4FOZA

Crystal structure of occd1 (oprd) y282r/d307h
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
420
structure length
377
Chain Sequence
DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTGNLPVPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFARLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAVAYTLDAHTFTLAYQKVHGDQPFDRIGFIFLANSVQYSHFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Porin D
publication title Toward Understanding the Outer Membrane Uptake of Small Molecules by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 108
structure length 377
sequence length 420
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4fozA01
1GFNA 2J4UP 3JTYA 7PRNA 1GFPA 3PRNA 5DL5A 4FT6A 3T0SA 4JFBA 1HXXA 1GFMA 3VY9X 1GFQA 3VZWX 2XE3A 3WI4A 4FSPA 3SY7A 3HW9A 2FGQX 3POQA 4LSHA 5JDPA 3POXA 2XE5A 2XE2A 1GFOA 4GCQA 3VZTX 3SYSA 1OPFA 4KRAA 2ODJA 2XE1A 2ZFGA 5DL7A 3POUA 3SY9A 2PRNA 1HXTA 1HXUA 2Y0HA 4C69X 4KR8A 4D65A 3HWBA 3T20A 5DL8A 8PRNA 3EMNX 1BH3A 1OSMA 4RJXA 4AUIA 2FGRA 3O0EA 1MPFA 3VY8X 3SZDA 6PRNA 4FOZA 3VZUX 2PORA 2Y0LA 2QTKA 4GCPA 2Y0KA 3NSGA 4FRXA 2ZLDA 3SZVA 3PORA 2J1NA 1H6S1 4LSIA 5PRNA 3UU2A 2XG6A 1PHOA 4FRTA 1PRNA 3A2SX 2O4VA 3T24A 4FMSA 4RJWA 4LSFA 3WI5A 4BUMX 5FVNA 1E54A 3UPGA 4KR4A 4D5UA 4D64A 5DL6A 3SYBA 4FSOA 2OMFA 1BT9A 2K4TA 4LSEA 3K19A 3FYXA 4GCSA 2Y2XA
chains in the Genus database with same CATH superfamily
1GFNA 2J4UP 4C4VA 2M06A 3GP6A 3JTYA 3QRCA 7PRNA 1GFPA 4RLCA 3PRNA 4FQEA 5EE2A 1QJ9A 5DL5A 3QRAA 5TISO 3AA6B 4FT6A 3T0SA 4JFBA 1HXXA 1GFMA 3BS0A 4G75A 3LK42 2LFUA 3VY9X 4Z3TA 2W80C 1GFQA 3VZWX 1IZNA 2MNHA 2XE3A 3WI4A 4FSPA 3AA1A 2YPVA 3SY7A 1ZHWA 3HW9A 2FGQX 3A0HO 3POQA 4K3CA 4LSHA 5AFUK 3POXA 1MM5A 5JDPA 2N2LA 2JQYA 3AA6A 4E1TA 3DWOX 3DWNA 3KZIO 5KAIO 2KXPA 2W81C 2XE5A 2XE2A 3DZMA 1GFOA 4GCQA 3VZTX 5B66O 5GTIO 1S5LO 5G26A 3PQUA 4AZLA 2KZ7B 3SYSA 3JCUO 4AYID 4AKRB 5T5FA 1OPFA 2ODJA 2XE1A 2XMXA 3PF1A 4KRAA 2ZFGA 4PUXA 2K0LA 5DL7A 2WJQA 5H2FO 4AKMA 3POUA 2R4OA 2XTQA 3SY9A 2PRNA 1HXTA 1HXUA 2Y0HA 3AAEB 3LK3A 4C69X 3KVDD 4FZMA 3V8UA 3AAAB 1P4TA 3BRZA 2KZ7A 4KR8A 2IWVA 4PJ0O 2GE4A 3AA0B 2KDYA 3HWBA 3RBHA 3UAQA 4D65A 5G39A 2R4NA 1ZHYA 3T20A 5DL8A 5G38A 2WJRA 2KC0A 8PRNA 5ADXK 3EMNX 1BH3A 3WU2O 