5EE2A

The crystal structure of the c-terminal beta-barrel of hpua from neisseria gonorrhoeae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
122
Chain Sequence
LSKGKITYQVWGIRVRNGQFVTSSVLSFITANFNSNTLAGKILGNSDYGPDVDIQNATITGPTFSGDATSGGKSGKLEGKFFEVSIGGKITFDGDRSLDTVFGGVSYEKKLDDTSQDTNHLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of haemoglobin binding by HpuA from the Neisseriaceae family.
pubmed doi rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Metal transport
molecule keywords Hemoglobin-haptoglobin-utilization protein
total genus 27
structure length 122
sequence length 148
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5ee2A00
3VE1A 5T5FA 1YS5A 3HOLA 4AYDC 3PQUA 3KVDD 4Z3TA 2KDYA 2W81C 4O4XA 4O3WA 2YPVA 3PQSA 3UAQA 4O49A 4QQ1A 4AYNA 4AYMC 2LFUA 4O3YA 4U9CA 2Y7SA 4AYID 3HOEA 4O3XB 2KC0A 4O3ZA 3VE2A 4AYEC 2W80C 5EE2A 3V8UA 4O4UA
chains in the Genus database with same CATH superfamily
3DA3A 3AAAA 4AKMA 3QRCA 5G38A 3VZUX 2LHFA 4D65A 2WJRA 2Y0HA 1QJ8A 1S5LO 3AA0B 1PRNA 1PHOA 3HOLA 3PF1A 4RLBA 5DL8A 5FVNA 3T0SA 4XNLA 4FUVA 2K0LA 2W81C 3LK3B 3AAEB 3PGSA 5JDPA 3PQSA 2M07A 3TZGA 3SZVA 3KZIO 1MM5A 3NSGA 4AYNA 2LFUA 7PRNA 3K19A 3SY7A 4E1TA 2O4VA 2AXTO 2XTRA 4N74A 1QJ9A 3AA1A 4LSEA 5B5EO 2WJQA 3AA7A 1HXTA 1T1LA 5G39A 1HXXA 2XMXA 2XTQA 2ODJA 3DWOX 4C00A 2R8AA 3C5OA 3SYSA 3PORA 3VY9X 4JFBA 4FZLA 3VE2A 2R4NA 1ZHTA 3O0EA 5DL5A 4AYEC 4E1SA 2YNKA 1MPFA 2PORA 3NJTA 4RLCA 3BS0A 4D5UA 4D64A 3A0BO 3HOEA 4C4VA 3VE1A 6PRNA 5AFUL 2J4UP 4GCPA 2Y0KA 5T5FA 4FMSA 4FSOA 3AA6B 3PRNA 4GHBA 3LK2A 2M06A 5G3AA 2KXPA 5GTHO 4FQEA 3KVDD 1H6S1 3SY9A 4GF4A 4AKRB 5IYUA 2OMFA 4GCSA 4O4XA 5DL7A 2YPVA 2MNHA 2R4OA 4XNKA 2FGRA 4PR7A 1ZHYA 2WVPA 1BT9A 5GTIO 3UPGA 3G7GA 3POUA 3QRAA 4FT6A 4GCQA 2XE1A 2Y7SA 3HWBA 4K3BA 4G76A 4N59A 4B61A 3WI5A 3LK3A 4FRXA 3AAEA 3EMNX 2PRNA 2KC0A 3SYBA 3PGRA 4O3ZA 1Q9FA 3AA1B 2JMMA 5H2FO 2W80C 4N75A 2R89A 4FESA 4AUIA 3LK41 2R4LA 1ORMA 2XG6A 3BRYA 4O3YA 4RL9A 3WU2O 3POQA 2F1CX 2R88A 2KZ7A 4LSFA 1G90A 1Q9GA 