4FOZA

Crystal structure of occd1 (oprd) y282r/d307h
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
420
structure length
377
Chain Sequence
DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTGNLPVPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFARLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAVAYTLDAHTFTLAYQKVHGDQPFDRIGFIFLANSVQYSHFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward Understanding the Outer Membrane Uptake of Small Molecules by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
molecule keywords Porin D
total genus 108
structure length 377
sequence length 420
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4fozA01
4LSIA 4D64A 3POXA 4FT6A 3WI5A 3VZWX 5JDPA 1MPFA 1OPFA 2ODJA 4FOZA 2XE1A 3VY9X 4KRAA 2XG6A 4D5UA 4GCSA 3VZTX 5DL8A 3JTYA 1HXXA 4FRXA 3POQA 3SYBA 4LSFA 3O0EA 4GCQA 8PRNA 5PRNA 3PORA 3SY7A 3A2SX 3SYSA 3EMNX 6PRNA 3NSGA 4KR4A 4C69X 1HXTA 3VZUX 1GFNA 4FMSA 1HXUA 1GFOA 5FVNA 2XE3A 2FGRA 5DL5A 2ZLDA 3UU2A 3WI4A 3VY8X 2XE5A 1BT9A 1GFMA 4LSEA 2Y0HA 2FGQX 1GFPA 3SZVA 2OMFA 2J1NA 2PRNA 1PHOA 4AUIA 3T24A 2QTKA 2O4VA 2Y0LA 3PRNA 3SZDA 1E54A 4D65A 2ZFGA 4FRTA 2XE2A 3SY9A 1PRNA 3T20A 4FSPA 5DL7A 3T0SA 7PRNA 2PORA 4LSHA 3UPGA 5DL6A 4GCPA 4BUMX 1GFQA 3K19A 1BH3A 1OSMA 3FYXA 3HWBA 1H6S1 4RJWA 2Y0KA 2Y2XA 2J4UP 4RJXA 3POUA 4FSOA 4KR8A 3HW9A 4JFBA 2K4TA
chains in the Genus database with same CATH superfamily
4LSIA 5KAFO 4D64A 4QQ1A 3AA6A 2WJQA 3POXA 4FT6A 3WI5A 3VZWX 2KC0A 1S5LO 4AFKA 4O3ZA 3TZGA 2JMMA 5JDPA 1MPFA 2M07A 4FUVA 2K0LA 1OPFA 2ODJA 2IWWA 4N75A 3HOEA 4FOZA 3AA1B 4U9CA 2XE1A 4AYDC 3VY9X 2LFUA 4KRAA 4Z3TA 2XG6A 4D5UA 3C5OA 2KZ7B 5AFUL 4O3YA 4N58A 2XTRA 4FQEA 2WJRA 2W81C 4GCSA 4AYEC 5GV0A 4G75A 5DL8A 3VZTX 1ZHYA 2R8AA 2X27X 3JTYA 1HXXA 2ERVA 3RBHA 2JQYA 3LK2A 4XNLA 3NJTA 3V8UA 3AA0B 3PQUA 4O4XA 4FRXA 5AFUK 3PF1A 4O3WA 3POQA 3SYBA 1THQA 3AA6B 4LSFA 4JCHA 3PGRA 3KVDD 1Q9GA 4IL6O 4C00A 1T16A 1T1LA 3O0EA 4GCQA 4AYNA 5TISO 8PRNA 5IYUA 2F1VA 3DA4A 3DA3A 3PORA 5PRNA 5G26A 3SY7A 1G90A 2KXPB 2F1CX 3A2SX 3SYSA 2N2MA 3EMNX 6PRNA 3AAEA 2XTQA 3NSGA 2R4NA 1ZHTA 4AKMA 1P4TA 4KR4A 3UAQA 4C69X 5H2FO 4FZMA 3LK42 2X9KA 1HXTA 3VZUX 5G3AA 3KZIO 1GFNA 1QJ8A 3A0HO 4FMSA 1HXUA 4K3BA 2KDYA 5G38A 1GFOA 