZHTA 4N59A 3QRAA 3VZTX 3A0HO 4LSEA 4AZLA 2JMMA 1OPFA 3POQA 4JFBA 2XE1A 3HWBA 3NJTA 4LSFA 2ODJA 1ORMA 3LK42 2KXPA 2XE2A 2R8AA 5DL7A 5AFUL 5H2FO 1HXUA 3AA0A 1PRNA 4D5UA 3LK41 4LSHA 4GCQA 3POUA 3SZVA 2FGQX 3SY7A 2R4OA 2WJRA 2WJQA 4QQ1A 2K4TA 4C00A 3WI4A 1HXXA 1QJ8A 3PQSA 2W81C 4U9CA 5KAIO 2KXPB 5IYUA 1GFPA 2O4VA 2GE4A 4FZMA 4K3CA 3TZGA 3AA0B 4AYMC 2ZFGA 3JTYA 6PRNA 3AAEB 2Y2XA 2XMXA 2JQYA 3KVDD 3BRYA 4AYEC 2Y0HA 1Q9GA 4LSIA 3KZIO 3DA3A 4FMSA 4PJ0O 2PORA 2OMFA 2X27X 3T20A 4FSOA 1GFQA 2J1NA 2KC0A 3PORA 3LK3A 5EE2A 4AYID 3PGRA 2M06A 4O4UA 4N58A 8PRNA 5GV0A 3V8UA 3BRZA 4KR4A 5E79O 4C69X 4AYNA 3EMNX 3POXA 1S5LO 1Q9FA 4B61A 4F4BA 4GCSA 3NSGA 2F1TA 3AAAA 3DZMA 3PGUA 4FT6A 2YPVA 4RLCA 5DL5A 1YS5A 3LK2A 1T16A 2FGRA 2XE3A 3LK3B 2Y7SA 3BS0A 4FZLA 5GTIO 3SZDA 5GTHO 2J4UP 4PR7A 4FOZA 4RJWA 2LFUA 3JCUO 2N2MA 2QTKA 3O0EA 5TISO 4AYDC 1QJ9A 3VY9X 3DA4A 4FUVA 2K0LA 5D5DA 5T5FA 1MM4A 3AAAB 4O3XB 5PRNA 5B5EO 1G90A 3LK2B 4O3YA 4O3ZA 4RL9A 2YNKA 3VZWX 3AA6A 4FRTA 4UB6O 1IZNA 2R4NA 5FVNA 5B66O 3UPGA 4O49A 4K3BA 3SYBA 5DL6A 2X9KA 4RJXA 2XE5A 3HOEA 2WVPA 5ADXL 2R4LA 2F1VA 3AA1A 4D65A 3VE2A 3K19A 4O3WA 4Z3TA 1GFNA 1MPFA 4FSPA 7PRNA 1H6S1 2W80C 3A2SX 4XNLA 4N74A 3AA6B 2N2LA 3AA7A 4FRXA 4KR8A 1IZNB 4C4VA 3T0SA 2KDYA 4AUIA 3DWOX 5AFUK 4FZNA 3UU2A 3A0BO 1MM5A 1ZHXA 3AA1B 4AFKA 3PGSA 5G3AA 4AKRA 3VZUX 1ZHZA 2PRNA 3UAQA 5G39A 4GF4A 3RBHA 3SY9A 3T24A 4RLBA 4O4XA 3AA7B 4UB8O 4AKMA 3PRNA 2IWVA 3PF1A 4PUXA 4C4VB 5JDPA 1QJPA 3QRCA 4D64A 4FQEA 4G75A 5DL8A 4BUMX 2XTQA 1HXTA 3VE1A 3FYXA 2AXTO 3G7GA 4AKRB 2R88A 4XNKA 2ZLDA 3WI5A 3DWNA 2IWWA 1T1LA 3GP6A 4E1SA 2R89A 4GCPA 3SYSA 3AAEA 3VY8X 5KAFO 1ZHYA 1OSMA 2M07A 1PHOA 1E54A 2ERVA
chains in the Genus database with same CATH topology
2Y0LA 3HOLA 4FESA 4E1TA 5ADXK 1GFMA 1P4TA 5G26A 4KRAA 2KZ7A 1BT9A 1THQA 3HW9A 2MHLA 4G76A 4GHBA 1BH3A 1ZHWA 1BXWA 1GFOA 2LHFA 2XG6A 3C5OA 4JCHA 2MNHA 2XTRA 3PQUA 2KZ7B 2Y0KA 1ZHTA 4N59A 3QRAA 3VZTX 4LSEA 4AZLA 2JMMA 1OPFA 3POQA 4JFBA 2XE1A 3HWBA 4LSFA 2ODJA 1ORMA 3LK42 2KXPA 2XE2A 5DL7A 5AFUL 1HXUA 3AA0A 1PRNA 4D5UA 3LK41 4LSHA 4GCQA 3POUA 3SZVA 2FGQX 3SY7A 4QQ1A 2K4TA 3WI4A 1HXXA 1QJ8A 3PQSA 2W81C 4U9CA 5IYUA 2KXPB 1GFPA 2O4VA 2GE4A 4FZMA 3TZGA 3AA0B 4AYMC 2ZFGA 3JTYA 6PRNA 