5EE2A

The crystal structure of the c-terminal beta-barrel of hpua from neisseria gonorrhoeae
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
148
structure length
122
Chain Sequence
LSKGKITYQVWGIRVRNGQFVTSSVLSFITANFNSNTLAGKILGNSDYGPDVDIQNATITGPTFSGDATSGGKSGKLEGKFFEVSIGGKITFDGDRSLDTVFGGVSYEKKLDDTSQDTNHLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Hemoglobin-haptoglobin-utilization protein
publication title Structural analysis of haemoglobin binding by HpuA from the Neisseriaceae family.
pubmed doi rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
total genus 27
structure length 122
sequence length 148
ec nomenclature
pdb deposition date 2015-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 5ee2A00
4AYID 3VE1A 4O3XB 1YS5A 4O49A 4O3YA 3PQUA 2Y7SA 2LFUA 5T5FA 3KVDD 2YPVA 4O4UA 3HOEA 4AYEC 3UAQA 4AYDC 3PQSA 4U9CA 4O3WA 4QQ1A 3V8UA 4O3ZA 2W81C 4O4XA 3HOLA 5EE2A 2W80C 4AYMC 2KDYA 4Z3TA 4AYNA 2KC0A 3VE2A
chains in the Genus database with same CATH superfamily
1GFQA 3LK41 4RLBA 3A0BO 1ZHTA 3T0SA 2K0LA 1YS5A 3A2SX 3HWBA 3K19A 5B5EO 3PRNA 2LHFA 3BRZA 2F1CX 2R89A 3SY7A 3SYSA 1QJ9A 2Y7SA 5T5FA 2FGQX 1ZHYA 3DZMA 3KZIO 2JQYA 4GHBA 4PJ0O 4AKRA 2XMXA 2YPVA 4O4UA 4CTDA 4D5UA 4GCQA 2R88A 2WJQA 1GFMA 3PGUA 1S5LO 2Y2XA 3LK2B 3AA1A 4FZLA 3VY8X 5DL7A 2O4VA 5FVNA 3PQSA 5G38A 2Y0KA 2ZLDA 4LSIA 3VZUX 4FESA 4FUVA 1OPFA 1BH3A 5DL6A 4B61A 1OSMA 2MNHA 4RJWA 4IL6O 4AFKA 2WVPA 3SYBA 1ZHWA 5GTIO 2R4LA 2XTRA 3PGSA 2XTQA 2KZ7B 3VZTX 4C4VA 3HOLA 3BS0A 3LK3B 4UB6O 5EE2A 2M07A 3AAAB 3JTYA 3NSGA 3O0EA 3LK2A 4N59A 1GFPA 1QJPA 2OMFA 1Q9GA 3VE2A 3WI5A 2IWWA 2XE5A 2MHLA 4AYID 5KAIO 1E54A 4O3XB 3QRAA 3HW9A 5KAFO 8PRNA 2LFUA 2QTKA 3POUA 3DA4A 2GE4A 2KZ7A 2M06A 4N75A 2N2MA 1IZNB 3LK3A 3HOEA 3AAAA 3RBHA 3T24A 2J1NA 4FSPA 4AYEC 3WU2O 1MM5A 3A0HO 5DL8A 1BXWA 5AFUK 2N2LA 4U9CA 5TISO 3SY9A 4O3WA 4F4BA 1G90A 2FGRA 4QQ1A 3C5OA 4N58A 3SZVA 3VY9X 6PRNA 3T20A 3AAEB 1HXUA 3LK42 2JMMA 4O3ZA 1H6S1 1IZNA 4LSHA 4AYMC 2W80C 3WI4A 3POQA 5B66O 2R4NA 4G75A 5G3AA 