5FVNA 2XE3A 4K3CA 2FGRA 4RLBA 5DL5A 3BS0A 1ZHWA 2N2LA 3G7GA 1MM5A 2ZLDA 3QRCA 4PUXA 5T5FA 3UU2A 1MM4A 4AYID 5ADXL 3WI4A 3BRYA 3VY8X 2XE5A 4AKRA 5ADXK 1BT9A 3DZMA 3PGUA 1GFMA 4LSEA 3BRZA 5E79O 2Y0HA 2FGQX 4GHBA 1GFPA 3SZVA 5GTHO 2OMFA 3AAAB 4O49A 4FZLA 4UB8O 2J1NA 2M06A 5G39A 2W80C 4O4UA 1QJPA 1BXWA 4GF4A 2XMXA 2PRNA 2YNKA 3AA1A 1PHOA 3AAEB 3DWNA 4AUIA 5B5EO 3T24A 2LHFA 4RLCA 3HOLA 1IZNB 2R88A 4O3XB 2QTKA 4RL9A 4PJ0O 2KXPA 2O4VA 4N74A 3AA7B 3A0BO 4C4VB 4FESA 4XNKA 2Y0LA 1IZNA 4E1TA 4F4BA 1QJ9A 3PRNA 4N59A 3SZDA 1E54A 2AXTO 3VE2A 4D65A 2R4LA 2ZFGA 2F1TA 4FRTA 2IWVA 2XE2A 4FZNA 3AA7A 3SY9A 1PRNA 3AA0A 4C4VA 4FSPA 3LK3B 3T20A 5DL7A 3T0SA 3LK2B 1ORMA 3AAAA 5B66O 7PRNA 2GE4A 2PORA 4LSHA 4PR7A 3LK41 3GP6A 4E1SA 3JCUO 3PQSA 4UB6O 5D5DA 1Q9FA 3WU2O 3UPGA 5DL6A 1YS5A 4GCPA 4G76A 4BUMX 1GFQA 1ZHZA 3PGSA 4B61A 2KZ7A 3DWOX 1BH3A 3K19A 5EE2A 5KAIO 4AZLA 1OSMA 4CTDA 2MHLA 1ZHXA 2MNHA 2Y7SA 3FYXA 3QRAA 2R4OA 5GTIO 4AYMC 3HWBA 1H6S1 4RJWA 2Y0KA 2Y2XA 3LK3A 2J4UP 2R89A 3VE1A 4RJXA 3POUA 4FSOA 4AKRB 4KR8A 2R4PA 3HW9A 2YPVA 2WVPA 4JFBA 2K4TA
chains in the Genus database with same CATH topology
4LSIA 4D64A 4QQ1A 3AA6A 3POXA 4FT6A 3WI5A 3VZWX 2KC0A 4AFKA 4O3ZA 3TZGA 5JDPA 1MPFA 2M07A 4FUVA 2K0LA 1OPFA 2ODJA 3HOEA 4FOZA 3AA1B 4U9CA 2XE1A 4AYDC 3VY9X 2LFUA 4KRAA 4Z3TA 2XG6A 4D5UA 3C5OA 2KZ7B 5AFUL 4O3YA 4N58A 2XTRA 2W81C 4GCSA 4AYEC 5GV0A 4G75A 5DL8A 3VZTX 1ZHYA 2X27X 3JTYA 1HXXA 2ERVA 3RBHA 3LK2A 4XNLA 3V8UA 3AA0B 3PQUA 4O4XA 4FRXA 5AFUK 4O3WA 3POQA 3SYBA 1THQA 3AA6B 4LSFA 4JCHA 3KVDD 1Q9GA 4AYNA 3O0EA 4GCQA 8PRNA 5IYUA 2F1VA 3DA4A 3DA3A 3PORA 5PRNA 5G26A 3SY7A 1G90A 2KXPB 3A2SX 3SYSA 2N2MA 3EMNX 6PRNA 3AAEA 2XTQA 3NSGA 1ZHTA 4AKMA 1P4TA 4KR4A 3UAQA 4C69X 4FZMA 3LK42 1HXTA 3VZUX 1GFNA 1QJ8A 4FMSA 1HXUA 2KDYA 1GFOA 5FVNA 2XE3A 2FGRA 4RLBA 5DL5A 5T5FA 1ZHWA 2N2LA 3G7GA 1MM5A 2ZLDA 3QRCA 4PUXA 3UU2A 4AYID 1MM4A 5ADXL 3WI4A 3VY8X 2XE5A 4AKRA 5ADXK 1BT9A 1GFMA 4LSEA 2Y0HA 2FGQX 4GHBA 1GFPA 3SZVA 2OMFA 3AAAB 4O49A 4FZLA 2J1NA 2M06A 2W80C 4O4UA 1QJPA 1BXWA 4GF4A 2XMXA 2PRNA 2YNKA 3AA1A 1PHOA 3AAEB 4AUIA 3T24A 2LHFA 4RLCA 3HOLA 1IZNB 4O3XB 4RL9A 2QTKA 2KXPA 2O4VA 3AA7B 4FESA 4XNKA 2Y0LA 1IZNA 4E1TA 4F4BA 1QJ9A 3PRNA 4N59A 3SZDA 1E54A 3VE2A 4D65A 2ZFGA 2F1TA 