5EE2A

The crystal structure of the c-terminal beta-barrel of hpua from neisseria gonorrhoeae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
122
Chain Sequence
LSKGKITYQVWGIRVRNGQFVTSSVLSFITANFNSNTLAGKILGNSDYGPDVDIQNATITGPTFSGDATSGGKSGKLEGKFFEVSIGGKITFDGDRSLDTVFGGVSYEKKLDDTSQDTNHLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of haemoglobin binding by HpuA from the Neisseriaceae family.
pubmed doi rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Metal transport
molecule keywords Hemoglobin-haptoglobin-utilization protein
total genus 27
structure length 122
sequence length 148
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5ee2A00
3VE1A 3UAQA 4O3YA 5EE2A 3KVDD 2KC0A 4AYNA 2W80C 2W81C 4QQ1A 3V8UA 4O3WA 3HOLA 1YS5A 4AYDC 3VE2A 4Z3TA 2Y7SA 4O49A 3PQUA 4AYID 2LFUA 3PQSA 4AYEC 4U9CA 4O3ZA 4O3XB 2KDYA 4O4UA 4O4XA 4AYMC 2YPVA 3HOEA 5T5FA
chains in the Genus database with same CATH superfamily
3VE1A 3VZTX 4BUMX 4XNLA 1IZNA 2XE3A 3C5OA 3PORA 4LSHA 4D5UA 2IWWA 1QJ9A 5DL6A 2Y2XA 1H6S1 2J1NA 2KXPB 2KXPA 4N58A 3AAAB 3DWOX 3WI4A 5ADXL 2KC0A 5AFUK 1MM5A 2R4NA 1OSMA 2R89A 2W81C 2W80C 3G7GA 4PJ0O 5G3AA 5PRNA 2PRNA 4O3WA 3HOLA 3V8UA 4B61A 1PHOA 1ZHZA 1P4TA 1YS5A 2GE4A 2M07A 3PRNA 5G38A 3AAEA 2ODJA 3AAEB 1THQA 2XE1A 2XTRA 2Y7SA 5DL7A 1QJPA 1HXTA 7PRNA 4RL9A 4D65A 2R8AA 5DL8A 3LK42 4GCSA 4RLBA 2ERVA 4U9CA 1BXWA 1MM4A 4KR8A 2XMXA 4FZMA 3RBHA 5KAIO 1BH3A 1MPFA 2K4TA 1HXXA 2Y0HA 2R88A 5GTIO 3BRYA 3POUA 3AA1B 4FESA 2KZ7B 4PR7A 4KRAA 4E1SA 4O3YA 1T1LA 4FMSA 2WJRA 1ORMA 5G26A 3PF1A 3DA3A 4N59A 3QRAA 4AFKA 1OPFA 3DWNA 3PGUA 2FGRA 4FZLA 1T16A 3DZMA 2IWVA 3A0HO 4GHBA 4AZLA 3WU2O 4XNKA 4JCHA 3POXA 4PUXA 5GV0A 1G90A 2OMFA 2MNHA 3LK2A 3VY8X 2XG6A 4FT6A 1Q9GA 3KZIO 2Y0LA 4N74A 4AYID 2QTKA 5AFUL 2LFUA 4AYEC 3JTYA 4GCQA 2R4OA 2MHLA 3A2SX 1QJ8A 2N2LA 3LK3A 2O4VA 2X9KA 3AA0A 2JQYA 3O0EA 4O3XB 2KDYA 2XE2A 2X27X 4O4XA 5JDPA 3HOEA 4FRTA 5T5FA 1GFOA 4E1TA 4G75A 5G39A 3UAQA 5H2FO 4LSFA 4FOZA 4AUIA 4FRXA 3SZVA 3FYXA 5B66O 1ZHWA 2PORA 