4FOZA

Crystal structure of occd1 (oprd) y282r/d307h
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
420
structure length
377
Chain Sequence
DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTGNLPVPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFARLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAVAYTLDAHTFTLAYQKVHGDQPFDRIGFIFLANSVQYSHFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward Understanding the Outer Membrane Uptake of Small Molecules by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
molecule keywords Porin D
total genus 108
structure length 377
sequence length 420
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4fozA01
5DL5A 4RJXA 4LSEA 1GFMA 2PORA 4D65A 1PRNA 2FGQX 3A2SX 2QTKA 4KRAA 4FT6A 4FSPA 1BT9A 5DL6A 2Y0KA 3SZDA 3HWBA 4LSHA 3NSGA 4LSIA 3SY7A 1GFOA 3VY9X 1BH3A 4FMSA 1HXXA 1MPFA 1GFPA 8PRNA 1E54A 3PORA 3HW9A 2XE3A 4AUIA 2XE1A 3T24A 2Y2XA 2K4TA 2ODJA 2PRNA 4FOZA 4BUMX 3POUA 6PRNA 1HXTA 2J1NA 5DL8A 2Y0HA 1GFNA 2O4VA 3POXA 5PRNA 1OSMA 3UPGA 3T20A 3SYBA 3O0EA 4GCPA 4KR8A 5JDPA 2J4UP 4LSFA 3EMNX 4FRTA 4D64A 4C69X 3K19A 1GFQA 3UU2A 3VZTX 4GCSA 2XE5A 3POQA 3PRNA 2XG6A 3SY9A 3VZWX 3WI5A 3SZVA 3JTYA 4JFBA 2OMFA 1HXUA 1PHOA 4GCQA 5DL7A 3VZUX 3WI4A 3VY8X 4D5UA 5FVNA 7PRNA 3FYXA 1OPFA 4KR4A 2ZLDA 4FSOA 3SYSA 2XE2A 2FGRA 1H6S1 4RJWA 4FRXA 3T0SA 2Y0LA 2ZFGA
chains in the Genus database with same CATH superfamily
5DL5A 4RJXA 4LSEA 4RLBA 2KXPB 2KZ7A 1GFMA 2PORA 4D65A 1PRNA 2FGQX 3A2SX 1ORMA 2QTKA 3LK3A 4KRAA 4FT6A 2R4PA 4FSPA 2F1TA 4O4XA 2Y7SA 5EE2A 1BT9A 5G38A 5DL6A 2Y0KA 2N2MA 3SZDA 2F1CX 1ZHZA 3HWBA 4LSHA 3NSGA 4O3XB 4RLCA 4Z3TA 3AAAB 3LK42 4LSIA 3SY7A 3HOEA 3PGRA 1GFOA 4E1TA 5ADXK 3V8UA 3VY9X 1BH3A 2LHFA 4UB6O 2W81C 4FMSA 4C4VB 1HXXA 1MPFA 1GFPA 8PRNA 1IZNA 1Q9GA 4B61A 3GP6A 1E54A 3DA3A 4FZLA 4O49A 2IWVA 3PORA 3HW9A 4O3WA 5E79O 4JCHA 2XE3A 4AUIA 2MHLA 2JMMA 2XE1A 3T24A 4AYID 4F4BA 2IWWA 2XMXA 5G26A 2KC0A 5B66O 4N59A 2W80C 2Y2XA 4G75A 2K4TA 5GTHO 3PQSA 5TISO 1QJPA 2ODJA 2PRNA 1QJ9A 2KDYA 4FOZA 3WU2O 2WJQA 2WVPA 3POUA 3BRYA 4BUMX 5AFUL 3LK41 4GF4A 4U9CA 2YPVA 1HXTA 3G7GA 2J1NA 1ZHTA 3LK2B 4O4UA 5DL8A 6PRNA 3LK3B 2Y0HA 1MM4A 1GFNA 3KVDD 2O4VA 2WJRA 4O3YA 3A0BO 1BXWA 2AXTO 3AAEA 3POXA 2K0LA 