3AAEB 2Y2XA 3KVDD 4AYEC 2Y0HA 1Q9GA 4LSIA 3DA3A 4FMSA 2PORA 2OMFA 2X27X 3T20A 4FSOA 1GFQA 2J1NA 2KC0A 3PORA 3LK3A 5EE2A 4AYID 8PRNA 2M06A 4O4UA 4N58A 5GV0A 3V8UA 4KR4A 4C69X 4AYNA 3EMNX 3POXA 4B61A 1Q9FA 4F4BA 4GCSA 3NSGA 2F1TA 3AAAA 4FT6A 4RLCA 2YPVA 5DL5A 1YS5A 3LK2A 2XE3A 2FGRA 3LK3B 4FZLA 2Y7SA 3SZDA 2J4UP 4FOZA 4RJWA 2LFUA 2N2MA 2QTKA 3O0EA 4AYDC 1QJ9A 3VY9X 3DA4A 4FUVA 2K0LA 5D5DA 5T5FA 1MM4A 3AAAB 4O3XB 5PRNA 1G90A 3LK2B 4O3YA 4O3ZA 4RL9A 2YNKA 3VZWX 3AA6A 4FRTA 1IZNA 1E54A 5FVNA 3UPGA 4O49A 3SYBA 5DL6A 4RJXA 2XE5A 3HOEA 5ADXL 3AA1A 2F1VA 4Z3TA 4D65A 3VE2A 3K19A 4O3WA 1GFNA 1MPFA 4FSPA 7PRNA 2W80C 1H6S1 3A2SX 4XNLA 3AA6B 2N2LA 3AA7A 4FRXA 4KR8A 1IZNB 3T0SA 2KDYA 4AUIA 5AFUK 4FZNA 3UU2A 1MM5A 1ZHXA 3AA1B 4AFKA 4AKRA 3VZUX 1ZHZA 2PRNA 3UAQA 4GF4A 3RBHA 3SY9A 3T24A 4RLBA 4O4XA 3AA7B 4AKMA 3PRNA 4PUXA 5JDPA 1QJPA 3QRCA 4D64A 4G75A 5DL8A 4BUMX 2XTQA 1HXTA 3VE1A 3FYXA 3G7GA 4AKRB 4XNKA 2ZLDA 3WI5A 3GP6A 4E1SA 4GCPA 3SYSA 3AAEA 3VY8X 1ZHYA 1OSMA 2M07A 1PHOA 2XMXA 2ERVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ1 A;  2YPV A;  3HOL A;  1YS5 A;  2KDY A;  3PQS A;  2W81 C;  2Y7S A;  4U9C A;  2LFU A;  4AYM C;  4AYD C;  3UAQ A;  5T5F A;  3KVD D;  4O4X A;  4AYE C;  4O3X B;  3PQU A;  4O3Y A;  4O3Z A;  2KC0 A;  3VE1 A;  5EE2 A;  4AYI D;  4O49 A;  4O4U A;  3V8U A;  3HOE A;  4Z3T A;  4AYN A;  3VE2 A;  4O3W A;  2W80 C; 
#chains in the Genus database with same CATH topology
 2F1C X;  2Y0L A;  3HOL A;  4FES A;  4N75 A;  4E1T A;  5ADX K;  2R4P A;  1GFM A;  1P4T A;  5G26 A;  4KRA A;  2KZ7 A;  1BT9 A;  1THQ A;  3HW9 A;  2MHL A;  4G76 A;  4GHB A;  4CTD A;  1BH3 A;  1ZHW A;  5G38 A;  1BXW A;  1GFO A;  2LHF A;  4IL6 O;  2XG6 A;  3C5O A;  4JCH A;  2MNH A;  2XTR A;  3PQU A;  3WU2 O;  2KZ7 B;  2Y0K A;  1ZHT A;  4N59 A;  3QRA A;  3VZT X;  3A0H O;  4LSE A;  4AZL A;  2JMM A;  1OPF A;  3POQ A;  4JFB A;  2XE1 A;  3HWB A;  3NJT A;  4LSF A;  2ODJ A;  1ORM A;  3LK4 2;  2KXP A;  2XE2 A;  2R8A A;  5DL7 A;  5AFU L;  5H2F O;  1HXU A;  3AA0 A;  1PRN A;  4D5U A;  3LK4 1;  4LSH A;  4GCQ A;  3POU A;  3SZV A;  2FGQ X;  3SY7 A;  2R4O A;  2WJR A;  2WJQ A;  4QQ1 A;  2K4T A;  4C00 A;  3WI4 A;  1HXX A;  1QJ8 A;  3PQS A;  2W81 C;  4U9C A;  5KAI