4FRTA 2XE2A 4FZNA 3AA7A 3SY9A 1PRNA 3AA0A 3T20A 4FSPA 3LK3B 5DL7A 3T0SA 3LK2B 1ORMA 3AAAA 7PRNA 2GE4A 2PORA 4LSHA 4E1SA 3LK41 3GP6A 3PQSA 5D5DA 1Q9FA 3UPGA 5DL6A 1YS5A 4GCPA 4G76A 4BUMX 1GFQA 1ZHZA 4B61A 2KZ7A 3K19A 1BH3A 5EE2A 4AZLA 1OSMA 2MHLA 1ZHXA 2MNHA 2Y7SA 3FYXA 3QRAA 4AYMC 3HWBA 1H6S1 4RJWA 2Y0KA 2Y2XA 3LK3A 2J4UP 3VE1A 4RJXA 3POUA 4FSOA 4AKRB 4KR8A 3HW9A 2YPVA 2JMMA 4JFBA 2K4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSI A;  4D64 A;  3POX A;  4FT6 A;  3WI5 A;  3VZW X;  5JDP A;  1MPF A;  1OPF A;  2ODJ A;  4FOZ A;  2XE1 A;  3VY9 X;  4KRA A;  2XG6 A;  4D5U A;  4GCS A;  3VZT X;  5DL8 A;  3JTY A;  1HXX A;  4FRX A;  3POQ A;  3SYB A;  4LSF A;  3O0E A;  4GCQ A;  8PRN A;  5PRN A;  3POR A;  3SY7 A;  3A2S X;  3SYS A;  3EMN X;  6PRN A;  3NSG A;  4KR4 A;  4C69 X;  1HXT A;  3VZU X;  1GFN A;  4FMS A;  1HXU A;  1GFO A;  5FVN A;  2XE3 A;  2FGR A;  5DL5 A;  2ZLD A;  3UU2 A;  3WI4 A;  3VY8 X;  2XE5 A;  1BT9 A;  1GFM A;  4LSE A;  2Y0H A;  2FGQ X;  1GFP A;  3SZV A;  2OMF A;  2J1N A;  2PRN A;  1PHO A;  4AUI A;  3T24 A;  2QTK A;  2O4V A;  2Y0L A;  3PRN A;  3SZD A;  1E54 A;  4D65 A;  2ZFG A;  4FRT A;  2XE2 A;  3SY9 A;  1PRN A;  3T20 A;  4FSP A;  5DL7 A;  3T0S A;  7PRN A;  2POR A;  4LSH A;  3UPG A;  5DL6 A;  4GCP A;  4BUM X;  1GFQ A;  3K19 A;  1BH3 A;  1OSM A;  3FYX A;  3HWB A;  1H6S 1;  4RJW A;  2Y0K A;  2Y2X A;  2J4U P;  4RJX A;  3POU A;  4FSO A;  4KR8 A;  3HW9 A;  4JFB A;  2K4T A; 
#chains in the Genus database with same CATH topology
 4LSI A;  5KAF O;  4D64 A;  4QQ1 A;  3AA6 A;  2WJQ A;  3POX A;  4FT6 A;  3WI5 A;  3VZW X;  2KC0 A;  1S5L O;  4AFK A;  4O3Z A;  3TZG A;  2JMM A;  5JDP A;  1MPF A;  2M07 A;  4FUV A;  2K0L A;  1OPF A;  2ODJ A;  2IWW A;  4N75 A;  3HOE A;  4FOZ A;  3AA1 B;  4U9C A;  2XE1 A;  4AYD C;  3VY9 X;  2LFU A;  4KRA A;  4Z3T A;  2XG6 A;  4D5U A;  3C5O A;  2KZ7 B;  5AFU L;  4O3Y A;  4N58 A;  2XTR A;  4FQE A;  2WJR A;  2W81 C;  4GCS A;  4AYE C;  5GV0 A;  4G75 A;  5DL8 A;  3VZT X;  1ZHY A;  2R8A A;  2X27 X;  3JTY A;  1HXX A;  2ERV A;  3RBH A;  2JQY A;  3LK2 A;  4XNL A;  3NJT A;  3V8U A;  3AA0 B;  3PQU A;  4O4X A;  4FRX A;  5AFU K;  3PF1 A;  4O3W A;  3POQ A;  3SYB A;  1THQ A;  3AA6 B;  4LSF A;  4JCH A;  3PGR A;  3KVD D;  