2AXTO 4UB8O 4QQ1A 4C4VB 5KAFO 1ZHXA 3AAAA 5TISO 3GP6A 4Z3TA 3T20A 1Q9FA 2LHFA 3PGRA 3PGSA 4AKRA 1IZNB 2Y0KA 2F1CX 3VE2A 1GFMA 2M06A 4F4BA 3K19A 3PQUA 4AKRB 1GFNA 1GFQA 3A0BO 1ZHTA 3EMNX 3LK3B 4IL6O 3PQSA 3AA6B 2F1VA 4G76A 5DL5A 4C4VA 5B5EO 4C69X 4FUVA 2WJQA 4AYMC 2K0LA 3NSGA 2XTQA 3LK2B 3NJTA 2XE5A 3POQA 3SYSA 4C00A 3SY9A 4FZNA 4K3BA 1HXUA 3AA7B 4GF4A 4FQEA 3BS0A 1ZHYA 3VY9X 1GFPA 2R4LA 3JCUO 5EE2A 3TZGA 3AA0B 4RJXA 2N2MA 3SZDA 3T24A 3VZWX 3KVDD 4GCPA 3SY7A 4D64A 5GTHO 3SYBA 1E54A 2ZLDA 3VZUX 1S5LO 4AYNA 5IYUA 4LSEA 4K3CA 2KZ7A 2YNKA 1BT9A 3AA1A 8PRNA 4RJWA 5E79O 4AYDC 2WVPA 4FSOA 4RLCA 6PRNA 2FGQX 3DA4A 3BRZA 4JFBA 4N75A 2F1TA 4O49A 2R4PA 4CTDA 4LSIA 3HW9A 2J4UP 4KR4A 3UPGA 3HWBA 5ADXK 2ZFGA 2JMMA 4UB6O 4FSPA 5FVNA 3UU2A 3AA7A 5D5DA 3T0SA 3LK41 4O3ZA 3QRCA 1PRNA 4O4UA 3WI5A 3AA6A 2YPVA 4AKMA
chains in the Genus database with same CATH topology
3VE1A 3VZTX 4BUMX 4XNLA 1IZNA 2XE3A 3C5OA 3PORA 4LSHA 4D5UA 1QJ9A 5DL6A 2Y2XA 1H6S1 2J1NA 2KXPB 2KXPA 4N58A 3AAAB 3WI4A 5ADXL 2KC0A 5AFUK 1MM5A 2W80C 1OSMA 2W81C 3G7GA 5PRNA 3V8UA 4B61A 2PRNA 4O3WA 3HOLA 1PHOA 1ZHZA 1P4TA 1YS5A 2GE4A 2M07A 3PRNA 4Z3TA 3AAEA 2ODJA 3AAEB 2Y7SA 1THQA 2XE1A 2XTRA 5DL7A 1QJPA 1HXTA 7PRNA 4RL9A 4D65A 5DL8A 3LK42 4GCSA 4RLBA 2ERVA 4U9CA 1BXWA 1MM4A 4KR8A 2XMXA 4FZMA 3RBHA 1BH3A 1MPFA 2K4TA 1HXXA 2Y0HA 3POUA 3AA1B 4FESA 2KZ7B 4KRAA 4E1SA 4O3YA 4FMSA 1ORMA 3DA3A 4N59A 3QRAA 4AFKA 1OPFA 2FGRA 4FZLA 4GHBA 4AZLA 4XNKA 4JCHA 3POXA 4PUXA 5GV0A 1G90A 2OMFA 2MNHA 3LK2A 3VY8X 2XG6A 4FT6A 1Q9GA 4AYID 2Y0LA 2QTKA 5AFUL 2LFUA 4AYEC 3JTYA 4GCQA 3A2SX 2MHLA 1QJ8A 2N2LA 3LK3A 2O4VA 3AA0A 3O0EA 4O3XB 2KDYA 2XE2A 2X27X 4O4XA 5JDPA 3HOEA 4FRTA 5T5FA 1GFOA 4E1TA 4G75A 3UAQA 4LSFA 4FOZA 4AUIA 4FRXA 3SZVA 3FYXA 1ZHWA 2PORA 4QQ1A 3T20A 1ZHXA 3AAAA 3GP6A 1Q9FA 2LHFA 4AKRA 1IZNB 2Y0KA 3VE2A 1GFMA 2M06A 4F4BA 3K19A 3PQUA 4AKRB 1GFNA 1GFQA 3EMNX 1ZHTA 3LK3B 5G26A 5DL5A 3PQSA 3AA6B 2F1VA 4G76A 4C69X 4FUVA 4AYMC 2K0LA 3NSGA 2XTQA 3LK2B 2XE5A 3POQA 3SYSA 3SY9A 4FZNA 1HXUA 