1OSMA 4RJXA 1Q9GA 3A0BO 1ZHZA 4AUIA 5ADXL 3PGUA 1MM4A 2FGRA 3AAEA 5AFUL 3O0EA 4AYMC 1MPFA 4GF4A 4CTDA 4UB8O 3DA3A 3AAAA 4RLBA 3HOLA 2R89A 3AA0A 4C00A 4N58A 3VY8X 1Q9FA 1ZHXA 4FZLA 3SZDA 6PRNA 3LK2B 3BRYA 2R8AA 5G3AA 4FOZA 3VZUX 2PORA 2Y7SA 2Y0LA 2QTKA 4GCPA 2Y0KA 4O49A 3NSGA 4FRXA 2ZLDA 5KAFO 3SZVA 4N59A 4AYNA 3PORA 2J1NA 1ZHTA 1ORMA 4AKRA 1H6S1 4LSIA 5PRNA 5GTHO 2YNKA 3UU2A 3G7GA 4PR7A 4IL6O 4RL9A 2AXTO 2F1TA 2WVPA 2XG6A 2M07A 2X9KA 1PHOA 4AFKA 4JCHA 4AYEC 4FRTA 3DA4A 2X27X 3TZGA 1PRNA 1T1LA 4O3WA 3A2SX 2O4VA 3T24A 4N75A 4B61A 4FMSA 4RJWA 4LSFA 5GV0A 4N74A 3AA7B 3WI5A 2XTRA 4G76A 3NJTA 4O3ZA 5FVNA 4BUMX 1E54A 2F1VA 1YS5A 4K3BA 1G90A 2IWWA 2F1CX 2KXPB 2R88A 4FUVA 4UB6O 4O3YA 3UPGA 3LK41 4KR4A 1T16A 1THQA 2MHLA 3PQSA 4D5UA 4D64A 5DL6A 5B5EO 1BXWA 1QJPA 4AYDC 1QJ8A 4XNKA 3SYBA 4FSOA 3AA7A 4C4VB 2OMFA 3C5OA 1BT9A 4FZNA 5D5DA 4O4XA 2K4TA 4FESA 2N2MA 3HOEA 3K19A 4LSEA 3LK2A 4O4UA 4QQ1A 3FYXA 4U9CA 5E79O 3VE2A 3LK3B 4F4BA 2JMMA 4O3XB 4XNLA 2LHFA 2R4LA 1IZNB 5IYUA 3PGRA 3PGSA 4GCSA 2R4PA 4GHBA 2ERVA 3VE1A 3AA1B 2Y2XA 4E1SA
chains in the Genus database with same CATH topology
1GFNA 2J4UP 2M06A 3GP6A 3JTYA 3QRCA 7PRNA 1GFPA 4RLCA 3PRNA 5EE2A 1QJ9A 5DL5A 3QRAA 3AA6B 4FT6A 3T0SA 4JFBA 1HXXA 1GFMA 4G75A 3LK42 2LFUA 3VY9X 4Z3TA 2W80C 1GFQA 3VZWX 1IZNA 2MNHA 2XE3A 3WI4A 4FSPA 3AA1A 2YPVA 3SY7A 1ZHWA 3HW9A 2FGQX 3POQA 4LSHA 5JDPA 5AFUK 3POXA 1MM5A 2N2LA 4E1TA 3AA6A 2KXPA 2W81C 2XE5A 2XE2A 1GFOA 4GCQA 3VZTX 5G26A 3PQUA 4AZLA 2KZ7B 3SYSA 4AYID 4AKRB 5T5FA 1OPFA 2ODJA 2XMXA 2XE1A 4KRAA 2ZFGA 4PUXA 2K0LA 5DL7A 4AKMA 3POUA 2XTQA 3SY9A 2PRNA 1HXTA 1HXUA 2Y0HA 3AAEB 3LK3A 4C69X 3KVDD 4FZMA 3V8UA 3AAAB 1P4TA 2KZ7A 4KR8A 2GE4A 3AA0B 2KDYA 3HWBA 3RBHA 3UAQA 4D65A 4F4BA 3T20A 1ZHYA 5DL8A 2KC0A 8PRNA 5ADXK 3EMNX 1BH3A 1OSMA 4RJXA 1Q9GA 1ZHZA 4AUIA 5ADXL 1MM4A 2FGRA 3AAEA 5AFUL 3O0EA 4AYMC 1MPFA 4GF4A 3DA3A 3AAAA 4RLBA 3HOLA 3AA0A 4N58A 3VY8X 1Q9FA 1ZHXA 4FZLA 3SZDA 6PRNA 3LK2B 4FOZA 3VZUX 2PORA 2Y7SA 2Y0LA 2QTKA 4GCPA 2Y0KA 4O49A 3NSGA 4FRXA 2ZLDA 3SZVA 4N59A 4AYNA 3PORA 2J1NA 1ZHTA 1ORMA 4AKRA 1H6S1 4LSIA 5PRNA 2YNKA 3UU2A 3G7GA 4RL9A 2F1TA 2XG6A 4AFKA 2M07A 1PHOA 4JCHA 4AYEC 4FRTA 3DA4A 2X27X 3TZGA 1PRNA 4O3WA 3A2SX 2O4VA 3T24A 4B61A 4FMSA 4RJWA 4LSFA 