1Q9G A;  4IL6 O;  4C00 A;  1T16 A;  1T1L A;  3O0E A;  4GCQ A;  4AYN A;  5TIS O;  8PRN A;  5IYU A;  2F1V A;  3DA4 A;  3DA3 A;  3POR A;  5PRN A;  5G26 A;  3SY7 A;  1G90 A;  2KXP B;  2F1C X;  3A2S X;  3SYS A;  2N2M A;  3EMN X;  6PRN A;  3AAE A;  2XTQ A;  3NSG A;  2R4N A;  1ZHT A;  4AKM A;  1P4T A;  4KR4 A;  3UAQ A;  4C69 X;  5H2F O;  4FZM A;  3LK4 2;  2X9K A;  1HXT A;  3VZU X;  5G3A A;  3KZI O;  1GFN A;  1QJ8 A;  3A0H O;  4FMS A;  1HXU A;  4K3B A;  2KDY A;  5G38 A;  1GFO A;  5FVN A;  2XE3 A;  4K3C A;  2FGR A;  4RLB A;  5DL5 A;  3BS0 A;  1ZHW A;  2N2L A;  3G7G A;  1MM5 A;  2ZLD A;  3QRC A;  4PUX A;  5T5F A;  3UU2 A;  1MM4 A;  4AYI D;  5ADX L;  3WI4 A;  3BRY A;  3VY8 X;  2XE5 A;  4AKR A;  5ADX K;  1BT9 A;  3DZM A;  3PGU A;  1GFM A;  4LSE A;  3BRZ A;  5E79 O;  2Y0H A;  2FGQ X;  4GHB A;  1GFP A;  3SZV A;  5GTH O;  2OMF A;  3AAA B;  4O49 A;  4FZL A;  4UB8 O;  2J1N A;  2M06 A;  5G39 A;  2W80 C;  4O4U A;  1QJP A;  1BXW A;  4GF4 A;  2XMX A;  2PRN A;  2YNK A;  3AA1 A;  1PHO A;  3AAE B;  3DWN A;  4AUI A;  5B5E O;  3T24 A;  2LHF A;  4RLC A;  3HOL A;  1IZN B;  2R88 A;  4O3X B;  2QTK A;  4RL9 A;  4PJ0 O;  2KXP A;  2O4V A;  4N74 A;  3AA7 B;  3A0B O;  4C4V B;  4FES A;  4XNK A;  2Y0L A;  1IZN A;  4E1T A;  4F4B A;  1QJ9 A;  3PRN A;  4N59 A;  3SZD A;  1E54 A;  2AXT O;  3VE2 A;  4D65 A;  2R4L A;  2ZFG A;  2F1T A;  4FRT A;  2IWV A;  2XE2 A;  4FZN A;  3AA7 A;  3SY9 A;  1PRN A;  3AA0 A;  4C4V A;  4FSP A;  3LK3 B;  3T20 A;  5DL7 A;  3T0S A;  3LK2 B;  1ORM A;  3AAA A;  5B66 O;  7PRN A;  2GE4 A;  2POR A;  4LSH A;  4PR7 A;  3LK4 1;  3GP6 A;  4E1S A;  3JCU O;  3PQS A;  4UB6 O;  5D5D A;  1Q9F A;  3WU2 O;  3UPG A;  5DL6 A;  1YS5 A;  4GCP A;  4G76 A;  4BUM X;  1GFQ A;  1ZHZ A;  3PGS A;  4B61 A;  2KZ7 A;  3DWO X;  1BH3 A;  3K19 A;  5EE2 A;  5KAI O;  4AZL A;  1OSM A;  4CTD A;  2MHL A;  1ZHX A;  2MNH A;  2Y7S A;  3FYX A;  3QRA A;  2R4O A;  5GTI O;  4AYM C;  3HWB A;  1H6S 1;  4RJW A;  2Y0K A;  2Y2X A;  3LK3 A;  2J4U P;  2R89 A;  3VE1 A;  4RJX A;  3POU A;  4FSO A;  4AKR B;  4KR8 A;  2R4P A;  3HW9 A;  2YPV A;  2WVP A;  4JFB A;  2K4T A; 
#chains in the Genus database with same CATH homology