3AA7B 4GF4A 1ZHYA 3VY9X 1GFPA 3TZGA 5EE2A 3AA0B 4RJXA 2N2MA 3SZDA 3T24A 3VZWX 3KVDD 4GCPA 3SY7A 4D64A 3SYBA 1E54A 2ZLDA 3VZUX 4AYNA 5IYUA 4LSEA 2KZ7A 2YNKA 1BT9A 3AA1A 8PRNA 4RJWA 4AYDC 4RLCA 4FSOA 6PRNA 2FGQX 3DA4A 2J4UP 4JFBA 4O49A 2F1TA 3UPGA 4LSIA 3HW9A 4KR4A 3HWBA 5ADXK 2ZFGA 2JMMA 4FSPA 5FVNA 3UU2A 3AA7A 5D5DA 3T0SA 3LK41 4O3ZA 3QRCA 1PRNA 4O4UA 3WI5A 3AA6A 2YPVA 4AKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE1 A;  3UAQ A;  4O3Y A;  5EE2 A;  3KVD D;  2KC0 A;  4AYN A;  2W80 C;  2W81 C;  4QQ1 A;  3V8U A;  4O3W A;  3HOL A;  1YS5 A;  4AYD C;  3VE2 A;  4Z3T A;  2Y7S A;  4O49 A;  3PQU A;  4AYI D;  2LFU A;  3PQS A;  4AYE C;  4U9C A;  4O3Z A;  4O3X B;  2KDY A;  4O4U A;  4O4X A;  4AYM C;  2YPV A;  3HOE A;  5T5F A; 
#chains in the Genus database with same CATH topology
 3VE1 A;  3VZT X;  4BUM X;  4XNL A;  1IZN A;  2XE3 A;  3C5O A;  3POR A;  4LSH A;  4D5U A;  2IWW A;  1QJ9 A;  5DL6 A;  2Y2X A;  1H6S 1;  2J1N A;  2KXP B;  2KXP A;  4N58 A;  3AAA B;  3DWO X;  3WI4 A;  5ADX L;  2KC0 A;  5AFU K;  1MM5 A;  2R4N A;  1OSM A;  2R89 A;  2W81 C;  2W80 C;  3G7G A;  4PJ0 O;  5G3A A;  5PRN A;  2PRN A;  4O3W A;  3HOL A;  3V8U A;  4B61 A;  1PHO A;  1ZHZ A;  1P4T A;  1YS5 A;  2GE4 A;  2M07 A;  3PRN A;  5G38 A;  3AAE A;  2ODJ A;  3AAE B;  1THQ A;  2XE1 A;  2XTR A;  2Y7S A;  5DL7 A;  1QJP A;  1HXT A;  7PRN A;  4RL9 A;  4D65 A;  2R8A A;  5DL8 A;  3LK4 2;  4GCS A;  4RLB A;  2ERV A;  4U9C A;  1BXW A;  1MM4 A;  4KR8 A;  2XMX A;  4FZM A;  3RBH A;  5KAI O;  1BH3 A;  1MPF A;  2K4T A;  1HXX A;  2Y0H A;  2R88 A;  5GTI O;  3BRY A;  3POU A;  3AA1 B;  4FES A;  2KZ7 B;  4PR7 A;  4KRA A;  4E1S A;  4O3Y A;  1T1L A;  4FMS A;  2WJR A;  1ORM A;  5G26 A;  3PF1 A;  3DA3 A;  4N59 A;  3QRA A;  4AFK A;  1OPF A;  3DWN A;  3PGU A;  2FGR A;  4FZL A;  1T16 A;  3DZM A;  2IWV A;  3A0H O;  4GHB A;  4AZL A;  3WU2 O;  4XNK A;  4JCH A;  3POX A;  4PUX A;  5GV0 A;  1G90 A;  2OMF A;  2MNH A;  3LK2 A;  3VY8 X;  2XG6 A;  4FT6 A;  1Q9G A;  3KZI O;  2Y0L A;  4N74 