O;  2KXP B;  5IYU A;  1GFP A;  2O4V A;  2GE4 A;  4FZM A;  4K3C A;  3TZG A;  3AA0 B;  4AYM C;  2ZFG A;  3JTY A;  6PRN A;  3AAE B;  2Y2X A;  2XMX A;  2JQY A;  3KVD D;  3BRY A;  4AYE C;  2Y0H A;  1Q9G A;  4LSI A;  3KZI O;  3DA3 A;  4FMS A;  4PJ0 O;  2POR A;  2OMF A;  2X27 X;  3T20 A;  4FSO A;  1GFQ A;  2J1N A;  2KC0 A;  3POR A;  3LK3 A;  5EE2 A;  4AYI D;  3PGR A;  2M06 A;  4O4U A;  4N58 A;  8PRN A;  5GV0 A;  3V8U A;  3BRZ A;  4KR4 A;  5E79 O;  4C69 X;  4AYN A;  3EMN X;  3POX A;  1S5L O;  1Q9F A;  4B61 A;  4F4B A;  4GCS A;  3NSG A;  2F1T A;  3AAA A;  3DZM A;  3PGU A;  4FT6 A;  2YPV A;  4RLC A;  5DL5 A;  1YS5 A;  3LK2 A;  1T16 A;  2FGR A;  2XE3 A;  3LK3 B;  2Y7S A;  3BS0 A;  4FZL A;  5GTI O;  3SZD A;  5GTH O;  2J4U P;  4PR7 A;  4FOZ A;  4RJW A;  2LFU A;  3JCU O;  2N2M A;  2QTK A;  3O0E A;  5TIS O;  4AYD C;  1QJ9 A;  3VY9 X;  3DA4 A;  4FUV A;  2K0L A;  5D5D A;  5T5F A;  1MM4 A;  3AAA B;  4O3X B;  5PRN A;  5B5E O;  1G90 A;  3LK2 B;  4O3Y A;  4O3Z A;  4RL9 A;  2YNK A;  3VZW X;  3AA6 A;  4FRT A;  4UB6 O;  1IZN A;  2R4N A;  5FVN A;  5B66 O;  3UPG A;  4O49 A;  4K3B A;  3SYB A;  5DL6 A;  2X9K A;  4RJX A;  2XE5 A;  3HOE A;  2WVP A;  5ADX L;  2R4L A;  2F1V A;  3AA1 A;  4D65 A;  3VE2 A;  3K19 A;  4O3W A;  4Z3T A;  1GFN A;  1MPF A;  4FSP A;  7PRN A;  1H6S 1;  2W80 C;  3A2S X;  4XNL A;  4N74 A;  3AA6 B;  2N2L A;  3AA7 A;  4FRX A;  4KR8 A;  1IZN B;  4C4V A;  3T0S A;  2KDY A;  4AUI A;  3DWO X;  5AFU K;  4FZN A;  3UU2 A;  3A0B O;  1MM5 A;  1ZHX A;  3AA1 B;  4AFK A;  3PGS A;  5G3A A;  4AKR A;  3VZU X;  1ZHZ A;  2PRN A;  3UAQ A;  5G39 A;  4GF4 A;  3RBH A;  3SY9 A;  3T24 A;  4RLB A;  4O4X A;  3AA7 B;  4UB8 O;  4AKM A;  3PRN A;  2IWV A;  3PF1 A;  4PUX A;  4C4V B;  5JDP A;  1QJP A;  3QRC A;  4D64 A;  4FQE A;  4G75 A;  5DL8 A;  4BUM X;  2XTQ A;  1HXT A;  3VE1 A;  3FYX A;  2AXT O;  3G7G A;  4AKR B;  2R88 A;  4XNK A;  2ZLD A;  3WI5 A;  3DWN A;  2IWW A;  1T1L A;  3GP6 A;  4E1S A;  2R89 A;  4GCP A;  3SYS A;  3AAE A;  3VY8 X;  5KAF O;  1ZHY A;  1OSM A;  2M07 A;  1PHO A;  1E54 A;  2ERV A; 
#chains in the Genus database with same CATH homology