1MM4A 5E79O 3DA4A 3PGUA 4FRTA 3SZDA 4Z3TA 1IZNB 1BXWA 2ZLDA 2F1TA 2ZFGA 3LK42 4RJXA 3LK2B 3UAQA 8PRNA 3GP6A 4G75A 2N2MA 4AYMC 1BH3A 4U9CA 2JQYA 5TISO 5ADXK 4AYID 1HXUA 4AKRA 3UU2A 4RJWA 1ZHXA 4FOZA 4LSHA 4O3XB 5B66O 2FGQX 5GV0A 2R4PA 3DWNA 3RBHA 1OPFA 4FSPA 4CTDA 3T20A 4N58A 4FZMA 3HW9A 3AAAB 2F1VA 2XE2A 2MHLA 2Y2XA 4IL6O 5ADXL 5EE2A 2XE5A 2GE4A 1THQA 2ERVA 3A0HO 3AA0A 3BRZA 5DL6A 4O4UA 3DZMA 3VZWX 5D5DA 5AFUK 4UB8O 4KRAA 1YS5A 4AYDC 3PQUA 2X27X 2Y0LA 3JTYA 5KAFO 2IWWA 4AZLA 2KDYA 1GFOA 3T24A 1ZHWA 4O3WA 1ZHZA 1OSMA 2KZ7B 3AA7B 4AFKA 3VY8X 4O49A 1GFPA 3JCUO 4KR8A 4QQ1A 1IZNA 1QJPA 5PRNA 1GFNA 1GFMA 4JCHA 1T16A 4UB6O 2N2LA 1E54A 1P4TA 5KAIO 2X9KA 3VZTX 4PJ0O 1GFQA 3WI4A 2K4TA 3POXA 4C4VB 4F4BA 2IWVA 4K3CA 5G26A 2QTKA 4PUXA 3AA6A 4LSIA 3A2SX 4C69X 2KXPB 4KR4A 3V8UA 2J1NA 3FYXA 4FZNA 2XE3A 4BUMX
chains in the Genus database with same CATH topology
3DA3A 3AAAA 4AKMA 3QRCA 3VZUX 4D65A 2LHFA 2Y0HA 3HOLA 1QJ8A 3AA0B 1PRNA 1PHOA 4RLBA 5DL8A 5FVNA 3T0SA 4XNLA 4FUVA 2K0LA 2W81C 3LK3B 3AAEB 5JDPA 3PQSA 2M07A 3TZGA 3SZVA 1MM5A 3NSGA 4AYNA 2LFUA 7PRNA 3K19A 3SY7A 4E1TA 2O4VA 2XTRA 1QJ9A 3AA1A 4LSEA 3AA7A 1HXTA 1HXXA 2XMXA 2XTQA 2ODJA 3C5OA 3SYSA 3PORA 3VY9X 4JFBA 4FZLA 3VE2A 4AYEC 1ZHTA 3O0EA 5DL5A 2YNKA 1MPFA 2PORA 4RLCA 4D5UA 4D64A 3HOEA 3VE1A 6PRNA 5AFUL 2J4UP 4GCPA 2Y0KA 5T5FA 4FMSA 4FSOA 3AA6B 3PRNA 4GHBA 3LK2A 2M06A 2KXPA 3KVDD 1H6S1 3SY9A 4GF4A 4AKRB 5IYUA 2OMFA 4GCSA 4O4XA 5DL7A 2YPVA 2MNHA 4XNKA 2FGRA 1ZHYA 3UPGA 1BT9A 3G7GA 3POUA 3QRAA 4FT6A 4GCQA 2XE1A 2Y7SA 3HWBA 4N59A 4G76A 4O3YA 4B61A 3WI5A 3LK3A 4FRXA 3AAEA 3EMNX 2PRNA 2KC0A 3SYBA 4O3ZA 1Q9FA 3AA1B 2JMMA 2W80C 4FESA 4AUIA 3LK41 2XG6A 1ORMA 4RL9A 3POQA 2KZ7A 4LSFA 1G90A 1Q9GA 1MM4A 3DA4A 4FRTA 3SZDA 4Z3TA 1IZNB 1BXWA 2ZLDA 2F1TA 2ZFGA 3LK42 4RJXA 3LK2B 3UAQA 8PRNA 3GP6A 4G75A 2N2MA 4AYMC 1BH3A 4U9CA 5ADXK 4AYID 1HXUA 4AKRA 3UU2A 4RJWA 1ZHXA 4FOZA 4LSHA 4O3XB 2FGQX 5GV0A 3RBHA 1OPFA 4FSPA 3T20A 4N58A 4FZMA 3HW9A 3AAAB 2F1VA 2XE2A 2MHLA 2Y2XA 5ADXL 5EE2A 2XE5A 