7PRNA 3GP6A 1Q9FA 2KC0A 3UAQA 4AZLA 2KXPB 3BRYA 2YNKA 3DWOX 3VE1A 3SZDA 2R4PA 1PRNA 3FYXA 5IYUA 1QJ8A 4KR8A 3AAEA 4PUXA 5G26A 3UU2A 2PRNA 4C69X 2XE2A 4UB8O 3G7GA 2Y0HA 3KVDD 1MPFA 4FOZA 4FZMA 5PRNA 3NJTA 2F1TA 4K3BA 3UPGA 1ORMA 2KXPA 1GFOA 3EMNX 1T16A 4FMSA 1ZHZA 2X27X 4FRXA 4KR4A 5ADXK 5H2FO 3PF1A 3PGRA 3PORA 3V8UA 3QRCA 2PORA 5D5DA 4D65A 4O4XA 1ZHXA 4G76A 2IWVA 4LSFA 1BT9A 2KDYA 4FSOA 4AYNA 4GF4A 4XNLA 2XE1A 4GCPA 3JCUO 4RLCA 4LSEA 4FT6A 4KRAA 1MM4A 1P4TA 4GCSA 3VZWX 4O49A 3AA6B 3AA7B 4E1SA 4JCHA 2Y0LA 4O3YA 1HXXA 2XE3A 3PQUA 4FZNA 2F1VA 2WJRA 2ZFGA 4XNKA 4JFBA 5AFUL 5JDPA 1GFNA 2R4OA 5DL5A 2XG6A 3AA0B 1PHOA 5ADXL 1T1LA 4AYDC 2J4UP 5GTHO 4C4VB 1THQA 4FQEA 4BUMX 4PR7A 2ODJA 4K3CA 5GV0A 1HXTA 3DA3A 4AUIA 2ERVA 3AA6A 3AA7A 2X9KA 4FRTA 4D64A 2AXTO 4RL9A 2W81C 5G39A 3AA0A 4AKRB 2K4TA 2R8AA 4C00A 4E1TA 4Z3TA 3DWNA 4RJXA 5E79O 3POXA 3TZGA 4AKMA 3AA1B 4N74A
chains in the Genus database with same CATH topology
1GFQA 3LK41 4RLBA 1ZHTA 3T0SA 2K0LA 1YS5A 3A2SX 3HWBA 3K19A 3PRNA 2LHFA 3SYSA 3SY7A 1QJ9A 2Y7SA 5T5FA 2FGQX 1ZHYA 4GHBA 4AKRA 2XMXA 2YPVA 4O4UA 4D5UA 4GCQA 1GFMA 2Y2XA 3LK2B 3VY8X 3AA1A 4FZLA 5DL7A 2O4VA 5FVNA 3PQSA 2Y0KA 2ZLDA 4LSIA 3VZUX 4FESA 4FUVA 1OPFA 1BH3A 5DL6A 4B61A 1OSMA 2MNHA 4RJWA 4AFKA 3SYBA 1ZHWA 2XTRA 2XTQA 2KZ7B 3VZTX 3HOLA 5EE2A 3LK3B 2M07A 3AAAB 3JTYA 3NSGA 3O0EA 3LK2A 4N59A 1GFPA 1QJPA 2OMFA 1Q9GA 3VE2A 3WI5A 2XE5A 2MHLA 4AYID 1E54A 4O3XB 3QRAA 3HW9A 8PRNA 2LFUA 2QTKA 3POUA 3DA4A 2GE4A 2KZ7A 2M06A 2N2MA 1IZNB 3LK3A 3HOEA 3AAAA 3RBHA 3T24A 2J1NA 4FSPA 4AYEC 1MM5A 5DL8A 1BXWA 5AFUK 2N2LA 4U9CA 3SY9A 4O3WA 4F4BA 1G90A 2FGRA 4QQ1A 3C5OA 4N58A 3SZVA 3VY9X 6PRNA 3T20A 3AAEB 1HXUA 3LK42 2JMMA 4O3ZA 1H6S1 1IZNA 4LSHA 4AYMC 2W80C 3WI4A 3POQA 4G75A 7PRNA 3GP6A 1Q9FA 2KC0A 3UAQA 4AZLA 2KXPB 2YNKA 3VE1A 3SZDA 1PRNA 3FYXA 5IYUA 1QJ8A 4KR8A 3AAEA 4PUXA 5G26A 3UU2A 2PRNA 4C69X 2XE2A 3G7GA 2Y0HA 3KVDD 1MPFA 4FOZA 4FZMA 5PRNA 2F1TA 3UPGA 1ORMA 2KXPA 1GFOA 3EMNX 4FMSA 1ZHZA 2X27X 4FRXA 4KR4A 5ADXK 3PORA 3V8UA 3QRCA 2PORA 5D5DA 