5GV0A 3AA7B 3WI5A 2XTRA 4G76A 5FVNA 4O3ZA 4BUMX 1E54A 2F1VA 1YS5A 1G90A 4FUVA 2KXPB 4O3YA 3UPGA 3LK41 4KR4A 3PQSA 1THQA 2MHLA 4D5UA 4D64A 5DL6A 1BXWA 1QJPA 4AYDC 1QJ8A 4XNKA 3SYBA 4FSOA 3AA7A 2OMFA 3C5OA 1BT9A 4FZNA 5D5DA 4O4XA 2K4TA 4FESA 2N2MA 3HOEA 3K19A 4LSEA 3LK2A 4O4UA 4QQ1A 3FYXA 4U9CA 3VE2A 3LK3B 2JMMA 4O3XB 4XNLA 2LHFA 1IZNB 5IYUA 4GCSA 4GHBA 3VE1A 2ERVA 3AA1B 2Y2XA 4E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFN A;  2J4U P;  3JTY A;  7PRN A;  1GFP A;  3PRN A;  5DL5 A;  4FT6 A;  3T0S A;  4JFB A;  1HXX A;  1GFM A;  3VY9 X;  1GFQ A;  3VZW X;  2XE3 A;  3WI4 A;  4FSP A;  3SY7 A;  3HW9 A;  2FGQ X;  3POQ A;  4LSH A;  5JDP A;  3POX A;  2XE5 A;  2XE2 A;  1GFO A;  4GCQ A;  3VZT X;  3SYS A;  1OPF A;  4KRA A;  2ODJ A;  2XE1 A;  2ZFG A;  5DL7 A;  3POU A;  3SY9 A;  2PRN A;  1HXT A;  1HXU A;  2Y0H A;  4C69 X;  4KR8 A;  4D65 A;  3HWB A;  3T20 A;  5DL8 A;  8PRN A;  3EMN X;  1BH3 A;  1OSM A;  4RJX A;  4AUI A;  2FGR A;  3O0E A;  1MPF A;  3VY8 X;  3SZD A;  6PRN A;  4FOZ A;  3VZU X;  2POR A;  2Y0L A;  2QTK A;  4GCP A;  2Y0K A;  3NSG A;  4FRX A;  2ZLD A;  3SZV A;  3POR A;  2J1N A;  1H6S 1;  4LSI A;  5PRN A;  3UU2 A;  2XG6 A;  1PHO A;  4FRT A;  1PRN A;  3A2S X;  2O4V A;  3T24 A;  4FMS A;  4RJW A;  4LSF A;  3WI5 A;  4BUM X;  5FVN A;  1E54 A;  3UPG A;  4KR4 A;  4D5U A;  4D64 A;  5DL6 A;  3SYB A;  4FSO A;  2OMF A;  1BT9 A;  2K4T A;  4LSE A;  3K19 A;  3FYX A;  4GCS A;  2Y2X A; 
#chains in the Genus database with same CATH topology
 1GFN A;  2J4U P;  4C4V A;  2M06 A;  3GP6 A;  3JTY A;  3QRC A;  7PRN A;  1GFP A;  4RLC A;  3PRN A;  4FQE A;  5EE2 A;  1QJ9 A;  5DL5 A;  3QRA A;  5TIS O;  3AA6 B;  4FT6 A;  3T0S A;  4JFB A;  1HXX A;  1GFM A;  3BS0 A;  4G75 A;  3LK4 2;  2LFU A;  3VY9 X;  4Z3T A;  2W80 C;  1GFQ A;  3VZW X;  1IZN A;  2MNH A;  2XE3 A;  3WI4 A;  4FSP A;  3AA1 A;  2YPV A;  3SY7 A;  1ZHW A;  3HW9 A;  2FGQ X;  3A0H O;  3POQ A;  4K3C A;  4LSH A;  5AFU K;  3POX A;  1MM5 A;  5JDP A;  2N2L A;  2JQY A;  3AA6 A;  4E1T A;  3DWO X;  3DWN A;  3KZI O;  5KAI O;  2KXP A;  2W81 C;  2XE5 A;  2XE2 A;  3DZM A;  1GFO A;  4GCQ A;  3VZT X;  5B66 O;  5GTI O;  1S5L O;  5G26 A;  3PQU A;  4AZL A;  2KZ7 B;  3SYS A;  3JCU O;  4AYI D;  4AKR B;  5T5F A;  1OPF