2GE4A 1THQA 2ERVA 3AA0A 5DL6A 4O4UA 3VZWX 5D5DA 5AFUK 4KRAA 1YS5A 4AYDC 3PQUA 2X27X 2Y0LA 3JTYA 4AZLA 2KDYA 1GFOA 3T24A 1ZHWA 4O3WA 1ZHZA 1OSMA 2KZ7B 3AA7B 4AFKA 3VY8X 4O49A 1GFPA 4KR8A 4QQ1A 1IZNA 1QJPA 5PRNA 1GFNA 1GFMA 4JCHA 2N2LA 1E54A 1P4TA 3WI4A 3VZTX 4E1SA 4F4BA 1GFQA 2K4TA 3POXA 5G26A 2QTKA 4PUXA 3AA6A 4LSIA 3A2SX 4C69X 2KXPB 4KR4A 3V8UA 2J1NA 3FYXA 4FZNA 2XE3A 4BUMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE1 A;  5T5F A;  1YS5 A;  3HOL A;  4AYD C;  3PQU A;  3KVD D;  4Z3T A;  2KDY A;  2W81 C;  4O4X A;  4O3W A;  2YPV A;  3PQS A;  3UAQ A;  4O49 A;  4QQ1 A;  4AYN A;  4AYM C;  2LFU A;  4O3Y A;  4U9C A;  2Y7S A;  4AYI D;  3HOE A;  4O3X B;  2KC0 A;  4O3Z A;  3VE2 A;  4AYE C;  2W80 C;  5EE2 A;  3V8U A;  4O4U A; 
#chains in the Genus database with same CATH topology
 3DA3 A;  3AAA A;  4AKM A;  3QRC A;  5G38 A;  3VZU X;  2LHF A;  4D65 A;  2WJR A;  2Y0H A;  1QJ8 A;  1S5L O;  3AA0 B;  1PRN A;  1PHO A;  3HOL A;  3PF1 A;  4RLB A;  5DL8 A;  5FVN A;  3T0S A;  4XNL A;  4FUV A;  2K0L A;  2W81 C;  3LK3 B;  3AAE B;  3PGS A;  5JDP A;  3PQS A;  2M07 A;  3TZG A;  3SZV A;  3KZI O;  1MM5 A;  3NSG A;  4AYN A;  2LFU A;  7PRN A;  3K19 A;  3SY7 A;  4E1T A;  2O4V A;  2AXT O;  2XTR A;  4N74 A;  1QJ9 A;  3AA1 A;  4LSE A;  5B5E O;  2WJQ A;  3AA7 A;  1HXT A;  1T1L A;  5G39 A;  1HXX A;  2XMX A;  2XTQ A;  2ODJ A;  3DWO X;  4C00 A;  2R8A A;  3C5O A;  3SYS A;  3POR A;  3VY9 X;  4JFB A;  4FZL A;  3VE2 A;  2R4N A;  1ZHT A;  3O0E A;  5DL5 A;  4AYE C;  4E1S A;  2YNK A;  1MPF A;  2POR A;  3NJT A;  4RLC A;  3BS0 A;  4D5U A;  4D64 A;  3A0B O;  3HOE A;  4C4V A;  3VE1 A;  6PRN A;  5AFU L;  2J4U P;  4GCP A;  2Y0K A;  5T5F A;  4FMS A;  4FSO A;  3AA6 B;  3PRN A;  4GHB A;  3LK2 A;  2M06 A;  5G3A A;  2KXP A;  5GTH O;  4FQE A;  3KVD D;  1H6S 1;  3SY9 A;  4GF4 A;  4AKR B;  5IYU A;  2OMF A;  4GCS A;  4O4X A;  5DL7 A;  2YPV A;  2MNH A;  2R4O A;  4XNK A;  2FGR A;  4PR7 A;  1ZHY A;  2WVP A;  1BT9 A;  5GTI O;  3UPG A;  3G7G A;  3POU A;  3QRA A;  4FT6 