2M07A 3HOLA 3PGUA 4RL9A 4CTDA 5PRNA 5IYUA 4AYDC 3JCUO 3PF1A 1OSMA 3UPGA 2R4LA 5D5DA 4AFKA 4AKMA 3T20A 3DWOX 4K3CA 1ZHYA 3AA7A 3SYBA 3O0EA 2MNHA 4GCPA 4KR8A 3BS0A 5JDPA 5G3AA 4PUXA 2J4UP 4K3BA 1ZHWA 5T5FA 3AA6A 2M06A 4LSFA 3EMNX 5GV0A 4FZNA 3VE2A 4FRTA 3AA0A 5KAFO 3AAAA 2X27X 3AAEB 3DZMA 4D64A 4C69X 1QJ8A 3K19A 3LK2A 4FESA 4QQ1A 1G90A 3AA7B 1GFQA 3UU2A 1ZHXA 3TZGA 2XTRA 1Q9FA 3VZTX 4AYEC 1YS5A 3NJTA 4GCSA 2XE5A 4FUVA 2R88A 3POQA 3PGSA 1P4TA 3PRNA 3AA0B 4IL6O 2XG6A 4N58A 4UB8O 4GHBA 4XNKA 3SY9A 3RBHA 3VZWX 5AFUK 4N74A 3VE1A 5ADXL 3QRCA 3WI5A 3AA1A 4C00A 2GE4A 3DWNA 4AYNA 2F1VA 2YNKA 4PJ0O 3SZVA 4AKRB 2R4NA 4O3ZA 2JQYA 3A0HO 4FZMA 5G39A 5GTIO 3JTYA 4JFBA 3DA4A 2OMFA 3C5OA 1S5LO 5H2FO 1HXUA 2ERVA 2KXPA 2KZ7B 2N2LA 2R4OA 1PHOA 4GCQA 5KAIO 5DL7A 4FQEA 5B5EO 3VZUX 4PR7A 3AA1B 3WI4A 1MM5A 4AYMC 3QRAA 3VY8X 4C4VA 4D5UA 5FVNA 2LFUA 2R8AA 4XNLA 7PRNA 3FYXA 3BRZA 4AZLA 4E1SA 2X9KA 3PQUA 1OPFA 4N75A 4KR4A 2ZLDA 4FSOA 1THQA 3AA6B 3KZIO 4G76A 3SYSA 2XE2A 2FGRA 1H6S1 2XTQA 4FRXA 4RJWA 4AKRA 3T0SA 1T16A 1IZNB 3UAQA 2Y0LA 2ZFGA 2R89A 1T1LA
chains in the Genus database with same CATH topology
5DL5A 4RJXA 4LSEA 4RLBA 2KXPB 2KZ7A 1GFMA 2PORA 4D65A 1PRNA 2FGQX 3A2SX 1ORMA 2QTKA 3LK3A 4KRAA 4FT6A 4FSPA 2F1TA 4O4XA 2Y7SA 5EE2A 1BT9A 5DL6A 2Y0KA 2N2MA 3SZDA 3HWBA 1ZHZA 4RLCA 4LSHA 3NSGA 4O3XB 4Z3TA 3AAAB 3LK42 4LSIA 3SY7A 3HOEA 1GFOA 4E1TA 5ADXK 3V8UA 3VY9X 1BH3A 2LHFA 2W81C 4FMSA 1HXXA 1MPFA 1GFPA 8PRNA 1IZNA 1Q9GA 4B61A 3GP6A 1E54A 3DA3A 4FZLA 4O49A 3PORA 3HW9A 4O3WA 4F4BA 4JCHA 2XE3A 4AUIA 2MHLA 2JMMA 2XE1A 3T24A 4AYID 2XMXA 5G26A 2KC0A 4N59A 2W80C 2Y2XA 4G75A 2K4TA 3PQSA 1QJPA 2ODJA 2PRNA 1QJ9A 2KDYA 4FOZA 4BUMX 5AFUL 3POUA 3LK41 4GF4A 4U9CA 2YPVA 1HXTA 3G7GA 2J1NA 1ZHTA 3LK2B 4O4UA 5DL8A 6PRNA 3LK3B 2Y0HA 1MM4A 1GFNA 3KVDD 2O4VA 4O3YA 1BXWA 3AAEA 3POXA 2K0LA 2M07A 3HOLA 4RL9A 5PRNA 5IYUA 4AYDC 1OSMA 3UPGA 5D5DA 4AFKA 3T20A 4AKMA 1ZHYA 3AA7A 3SYBA 3O0EA 2MNHA 4GCPA 4KR8A 5JDPA 4PUXA 2J4UP 5T5FA 1ZHWA 3AA6A 2M06A 4LSFA 3EMNX 5GV0A 4FZNA 3VE2A 4FRTA 3AA0A 3AAAA 2X27X 3AAEB 4D64A 4C69X 1QJ8A 3K19A 3LK2A 4FESA 4QQ1A 1G90A 3AA7B 1GFQA 3UU2A 1ZHXA 3TZGA 2XTRA 1Q9FA 3VZTX 4AYEC 1YS5A 4GCSA 2XE5A 4FUVA 3POQA 1P4TA 3PRNA 3AA0B 4N58A 2XG6A 4XNKA 3SY9A 4GHBA 