A;  4AYI D;  2QTK A;  5AFU L;  2LFU A;  4AYE C;  3JTY A;  4GCQ A;  2R4O A;  2MHL A;  3A2S X;  1QJ8 A;  2N2L A;  3LK3 A;  2O4V A;  2X9K A;  3AA0 A;  2JQY A;  3O0E A;  4O3X B;  2KDY A;  2XE2 A;  2X27 X;  4O4X A;  5JDP A;  3HOE A;  4FRT A;  5T5F A;  1GFO A;  4E1T A;  4G75 A;  5G39 A;  3UAQ A;  5H2F O;  4LSF A;  4FOZ A;  4AUI A;  4FRX A;  3SZV A;  3FYX A;  5B66 O;  1ZHW A;  2POR A;  2AXT O;  4UB8 O;  4QQ1 A;  4C4V B;  5KAF O;  1ZHX A;  3AAA A;  5TIS O;  3GP6 A;  4Z3T A;  3T20 A;  1Q9F A;  2LHF A;  3PGR A;  3PGS A;  4AKR A;  1IZN B;  2Y0K A;  2F1C X;  3VE2 A;  1GFM A;  2M06 A;  4F4B A;  3K19 A;  3PQU A;  4AKR B;  1GFN A;  1GFQ A;  3A0B O;  1ZHT A;  3EMN X;  3LK3 B;  4IL6 O;  3PQS A;  3AA6 B;  2F1V A;  4G76 A;  5DL5 A;  4C4V A;  5B5E O;  4C69 X;  4FUV A;  2WJQ A;  4AYM C;  2K0L A;  3NSG A;  2XTQ A;  3LK2 B;  3NJT A;  2XE5 A;  3POQ A;  3SYS A;  4C00 A;  3SY9 A;  4FZN A;  4K3B A;  1HXU A;  3AA7 B;  4GF4 A;  4FQE A;  3BS0 A;  1ZHY A;  3VY9 X;  1GFP A;  2R4L A;  3JCU O;  5EE2 A;  3TZG A;  3AA0 B;  4RJX A;  2N2M A;  3SZD A;  3T24 A;  3VZW X;  3KVD D;  4GCP A;  3SY7 A;  4D64 A;  5GTH O;  3SYB A;  1E54 A;  2ZLD A;  3VZU X;  1S5L O;  4AYN A;  5IYU A;  4LSE A;  4K3C A;  2KZ7 A;  2YNK A;  1BT9 A;  3AA1 A;  8PRN A;  4RJW A;  5E79 O;  4AYD C;  2WVP A;  4FSO A;  4RLC A;  6PRN A;  2FGQ X;  3DA4 A;  3BRZ A;  4JFB A;  4N75 A;  2F1T A;  4O49 A;  2R4P A;  4CTD A;  4LSI A;  3HW9 A;  2J4U P;  4KR4 A;  3UPG A;  3HWB A;  5ADX K;  2ZFG A;  2JMM A;  4UB6 O;  4FSP A;  5FVN A;  3UU2 A;  3AA7 A;  5D5D A;  3T0S A;  3LK4 1;  4O3Z A;  3QRC A;  1PRN A;  4O4U A;  3WI5 A;  3AA6 A;  2YPV A;  4AKM A; 
#chains in the Genus database with same CATH homology
 3VE1 A;  3VZT X;  4BUM X;  4XNL A;  1IZN A;  2XE3 A;  3C5O A;  3POR A;  4LSH A;  4D5U A;  1QJ9 A;  5DL6 A;  2Y2X A;  1H6S 1;  2J1N A;  2KXP B;  2KXP A;  4N58 A;  3AAA B;  3WI4 A;  5ADX L;  2KC0 A;  5AFU K;  1MM5 A;  2W80 C;  1OSM A;  2W81 C;  3G7G A;  5PRN A;  3V8U A;  4B61 A;  2PRN A;  4O3W A;  3HOL