4D65A 4O4XA 1ZHXA 4G76A 4LSFA 1BT9A 2KDYA 4FSOA 4AYNA 4GF4A 4XNLA 2XE1A 4GCPA 4RLCA 4LSEA 4FT6A 4KRAA 1MM4A 1P4TA 4GCSA 3VZWX 4O49A 3AA6B 3AA7B 4E1SA 4JCHA 2Y0LA 4O3YA 1HXXA 2XE3A 3PQUA 4FZNA 2F1VA 2ZFGA 4XNKA 4JFBA 5AFUL 5JDPA 1GFNA 5DL5A 2XG6A 3AA0B 1PHOA 5ADXL 4AYDC 2J4UP 1THQA 4BUMX 2ODJA 5GV0A 1HXTA 3DA3A 4AUIA 2ERVA 3AA6A 3AA7A 4FRTA 4D64A 4RL9A 2W81C 3AA0A 4AKRB 2K4TA 4E1TA 4Z3TA 4RJXA 3POXA 3TZGA 4AKMA 3AA1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYI D;  3VE1 A;  4O3X B;  1YS5 A;  4O49 A;  4O3Y A;  3PQU A;  2Y7S A;  2LFU A;  5T5F A;  3KVD D;  2YPV A;  4O4U A;  3HOE A;  4AYE C;  3UAQ A;  4AYD C;  3PQS A;  4U9C A;  4O3W A;  4QQ1 A;  3V8U A;  4O3Z A;  2W81 C;  4O4X A;  3HOL A;  5EE2 A;  2W80 C;  4AYM C;  2KDY A;  4Z3T A;  4AYN A;  2KC0 A;  3VE2 A; 
#chains in the Genus database with same CATH topology
 1GFQ A;  3LK4 1;  4RLB A;  3A0B O;  1ZHT A;  3T0S A;  2K0L A;  1YS5 A;  3A2S X;  3HWB A;  3K19 A;  5B5E O;  3PRN A;  2LHF A;  3BRZ A;  2F1C X;  2R89 A;  3SY7 A;  3SYS A;  1QJ9 A;  2Y7S A;  5T5F A;  2FGQ X;  1ZHY A;  3DZM A;  3KZI O;  2JQY A;  4GHB A;  4PJ0 O;  4AKR A;  2XMX A;  2YPV A;  4O4U A;  4CTD A;  4D5U A;  4GCQ A;  2R88 A;  2WJQ A;  1GFM A;  3PGU A;  1S5L O;  2Y2X A;  3LK2 B;  3AA1 A;  4FZL A;  3VY8 X;  5DL7 A;  2O4V A;  5FVN A;  3PQS A;  5G38 A;  2Y0K A;  2ZLD A;  4LSI A;  3VZU X;  4FES A;  4FUV A;  1OPF A;  1BH3 A;  5DL6 A;  4B61 A;  1OSM A;  2MNH A;  4RJW A;  4IL6 O;  4AFK A;  2WVP A;  3SYB A;  1ZHW A;  5GTI O;  2R4L A;  2XTR A;  3PGS A;  2XTQ A;  2KZ7 B;  3VZT X;  4C4V A;  3HOL A;  3BS0 A;  3LK3 B;  4UB6 O;  5EE2 A;  2M07 A;  3AAA B;  3JTY A;  3NSG A;  3O0E A;  3LK2 A;  4N59 A;  1GFP A;  1QJP A;  2OMF A;  1Q9G A;  3VE2 A;  3WI5 A;  2IWW A;  2XE5 A;  2MHL A;  4AYI D;  5KAI O;  1E54 A;  4O3X B;  3QRA A;  3HW9 A;  5KAF O;  8PRN A;  2LFU A;  2QTK A;  3POU A;  3DA4 A;  2GE4 A;  2KZ7 A;  2M06 A;  4N75 A;  2N2M A;  1IZN B;  3LK3 A;  3HOE A;  3AAA A;  3RBH A;  3T24 A;  2J1N A;  4FSP A;  4AYE C;  3WU2 O;  1MM5 