5AFUK 3RBHA 3VZWX 5ADXL 3VE1A 3QRCA 3WI5A 3AA1A 2GE4A 4AYNA 2F1VA 2YNKA 3SZVA 4AKRB 4O3ZA 4FZMA 3JTYA 4JFBA 3DA4A 2OMFA 3C5OA 1HXUA 2ERVA 2KXPA 2KZ7B 2N2LA 1PHOA 4GCQA 5DL7A 3VZUX 3WI4A 3AA1B 4AYMC 1MM5A 3QRAA 3VY8X 4D5UA 5FVNA 2LFUA 4XNLA 7PRNA 3FYXA 4AZLA 4E1SA 3PQUA 1OPFA 4KR4A 2ZLDA 4FSOA 1THQA 3AA6B 4G76A 3SYSA 2XE2A 2FGRA 1H6S1 2XTQA 4FRXA 4RJWA 4AKRA 3T0SA 1IZNB 3UAQA 2Y0LA 2ZFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DL5 A;  4RJX A;  4LSE A;  1GFM A;  2POR A;  4D65 A;  1PRN A;  2FGQ X;  3A2S X;  2QTK A;  4KRA A;  4FT6 A;  4FSP A;  1BT9 A;  5DL6 A;  2Y0K A;  3SZD A;  3HWB A;  4LSH A;  3NSG A;  4LSI A;  3SY7 A;  1GFO A;  3VY9 X;  1BH3 A;  4FMS A;  1HXX A;  1MPF A;  1GFP A;  8PRN A;  1E54 A;  3POR A;  3HW9 A;  2XE3 A;  4AUI A;  2XE1 A;  3T24 A;  2Y2X A;  2K4T A;  2ODJ A;  2PRN A;  4FOZ A;  4BUM X;  3POU A;  6PRN A;  1HXT A;  2J1N A;  5DL8 A;  2Y0H A;  1GFN A;  2O4V A;  3POX A;  5PRN A;  1OSM A;  3UPG A;  3T20 A;  3SYB A;  3O0E A;  4GCP A;  4KR8 A;  5JDP A;  2J4U P;  4LSF A;  3EMN X;  4FRT A;  4D64 A;  4C69 X;  3K19 A;  1GFQ A;  3UU2 A;  3VZT X;  4GCS A;  2XE5 A;  3POQ A;  3PRN A;  2XG6 A;  3SY9 A;  3VZW X;  3WI5 A;  3SZV A;  3JTY A;  4JFB A;  2OMF A;  1HXU A;  1PHO A;  4GCQ A;  5DL7 A;  3VZU X;  3WI4 A;  3VY8 X;  4D5U A;  5FVN A;  7PRN A;  3FYX A;  1OPF A;  4KR4 A;  2ZLD A;  4FSO A;  3SYS A;  2XE2 A;  2FGR A;  1H6S 1;  4RJW A;  4FRX A;  3T0S A;  2Y0L A;  2ZFG A; 
#chains in the Genus database with same CATH topology
 5DL5 A;  4RJX A;  4LSE A;  4RLB A;  2KXP B;  2KZ7 A;  1GFM A;  2POR A;  4D65 A;  1PRN A;  2FGQ X;  3A2S X;  1ORM A;  2QTK A;  3LK3 A;  4KRA A;  4FT6 A;  2R4P A;  4FSP A;  2F1T A;  4O4X A;  2Y7S A;  5EE2 A;  1BT9 A;  5G38 A;  5DL6 A;  2Y0K A;  2N2M A;  3SZD A;  2F1C X;  1ZHZ A;  3HWB A;  4LSH A;  3NSG A;  4O3X B;  4RLC A;  4Z3T A;  3AAA B;  3LK4 2;  4LSI A;  3SY7 A;  3HOE A;  3PGR A;  1GFO A;  4E1T A;  5ADX K;  3V8U A;  3VY9 X;  1BH3 A;  2LHF A;  4UB6 O;  2W81 C;  4FMS A;  4C4V B;  1HXX A;  1MPF A;  1GFP A;  8PRN A;  1IZN A;  1Q9G A;  4B61 A;  3GP6 A;  1E54 A;  3DA3 A;  4FZL A;  4O49 A;  2IWV A;  3POR A;  3HW9 A;  4O3W A;  5E79 O;  4JCH A;  2XE3 A;  4AUI A;  2MHL A;  2JMM A;  2XE1 A;  3T24 A;  4AYI D;  