A;  2ODJ A;  2XE1 A;  2XMX A;  3PF1 A;  4KRA A;  2ZFG A;  4PUX A;  2K0L A;  5DL7 A;  2WJQ A;  5H2F O;  4AKM A;  3POU A;  2R4O A;  2XTQ A;  3SY9 A;  2PRN A;  1HXT A;  1HXU A;  2Y0H A;  3AAE B;  3LK3 A;  4C69 X;  3KVD D;  4FZM A;  3V8U A;  3AAA B;  1P4T A;  3BRZ A;  2KZ7 A;  4KR8 A;  2IWV A;  4PJ0 O;  2GE4 A;  3AA0 B;  2KDY A;  3HWB A;  3RBH A;  3UAQ A;  4D65 A;  5G39 A;  2R4N A;  1ZHY A;  3T20 A;  5DL8 A;  5G38 A;  2WJR A;  2KC0 A;  8PRN A;  5ADX K;  3EMN X;  1BH3 A;  3WU2 O;  1OSM A;  4RJX A;  1Q9G A;  3A0B O;  1ZHZ A;  4AUI A;  5ADX L;  3PGU A;  1MM4 A;  2FGR A;  3AAE A;  5AFU L;  3O0E A;  4AYM C;  1MPF A;  4GF4 A;  4CTD A;  4UB8 O;  3DA3 A;  3AAA A;  4RLB A;  3HOL A;  2R89 A;  3AA0 A;  4C00 A;  4N58 A;  3VY8 X;  1Q9F A;  1ZHX A;  4FZL A;  3SZD A;  6PRN A;  3LK2 B;  3BRY A;  2R8A A;  5G3A A;  4FOZ A;  3VZU X;  2POR A;  2Y7S A;  2Y0L A;  2QTK A;  4GCP A;  2Y0K A;  4O49 A;  3NSG A;  4FRX A;  2ZLD A;  5KAF O;  3SZV A;  4N59 A;  4AYN A;  3POR A;  2J1N A;  1ZHT A;  1ORM A;  4AKR A;  1H6S 1;  4LSI A;  5PRN A;  5GTH O;  2YNK A;  3UU2 A;  3G7G A;  4PR7 A;  4IL6 O;  4RL9 A;  2AXT O;  2F1T A;  2WVP A;  2XG6 A;  2M07 A;  2X9K A;  1PHO A;  4AFK A;  4JCH A;  4AYE C;  4FRT A;  3DA4 A;  2X27 X;  3TZG A;  1PRN A;  1T1L A;  4O3W A;  3A2S X;  2O4V A;  3T24 A;  4N75 A;  4B61 A;  4FMS A;  4RJW A;  4LSF A;  5GV0 A;  4N74 A;  3AA7 B;  3WI5 A;  2XTR A;  4G76 A;  3NJT A;  4O3Z A;  5FVN A;  4BUM X;  1E54 A;  2F1V A;  1YS5 A;  4K3B A;  1G90 A;  2IWW A;  2F1C X;  2KXP B;  2R88 A;  4FUV A;  4UB6 O;  4O3Y A;  3UPG A;  3LK4 1;  4KR4 A;  1T16 A;  1THQ A;  2MHL A;  3PQS A;  4D5U A;  4D64 A;  5DL6 A;  5B5E O;  1BXW A;  1QJP A;  4AYD C;  1QJ8 A;  4XNK A;  3SYB A;  4FSO A;  3AA7 A;  4C4V B;  2OMF A;  3C5O A;  1BT9 A;  4FZN A;  5D5D A;  4O4X A;  2K4T A;  4FES A;  2N2M A;  3HOE A;  3K19 A;  4LSE A;  3LK2 A;  4O4U A;  4QQ1 A;  3FYX A;  4U9C A;  5E79 O;  3VE2 A;  3LK3 B;  4F4B A;  2JMM A;  4O3X B;  4XNL A;  2LHF A;  2R4L A;  1IZN B;  5IYU A;  3PGR A;  3PGS A;  4GCS A;  2R4P A;  4GHB A;  2ERV A;  3VE1 A;  3AA1 B;  2Y2X A;  4E1S A; 
#chains in the Genus database with same CATH homology