A;  3A0H O;  5DL8 A;  1BXW A;  5AFU K;  2N2L A;  4U9C A;  5TIS O;  3SY9 A;  4O3W A;  4F4B A;  1G90 A;  2FGR A;  4QQ1 A;  3C5O A;  4N58 A;  3SZV A;  3VY9 X;  6PRN A;  3T20 A;  3AAE B;  1HXU A;  3LK4 2;  2JMM A;  4O3Z A;  1H6S 1;  1IZN A;  4LSH A;  4AYM C;  2W80 C;  3WI4 A;  3POQ A;  5B66 O;  2R4N A;  4G75 A;  5G3A A;  7PRN A;  3GP6 A;  1Q9F A;  2KC0 A;  3UAQ A;  4AZL A;  2KXP B;  3BRY A;  2YNK A;  3DWO X;  3VE1 A;  3SZD A;  2R4P A;  1PRN A;  3FYX A;  5IYU A;  1QJ8 A;  4KR8 A;  3AAE A;  4PUX A;  5G26 A;  3UU2 A;  2PRN A;  4C69 X;  2XE2 A;  4UB8 O;  3G7G A;  2Y0H A;  3KVD D;  1MPF A;  4FOZ A;  4FZM A;  5PRN A;  3NJT A;  2F1T A;  4K3B A;  3UPG A;  1ORM A;  2KXP A;  1GFO A;  3EMN X;  1T16 A;  4FMS A;  1ZHZ A;  2X27 X;  4FRX A;  4KR4 A;  5ADX K;  5H2F O;  3PF1 A;  3PGR A;  3POR A;  3V8U A;  3QRC A;  2POR A;  5D5D A;  4D65 A;  4O4X A;  1ZHX A;  4G76 A;  2IWV A;  4LSF A;  1BT9 A;  2KDY A;  4FSO A;  4AYN A;  4GF4 A;  4XNL A;  2XE1 A;  4GCP A;  3JCU O;  4RLC A;  4LSE A;  4FT6 A;  4KRA A;  1MM4 A;  1P4T A;  4GCS A;  3VZW X;  4O49 A;  3AA6 B;  3AA7 B;  4E1S A;  4JCH A;  2Y0L A;  4O3Y A;  1HXX A;  2XE3 A;  3PQU A;  4FZN A;  2F1V A;  2WJR A;  2ZFG A;  4XNK A;  4JFB A;  5AFU L;  5JDP A;  1GFN A;  2R4O A;  5DL5 A;  2XG6 A;  3AA0 B;  1PHO A;  5ADX L;  1T1L A;  4AYD C;  2J4U P;  5GTH O;  4C4V B;  1THQ A;  4FQE A;  4BUM X;  4PR7 A;  2ODJ A;  4K3C A;  5GV0 A;  1HXT A;  3DA3 A;  4AUI A;  2ERV A;  3AA6 A;  3AA7 A;  2X9K A;  4FRT A;  4D64 A;  2AXT O;  4RL9 A;  2W81 C;  5G39 A;  3AA0 A;  4AKR B;  2K4T A;  2R8A A;  4C00 A;  4E1T A;  4Z3T A;  3DWN A;  4RJX A;  5E79 O;  3POX A;  3TZG A;  4AKM A;  3AA1 B;  4N74 A; 
#chains in the Genus database with same CATH homology