4F4B A;  2IWW A;  2XMX A;  5G26 A;  2KC0 A;  5B66 O;  4N59 A;  2W80 C;  2Y2X A;  4G75 A;  2K4T A;  5GTH O;  3PQS A;  5TIS O;  1QJP A;  2ODJ A;  2PRN A;  1QJ9 A;  2KDY A;  4FOZ A;  3WU2 O;  2WJQ A;  2WVP A;  3POU A;  3BRY A;  4BUM X;  5AFU L;  3LK4 1;  4GF4 A;  4U9C A;  2YPV A;  1HXT A;  3G7G A;  2J1N A;  1ZHT A;  3LK2 B;  4O4U A;  5DL8 A;  6PRN A;  3LK3 B;  2Y0H A;  1MM4 A;  1GFN A;  3KVD D;  2O4V A;  2WJR A;  4O3Y A;  3A0B O;  1BXW A;  2AXT O;  3AAE A;  3POX A;  2K0L A;  2M07 A;  3HOL A;  3PGU A;  4RL9 A;  4CTD A;  5PRN A;  5IYU A;  4AYD C;  3JCU O;  3PF1 A;  1OSM A;  3UPG A;  2R4L A;  5D5D A;  4AFK A;  4AKM A;  3T20 A;  3DWO X;  4K3C A;  1ZHY A;  3AA7 A;  3SYB A;  3O0E A;  2MNH A;  4GCP A;  4KR8 A;  3BS0 A;  5JDP A;  5G3A A;  4PUX A;  2J4U P;  4K3B A;  1ZHW A;  5T5F A;  3AA6 A;  2M06 A;  4LSF A;  3EMN X;  5GV0 A;  4FZN A;  3VE2 A;  4FRT A;  3AA0 A;  5KAF O;  3AAA A;  2X27 X;  3AAE B;  3DZM A;  4D64 A;  4C69 X;  1QJ8 A;  3K19 A;  3LK2 A;  4FES A;  4QQ1 A;  1G90 A;  3AA7 B;  1GFQ A;  3UU2 A;  1ZHX A;  3TZG A;  2XTR A;  1Q9F A;  3VZT X;  4AYE C;  1YS5 A;  3NJT A;  4GCS A;  2XE5 A;  4FUV A;  2R88 A;  3POQ A;  3PGS A;  1P4T A;  3PRN A;  3AA0 B;  4IL6 O;  2XG6 A;  4N58 A;  4UB8 O;  4GHB A;  4XNK A;  3SY9 A;  3RBH A;  3VZW X;  5AFU K;  4N74 A;  3VE1 A;  5ADX L;  3QRC A;  3WI5 A;  3AA1 A;  4C00 A;  2GE4 A;  3DWN A;  4AYN A;  2F1V A;  2YNK A;  4PJ0 O;  3SZV A;  4AKR B;  2R4N A;  4O3Z A;  2JQY A;  3A0H O;  4FZM A;  5G39 A;  5GTI O;  3JTY A;  4JFB A;  3DA4 A;  2OMF A;  3C5O A;  1S5L O;  5H2F O;  1HXU A;  2ERV A;  2KXP A;  2KZ7 B;  2N2L A;  2R4O A;  1PHO A;  4GCQ A;  5KAI O;  5DL7 A;  4FQE A;  5B5E O;  3VZU X;  4PR7 A;  3AA1 B;  3WI4 A;  1MM5 A;  4AYM C;  3QRA A;  3VY8 X;  4C4V A;  4D5U A;  5FVN A;  2LFU A;  2R8A A;  4XNL A;  7PRN A;  3FYX A;  3BRZ A;  4AZL A;  4E1S A;  2X9K A;  3PQU A;  1OPF A;  4N75 A;  4KR4 A;  2ZLD A;  4FSO A;  1THQ A;  3AA6 B;  3KZI O;  4G76 A;  3SYS A;  2XE2 A;  2FGR A;  1H6S 1;  2XTQ A;  4FRX A;  4RJW A;  4AKR A;  3T0S A;  1T16 A;  1IZN B;  3UAQ A;  2Y0L A;  2ZFG A;  2R89 A;  1T1L A; 
#chains in the Genus database with same CATH homology