 1GFN A;  2J4U P;  2M06 A;  3GP6 A;  3JTY A;  3QRC A;  7PRN A;  1GFP A;  4RLC A;  3PRN A;  5EE2 A;  1QJ9 A;  5DL5 A;  3QRA A;  3AA6 B;  4FT6 A;  3T0S A;  4JFB A;  1HXX A;  1GFM A;  4G75 A;  3LK4 2;  2LFU A;  3VY9 X;  4Z3T A;  2W80 C;  1GFQ A;  3VZW X;  1IZN A;  2MNH A;  2XE3 A;  3WI4 A;  4FSP A;  3AA1 A;  2YPV A;  3SY7 A;  1ZHW A;  3HW9 A;  2FGQ X;  3POQ A;  4LSH A;  5JDP A;  5AFU K;  3POX A;  1MM5 A;  2N2L A;  4E1T A;  3AA6 A;  2KXP A;  2W81 C;  2XE5 A;  2XE2 A;  1GFO A;  4GCQ A;  3VZT X;  5G26 A;  3PQU A;  4AZL A;  2KZ7 B;  3SYS A;  4AYI D;  4AKR B;  5T5F A;  1OPF A;  2ODJ A;  2XMX A;  2XE1 A;  4KRA A;  2ZFG A;  4PUX A;  2K0L A;  5DL7 A;  4AKM A;  3POU A;  2XTQ A;  3SY9 A;  2PRN A;  1HXT A;  1HXU A;  2Y0H A;  3AAE B;  3LK3 A;  4C69 X;  3KVD D;  4FZM A;  3V8U A;  3AAA B;  1P4T A;  2KZ7 A;  4KR8 A;  2GE4 A;  3AA0 B;  2KDY A;  3HWB A;  3RBH A;  3UAQ A;  4D65 A;  4F4B A;  3T20 A;  1ZHY A;  5DL8 A;  2KC0 A;  8PRN A;  5ADX K;  3EMN X;  1BH3 A;  1OSM A;  4RJX A;  1Q9G A;  1ZHZ A;  4AUI A;  5ADX L;  1MM4 A;  2FGR A;  3AAE A;  5AFU L;  3O0E A;  4AYM C;  1MPF A;  4GF4 A;  3DA3 A;  3AAA A;  4RLB A;  3HOL A;  3AA0 A;  4N58 A;  3VY8 X;  1Q9F A;  1ZHX A;  4FZL A;  3SZD A;  6PRN A;  3LK2 B;  4FOZ A;  3VZU X;  2POR A;  2Y7S A;  2Y0L A;  2QTK A;  4GCP A;  2Y0K A;  4O49 A;  3NSG A;  4FRX A;  2ZLD A;  3SZV A;  4N59 A;  4AYN A;  3POR A;  2J1N A;  1ZHT A;  1ORM A;  4AKR A;  1H6S 1;  4LSI A;  5PRN A;  2YNK A;  3UU2 A;  3G7G A;  4RL9 A;  2F1T A;  2XG6 A;  4AFK A;  2M07 A;  1PHO A;  4JCH A;  4AYE C;  4FRT A;  3DA4 A;  2X27 X;  3TZG A;  1PRN A;  4O3W A;  3A2S X;  2O4V A;  3T24 A;  4B61 A;  4FMS A;  4RJW A;  4LSF A;  5GV0 A;  3AA7 B;  3WI5 A;  2XTR A;  4G76 A;  5FVN A;  4O3Z A;  4BUM X;  1E54 A;  2F1V A;  1YS5 A;  1G90 A;  4FUV A;  2KXP B;  4O3Y A;  3UPG A;  3LK4 1;  4KR4 A;  3PQS A;  1THQ A;  2MHL A;  4D5U A;  4D64 A;  5DL6 A;  1BXW A;  1QJP A;  4AYD C;  1QJ8 A;  4XNK A;  3SYB A;  4FSO A;  3AA7 A;  2OMF A;  3C5O A;  1BT9 A;  4FZN A;  5D5D A;  4O4X A;  2K4T A;  4FES A;  2N2M A;  3HOE A;  3K19 A;  4LSE A;  3LK2 A;  4O4U A;  4QQ1 A;  3FYX A;  4U9C A;  3VE2 A;  3LK3 B;  2JMM A;  4O3X B;  4XNL A;  2LHF A;  1IZN B;  5IYU A;  4GCS A;  4GHB A;  3VE1 A;  2ERV A;  3AA1 B;  2Y2X A;  4E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...