 4LSI A;  4D64 A;  4QQ1 A;  3AA6 A;  3POX A;  4FT6 A;  3WI5 A;  3VZW X;  2KC0 A;  4AFK A;  4O3Z A;  3TZG A;  5JDP A;  1MPF A;  2M07 A;  4FUV A;  2K0L A;  1OPF A;  2ODJ A;  3HOE A;  4FOZ A;  3AA1 B;  4U9C A;  2XE1 A;  4AYD C;  3VY9 X;  2LFU A;  4KRA A;  4Z3T A;  2XG6 A;  4D5U A;  3C5O A;  2KZ7 B;  5AFU L;  4O3Y A;  4N58 A;  2XTR A;  2W81 C;  4GCS A;  4AYE C;  5GV0 A;  4G75 A;  5DL8 A;  3VZT X;  1ZHY A;  2X27 X;  3JTY A;  1HXX A;  2ERV A;  3RBH A;  3LK2 A;  4XNL A;  3V8U A;  3AA0 B;  3PQU A;  4O4X A;  4FRX A;  5AFU K;  4O3W A;  3POQ A;  3SYB A;  1THQ A;  3AA6 B;  4LSF A;  4JCH A;  3KVD D;  1Q9G A;  4AYN A;  3O0E A;  4GCQ A;  8PRN A;  5IYU A;  2F1V A;  3DA4 A;  3DA3 A;  3POR A;  5PRN A;  5G26 A;  3SY7 A;  1G90 A;  2KXP B;  3A2S X;  3SYS A;  2N2M A;  3EMN X;  6PRN A;  3AAE A;  2XTQ A;  3NSG A;  1ZHT A;  4AKM A;  1P4T A;  4KR4 A;  3UAQ A;  4C69 X;  4FZM A;  3LK4 2;  1HXT A;  3VZU X;  1GFN A;  1QJ8 A;  4FMS A;  1HXU A;  2KDY A;  1GFO A;  5FVN A;  2XE3 A;  2FGR A;  4RLB A;  5DL5 A;  5T5F A;  1ZHW A;  2N2L A;  3G7G A;  1MM5 A;  2ZLD A;  3QRC A;  4PUX A;  3UU2 A;  4AYI D;  1MM4 A;  5ADX L;  3WI4 A;  3VY8 X;  2XE5 A;  4AKR A;  5ADX K;  1BT9 A;  1GFM A;  4LSE A;  2Y0H A;  2FGQ X;  4GHB A;  1GFP A;  3SZV A;  2OMF A;  3AAA B;  4O49 A;  4FZL A;  2J1N A;  2M06 A;  2W80 C;  4O4U A;  1QJP A;  1BXW A;  4GF4 A;  2XMX A;  2PRN A;  2YNK A;  3AA1 A;  1PHO A;  3AAE B;  4AUI A;  3T24 A;  2LHF A;  4RLC A;  3HOL A;  1IZN B;  4O3X B;  4RL9 A;  2QTK A;  2KXP A;  2O4V A;  3AA7 B;  4FES A;  4XNK A;  2Y0L A;  1IZN A;  4E1T A;  4F4B A;  1QJ9 A;  3PRN A;  4N59 A;  3SZD A;  1E54 A;  3VE2 A;  4D65 A;  2ZFG A;  2F1T A;  4FRT A;  2XE2 A;  4FZN A;  3AA7 A;  3SY9 A;  1PRN A;  3AA0 A;  3T20 A;  4FSP A;  3LK3 B;  5DL7 A;  3T0S A;  3LK2 B;  1ORM A;  3AAA A;  7PRN A;  2GE4 A;  2POR A;  4LSH A;  4E1S A;  3LK4 1;  3GP6 A;  3PQS A;  5D5D A;  1Q9F A;  3UPG A;  5DL6 A;  1YS5 A;  4GCP A;  4G76 A;  4BUM X;  1GFQ A;  1ZHZ A;  4B61 A;  2KZ7 A;  3K19 A;  1BH3 A;  5EE2 A;  4AZL A;  1OSM A;  2MHL A;  1ZHX A;  2MNH A;  2Y7S A;  3FYX A;  3QRA A;  4AYM C;  3HWB A;  1H6S 1;  4RJW A;  2Y0K A;  2Y2X A;  3LK3 A;  2J4U P;  3VE1 A;  4RJX A;  3POU A;  4FSO A;  4AKR B;  4KR8 A;  3HW9 A;  2YPV A;  2JMM A;  4JFB A;  2K4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...