 2Y0L A;  3HOL A;  4FES A;  4E1T A;  5ADX K;  1GFM A;  1P4T A;  5G26 A;  4KRA A;  2KZ7 A;  1BT9 A;  1THQ A;  3HW9 A;  2MHL A;  4G76 A;  4GHB A;  1BH3 A;  1ZHW A;  1BXW A;  1GFO A;  2LHF A;  2XG6 A;  3C5O A;  4JCH A;  2MNH A;  2XTR A;  3PQU A;  2KZ7 B;  2Y0K A;  1ZHT A;  4N59 A;  3QRA A;  3VZT X;  4LSE A;  4AZL A;  2JMM A;  1OPF A;  3POQ A;  4JFB A;  2XE1 A;  3HWB A;  4LSF A;  2ODJ A;  1ORM A;  3LK4 2;  2KXP A;  2XE2 A;  5DL7 A;  5AFU L;  1HXU A;  3AA0 A;  1PRN A;  4D5U A;  3LK4 1;  4LSH A;  4GCQ A;  3POU A;  3SZV A;  2FGQ X;  3SY7 A;  4QQ1 A;  2K4T A;  3WI4 A;  1HXX A;  1QJ8 A;  3PQS A;  2W81 C;  4U9C A;  5IYU A;  2KXP B;  1GFP A;  2O4V A;  2GE4 A;  4FZM A;  3TZG A;  3AA0 B;  4AYM C;  2ZFG A;  3JTY A;  6PRN A;  3AAE B;  2Y2X A;  3KVD D;  4AYE C;  2Y0H A;  1Q9G A;  4LSI A;  3DA3 A;  4FMS A;  2POR A;  2OMF A;  2X27 X;  3T20 A;  4FSO A;  1GFQ A;  2J1N A;  2KC0 A;  3POR A;  3LK3 A;  5EE2 A;  4AYI D;  8PRN A;  2M06 A;  4O4U A;  4N58 A;  5GV0 A;  3V8U A;  4KR4 A;  4C69 X;  4AYN A;  3EMN X;  3POX A;  4B61 A;  1Q9F A;  4F4B A;  4GCS A;  3NSG A;  2F1T A;  3AAA A;  4FT6 A;  4RLC A;  2YPV A;  5DL5 A;  1YS5 A;  3LK2 A;  2XE3 A;  2FGR A;  3LK3 B;  4FZL A;  2Y7S A;  3SZD A;  2J4U P;  4FOZ A;  4RJW A;  2LFU A;  2N2M A;  2QTK A;  3O0E A;  4AYD C;  1QJ9 A;  3VY9 X;  3DA4 A;  4FUV A;  2K0L A;  5D5D A;  5T5F A;  1MM4 A;  3AAA B;  4O3X B;  5PRN A;  1G90 A;  3LK2 B;  4O3Y A;  4O3Z A;  4RL9 A;  2YNK A;  3VZW X;  3AA6 A;  4FRT A;  1IZN A;  1E54 A;  5FVN A;  3UPG A;  4O49 A;  3SYB A;  5DL6 A;  4RJX A;  2XE5 A;  3HOE A;  5ADX L;  3AA1 A;  2F1V A;  4Z3T A;  4D65 A;  3VE2 A;  3K19 A;  4O3W A;  1GFN A;  1MPF A;  4FSP A;  7PRN A;  2W80 C;  1H6S 1;  3A2S X;  4XNL A;  3AA6 B;  2N2L A;  3AA7 A;  4FRX A;  4KR8 A;  1IZN B;  3T0S A;  2KDY A;  4AUI A;  5AFU K;  4FZN A;  3UU2 A;  1MM5 A;  1ZHX A;  3AA1 B;  4AFK A;  4AKR A;  3VZU X;  1ZHZ A;  2PRN A;  3UAQ A;  4GF4 A;  3RBH A;  3SY9 A;  3T24 A;  4RLB A;  4O4X A;  3AA7 B;  4AKM A;  3PRN A;  4PUX A;  5JDP A;  1QJP A;  3QRC A;  4D64 A;  4G75 A;  5DL8 A;  4BUM X;  2XTQ A;  1HXT A;  3VE1 A;  3FYX A;  3G7G A;  4AKR B;  4XNK A;  2ZLD A;  3WI5 A;  3GP6 A;  4E1S A;  4GCP A;  3SYS A;  3AAE A;  3VY8 X;  1ZHY A;  1OSM A;  2M07 A;  1PHO A;  2XMX A;  2ERV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...