A;  4GCQ A;  2XE1 A;  2Y7S A;  3HWB A;  4K3B A;  4G76 A;  4N59 A;  4B61 A;  3WI5 A;  3LK3 A;  4FRX A;  3AAE A;  3EMN X;  2PRN A;  2KC0 A;  3SYB A;  3PGR A;  4O3Z A;  1Q9F A;  3AA1 B;  2JMM A;  5H2F O;  2W80 C;  4N75 A;  2R89 A;  4FES A;  4AUI A;  3LK4 1;  2R4L A;  1ORM A;  2XG6 A;  3BRY A;  4O3Y A;  4RL9 A;  3WU2 O;  3POQ A;  2F1C X;  2R88 A;  2KZ7 A;  4LSF A;  1G90 A;  1Q9G A;  1MM4 A;  5E79 O;  3DA4 A;  3PGU A;  4FRT A;  3SZD A;  4Z3T A;  1IZN B;  1BXW A;  2ZLD A;  2F1T A;  2ZFG A;  3LK4 2;  4RJX A;  3LK2 B;  3UAQ A;  8PRN A;  3GP6 A;  4G75 A;  2N2M A;  4AYM C;  1BH3 A;  4U9C A;  2JQY A;  5TIS O;  5ADX K;  4AYI D;  1HXU A;  4AKR A;  3UU2 A;  4RJW A;  1ZHX A;  4FOZ A;  4LSH A;  4O3X B;  5B66 O;  2FGQ X;  5GV0 A;  2R4P A;  3DWN A;  3RBH A;  1OPF A;  4FSP A;  4CTD A;  3T20 A;  4N58 A;  4FZM A;  3HW9 A;  3AAA B;  2F1V A;  2XE2 A;  2MHL A;  2Y2X A;  4IL6 O;  5ADX L;  5EE2 A;  2XE5 A;  2GE4 A;  1THQ A;  2ERV A;  3A0H O;  3AA0 A;  3BRZ A;  5DL6 A;  4O4U A;  3DZM A;  3VZW X;  5D5D A;  5AFU K;  4UB8 O;  4KRA A;  1YS5 A;  4AYD C;  3PQU A;  2X27 X;  2Y0L A;  3JTY A;  5KAF O;  2IWW A;  4AZL A;  2KDY A;  1GFO A;  3T24 A;  1ZHW A;  4O3W A;  1ZHZ A;  1OSM A;  2KZ7 B;  3AA7 B;  4AFK A;  3VY8 X;  4O49 A;  1GFP A;  3JCU O;  4KR8 A;  4QQ1 A;  1IZN A;  1QJP A;  5PRN A;  1GFN A;  1GFM A;  4JCH A;  1T16 A;  4UB6 O;  2N2L A;  1E54 A;  1P4T A;  5KAI O;  2X9K A;  3VZT X;  4PJ0 O;  1GFQ A;  3WI4 A;  2K4T A;  3POX A;  4C4V B;  4F4B A;  2IWV A;  4K3C A;  5G26 A;  2QTK A;  4PUX A;  3AA6 A;  4LSI A;  3A2S X;  4C69 X;  2KXP B;  4KR4 A;  3V8U A;  2J1N A;  3FYX A;  4FZN A;  2XE3 A;  4BUM X; 
#chains in the Genus database with same CATH homology
 3DA3 A;  3AAA A;  4AKM A;  3QRC A;  3VZU X;  4D65 A;  2LHF A;  2Y0H A;  3HOL A;  1QJ8 A;  3AA0 B;  1PRN A;  1PHO A;  4RLB A;  5DL8 A;  5FVN A;  3T0S A;  4XNL A;  4FUV A;  2K0L A;  2W81 C;  3LK3 B;  3AAE B;  5JDP A;  3PQS A;  2M07 A;  3TZG A;  3SZV A;  1MM5 A;  3NSG A;  4AYN A;  2LFU A;  7PRN A;  3K19 