A;  1PHO A;  1ZHZ A;  1P4T A;  1YS5 A;  2GE4 A;  2M07 A;  3PRN A;  4Z3T A;  3AAE A;  2ODJ A;  3AAE B;  2Y7S A;  1THQ A;  2XE1 A;  2XTR A;  5DL7 A;  1QJP A;  1HXT A;  7PRN A;  4RL9 A;  4D65 A;  5DL8 A;  3LK4 2;  4GCS A;  4RLB A;  2ERV A;  4U9C A;  1BXW A;  1MM4 A;  4KR8 A;  2XMX A;  4FZM A;  3RBH A;  1BH3 A;  1MPF A;  2K4T A;  1HXX A;  2Y0H A;  3POU A;  3AA1 B;  4FES A;  2KZ7 B;  4KRA A;  4E1S A;  4O3Y A;  4FMS A;  1ORM A;  3DA3 A;  4N59 A;  3QRA A;  4AFK A;  1OPF A;  2FGR A;  4FZL A;  4GHB A;  4AZL A;  4XNK A;  4JCH A;  3POX A;  4PUX A;  5GV0 A;  1G90 A;  2OMF A;  2MNH A;  3LK2 A;  3VY8 X;  2XG6 A;  4FT6 A;  1Q9G A;  4AYI D;  2Y0L A;  2QTK A;  5AFU L;  2LFU A;  4AYE C;  3JTY A;  4GCQ A;  3A2S X;  2MHL A;  1QJ8 A;  2N2L A;  3LK3 A;  2O4V A;  3AA0 A;  3O0E A;  4O3X B;  2KDY A;  2XE2 A;  2X27 X;  4O4X A;  5JDP A;  3HOE A;  4FRT A;  5T5F A;  1GFO A;  4E1T A;  4G75 A;  3UAQ A;  4LSF A;  4FOZ A;  4AUI A;  4FRX A;  3SZV A;  3FYX A;  1ZHW A;  2POR A;  4QQ1 A;  3T20 A;  1ZHX A;  3AAA A;  3GP6 A;  1Q9F A;  2LHF A;  4AKR A;  1IZN B;  2Y0K A;  3VE2 A;  1GFM A;  2M06 A;  4F4B A;  3K19 A;  3PQU A;  4AKR B;  1GFN A;  1GFQ A;  3EMN X;  1ZHT A;  3LK3 B;  5G26 A;  5DL5 A;  3PQS A;  3AA6 B;  2F1V A;  4G76 A;  4C69 X;  4FUV A;  4AYM C;  2K0L A;  3NSG A;  2XTQ A;  3LK2 B;  2XE5 A;  3POQ A;  3SYS A;  3SY9 A;  4FZN A;  1HXU A;  3AA7 B;  4GF4 A;  1ZHY A;  3VY9 X;  1GFP A;  3TZG A;  5EE2 A;  3AA0 B;  4RJX A;  2N2M A;  3SZD A;  3T24 A;  3VZW X;  3KVD D;  4GCP A;  3SY7 A;  4D64 A;  3SYB A;  1E54 A;  2ZLD A;  3VZU X;  4AYN A;  5IYU A;  4LSE A;  2KZ7 A;  2YNK A;  1BT9 A;  3AA1 A;  8PRN A;  4RJW A;  4AYD C;  4RLC A;  4FSO A;  6PRN A;  2FGQ X;  3DA4 A;  2J4U P;  4JFB A;  4O49 A;  2F1T A;  3UPG A;  4LSI A;  3HW9 A;  4KR4 A;  3HWB A;  5ADX K;  2ZFG A;  2JMM A;  4FSP A;  5FVN A;  3UU2 A;  3AA7 A;  5D5D A;  3T0S A;  3LK4 1;  4O3Z A;  3QRC A;  1PRN A;  4O4U A;  3WI5 A;  3AA6 A;  2YPV A;  4AKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...