 5DL5 A;  4RJX A;  4LSE A;  4RLB A;  2KXP B;  2KZ7 A;  1GFM A;  2POR A;  4D65 A;  1PRN A;  2FGQ X;  3A2S X;  1ORM A;  2QTK A;  3LK3 A;  4KRA A;  4FT6 A;  4FSP A;  2F1T A;  4O4X A;  2Y7S A;  5EE2 A;  1BT9 A;  5DL6 A;  2Y0K A;  2N2M A;  3SZD A;  3HWB A;  1ZHZ A;  4RLC A;  4LSH A;  3NSG A;  4O3X B;  4Z3T A;  3AAA B;  3LK4 2;  4LSI A;  3SY7 A;  3HOE A;  1GFO A;  4E1T A;  5ADX K;  3V8U A;  3VY9 X;  1BH3 A;  2LHF A;  2W81 C;  4FMS A;  1HXX A;  1MPF A;  1GFP A;  8PRN A;  1IZN A;  1Q9G A;  4B61 A;  3GP6 A;  1E54 A;  3DA3 A;  4FZL A;  4O49 A;  3POR A;  3HW9 A;  4O3W A;  4F4B A;  4JCH A;  2XE3 A;  4AUI A;  2MHL A;  2JMM A;  2XE1 A;  3T24 A;  4AYI D;  2XMX A;  5G26 A;  2KC0 A;  4N59 A;  2W80 C;  2Y2X A;  4G75 A;  2K4T A;  3PQS A;  1QJP A;  2ODJ A;  2PRN A;  1QJ9 A;  2KDY A;  4FOZ A;  4BUM X;  5AFU L;  3POU A;  3LK4 1;  4GF4 A;  4U9C A;  2YPV A;  1HXT A;  3G7G A;  2J1N A;  1ZHT A;  3LK2 B;  4O4U A;  5DL8 A;  6PRN A;  3LK3 B;  2Y0H A;  1MM4 A;  1GFN A;  3KVD D;  2O4V A;  4O3Y A;  1BXW A;  3AAE A;  3POX A;  2K0L A;  2M07 A;  3HOL A;  4RL9 A;  5PRN A;  5IYU A;  4AYD C;  1OSM A;  3UPG A;  5D5D A;  4AFK A;  3T20 A;  4AKM A;  1ZHY A;  3AA7 A;  3SYB A;  3O0E A;  2MNH A;  4GCP A;  4KR8 A;  5JDP A;  4PUX A;  2J4U P;  5T5F A;  1ZHW A;  3AA6 A;  2M06 A;  4LSF A;  3EMN X;  5GV0 A;  4FZN A;  3VE2 A;  4FRT A;  3AA0 A;  3AAA A;  2X27 X;  3AAE B;  4D64 A;  4C69 X;  1QJ8 A;  3K19 A;  3LK2 A;  4FES A;  4QQ1 A;  1G90 A;  3AA7 B;  1GFQ A;  3UU2 A;  1ZHX A;  3TZG A;  2XTR A;  1Q9F A;  3VZT X;  4AYE C;  1YS5 A;  4GCS A;  2XE5 A;  4FUV A;  3POQ A;  1P4T A;  3PRN A;  3AA0 B;  4N58 A;  2XG6 A;  4XNK A;  3SY9 A;  4GHB A;  5AFU K;  3RBH A;  3VZW X;  5ADX L;  3VE1 A;  3QRC A;  3WI5 A;  3AA1 A;  2GE4 A;  4AYN A;  2F1V A;  2YNK A;  3SZV A;  4AKR B;  4O3Z A;  4FZM A;  3JTY A;  4JFB A;  3DA4 A;  2OMF A;  3C5O A;  1HXU A;  2ERV A;  2KXP A;  2KZ7 B;  2N2L A;  1PHO A;  4GCQ A;  5DL7 A;  3VZU X;  3WI4 A;  3AA1 B;  4AYM C;  1MM5 A;  3QRA A;  3VY8 X;  4D5U A;  5FVN A;  2LFU A;  4XNL A;  7PRN A;  3FYX A;  4AZL A;  4E1S A;  3PQU A;  1OPF A;  4KR4 A;  2ZLD A;  4FSO A;  1THQ A;  3AA6 B;  4G76 A;  3SYS A;  2XE2 A;  2FGR A;  1H6S 1;  2XTQ A;  4FRX A;  4RJW A;  4AKR A;  3T0S A;  1IZN B;  3UAQ A;  2Y0L A;  2ZFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...