A;  3SY7 A;  4E1T A;  2O4V A;  2XTR A;  1QJ9 A;  3AA1 A;  4LSE A;  3AA7 A;  1HXT A;  1HXX A;  2XMX A;  2XTQ A;  2ODJ A;  3C5O A;  3SYS A;  3POR A;  3VY9 X;  4JFB A;  4FZL A;  3VE2 A;  4AYE C;  1ZHT A;  3O0E A;  5DL5 A;  2YNK A;  1MPF A;  2POR A;  4RLC A;  4D5U A;  4D64 A;  3HOE A;  3VE1 A;  6PRN A;  5AFU L;  2J4U P;  4GCP A;  2Y0K A;  5T5F A;  4FMS A;  4FSO A;  3AA6 B;  3PRN A;  4GHB A;  3LK2 A;  2M06 A;  2KXP A;  3KVD D;  1H6S 1;  3SY9 A;  4GF4 A;  4AKR B;  5IYU A;  2OMF A;  4GCS A;  4O4X A;  5DL7 A;  2YPV A;  2MNH A;  4XNK A;  2FGR A;  1ZHY A;  3UPG A;  1BT9 A;  3G7G A;  3POU A;  3QRA A;  4FT6 A;  4GCQ A;  2XE1 A;  2Y7S A;  3HWB A;  4N59 A;  4G76 A;  4O3Y A;  4B61 A;  3WI5 A;  3LK3 A;  4FRX A;  3AAE A;  3EMN X;  2PRN A;  2KC0 A;  3SYB A;  4O3Z A;  1Q9F A;  3AA1 B;  2JMM A;  2W80 C;  4FES A;  4AUI A;  3LK4 1;  2XG6 A;  1ORM A;  4RL9 A;  3POQ A;  2KZ7 A;  4LSF A;  1G90 A;  1Q9G A;  1MM4 A;  3DA4 A;  4FRT A;  3SZD A;  4Z3T A;  1IZN B;  1BXW A;  2ZLD A;  2F1T A;  2ZFG A;  3LK4 2;  4RJX A;  3LK2 B;  3UAQ A;  8PRN A;  3GP6 A;  4G75 A;  2N2M A;  4AYM C;  1BH3 A;  4U9C A;  5ADX K;  4AYI D;  1HXU A;  4AKR A;  3UU2 A;  4RJW A;  1ZHX A;  4FOZ A;  4LSH A;  4O3X B;  2FGQ X;  5GV0 A;  3RBH A;  1OPF A;  4FSP A;  3T20 A;  4N58 A;  4FZM A;  3HW9 A;  3AAA B;  2F1V A;  2XE2 A;  2MHL A;  2Y2X A;  5ADX L;  5EE2 A;  2XE5 A;  2GE4 A;  1THQ A;  2ERV A;  3AA0 A;  5DL6 A;  4O4U A;  3VZW X;  5D5D A;  5AFU K;  4KRA A;  1YS5 A;  4AYD C;  3PQU A;  2X27 X;  2Y0L A;  3JTY A;  4AZL A;  2KDY A;  1GFO A;  3T24 A;  1ZHW A;  4O3W A;  1ZHZ A;  1OSM A;  2KZ7 B;  3AA7 B;  4AFK A;  3VY8 X;  4O49 A;  1GFP A;  4KR8 A;  4QQ1 A;  1IZN A;  1QJP A;  5PRN A;  1GFN A;  1GFM A;  4JCH A;  2N2L A;  1E54 A;  1P4T A;  3WI4 A;  3VZT X;  4E1S A;  4F4B A;  1GFQ A;  2K4T A;  3POX A;  5G26 A;  2QTK A;  4PUX A;  3AA6 A;  4LSI A;  3A2S X;  4C69 X;  2KXP B;  4KR4 A;  3V8U A;  2J1N A;  3FYX A;  4FZN A;  2XE3 A;  4BUM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...