 1GFQ A;  3LK4 1;  4RLB A;  1ZHT A;  3T0S A;  2K0L A;  1YS5 A;  3A2S X;  3HWB A;  3K19 A;  3PRN A;  2LHF A;  3SYS A;  3SY7 A;  1QJ9 A;  2Y7S A;  5T5F A;  2FGQ X;  1ZHY A;  4GHB A;  4AKR A;  2XMX A;  2YPV A;  4O4U A;  4D5U A;  4GCQ A;  1GFM A;  2Y2X A;  3LK2 B;  3VY8 X;  3AA1 A;  4FZL A;  5DL7 A;  2O4V A;  5FVN A;  3PQS A;  2Y0K A;  2ZLD A;  4LSI A;  3VZU X;  4FES A;  4FUV A;  1OPF A;  1BH3 A;  5DL6 A;  4B61 A;  1OSM A;  2MNH A;  4RJW A;  4AFK A;  3SYB A;  1ZHW A;  2XTR A;  2XTQ A;  2KZ7 B;  3VZT X;  3HOL A;  5EE2 A;  3LK3 B;  2M07 A;  3AAA B;  3JTY A;  3NSG A;  3O0E A;  3LK2 A;  4N59 A;  1GFP A;  1QJP A;  2OMF A;  1Q9G A;  3VE2 A;  3WI5 A;  2XE5 A;  2MHL A;  4AYI D;  1E54 A;  4O3X B;  3QRA A;  3HW9 A;  8PRN A;  2LFU A;  2QTK A;  3POU A;  3DA4 A;  2GE4 A;  2KZ7 A;  2M06 A;  2N2M A;  1IZN B;  3LK3 A;  3HOE A;  3AAA A;  3RBH A;  3T24 A;  2J1N A;  4FSP A;  4AYE C;  1MM5 A;  5DL8 A;  1BXW A;  5AFU K;  2N2L A;  4U9C A;  3SY9 A;  4O3W A;  4F4B A;  1G90 A;  2FGR A;  4QQ1 A;  3C5O A;  4N58 A;  3SZV A;  3VY9 X;  6PRN A;  3T20 A;  3AAE B;  1HXU A;  3LK4 2;  2JMM A;  4O3Z A;  1H6S 1;  1IZN A;  4LSH A;  4AYM C;  2W80 C;  3WI4 A;  3POQ A;  4G75 A;  7PRN A;  3GP6 A;  1Q9F A;  2KC0 A;  3UAQ A;  4AZL A;  2KXP B;  2YNK A;  3VE1 A;  3SZD A;  1PRN A;  3FYX A;  5IYU A;  1QJ8 A;  4KR8 A;  3AAE A;  4PUX A;  5G26 A;  3UU2 A;  2PRN A;  4C69 X;  2XE2 A;  3G7G A;  2Y0H A;  3KVD D;  1MPF A;  4FOZ A;  4FZM A;  5PRN A;  2F1T A;  3UPG A;  1ORM A;  2KXP A;  1GFO A;  3EMN X;  4FMS A;  1ZHZ A;  2X27 X;  4FRX A;  4KR4 A;  5ADX K;  3POR A;  3V8U A;  3QRC A;  2POR A;  5D5D A;  4D65 A;  4O4X A;  1ZHX A;  4G76 A;  4LSF A;  1BT9 A;  2KDY A;  4FSO A;  4AYN A;  4GF4 A;  4XNL A;  2XE1 A;  4GCP A;  4RLC A;  4LSE A;  4FT6 A;  4KRA A;  1MM4 A;  1P4T A;  4GCS A;  3VZW X;  4O49 A;  3AA6 B;  3AA7 B;  4E1S A;  4JCH A;  2Y0L A;  4O3Y A;  1HXX A;  2XE3 A;  3PQU A;  4FZN A;  2F1V A;  2ZFG A;  4XNK A;  4JFB A;  5AFU L;  5JDP A;  1GFN A;  5DL5 A;  2XG6 A;  3AA0 B;  1PHO A;  5ADX L;  4AYD C;  2J4U P;  1THQ A;  4BUM X;  2ODJ A;  5GV0 A;  1HXT A;  3DA3 A;  4AUI A;  2ERV A;  3AA6 A;  3AA7 A;  4FRT A;  4D64 A;  4RL9 A;  2W81 C;  3AA0 A;  4AKR B;  2K4T A;  4E1T A;  4Z3T A;  4RJX A;  3POX A;  3TZG A;  4AKM A;  3AA1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...