4FOZA

Crystal structure of occd1 (oprd) y282r/d307h
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
420
structure length
377
Chain Sequence
b'DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTGNLPVPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFARLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAVAYTLDAHTFTLAYQKVHGDQPFDRIGFIFLANSVQYSHFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin D
publication title Toward Understanding the Outer Membrane Uptake of Small Molecules by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 108
structure length 377
sequence length 420
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4fozA01
4FRTA 4LSFA 2XE5A 1OSMA 2Y0HA 2OMFA 4FSPA 3POUA 3UPGA 7PRNA 3JTYA 3VY9X 4BUMX 4GCQA 3SY9A 2Y2XA 1MPFA 8PRNA 4LSEA 4FT6A 2PRNA 3VZWX 3WI4A 5DL7A 4KR8A 2O4VA 4KR4A 4LSHA 3O0EA 4KRAA 1GFPA 1HXTA 1GFOA 3K19A 2XG6A 2ZFGA 1HXUA 1E54A 2K4TA 2QTKA 2J4UP 3POQA 1PRNA 3VY8X 4D65A 3SY7A 1HXXA 3EMNX 5DL8A 5FVNA 1GFMA 2FGQX 1OPFA 4GCPA 5PRNA 3HWBA 3PRNA 3HW9A 3POXA 3VZUX 5JDPA 3T20A 4D64A 4LSIA 4FMSA 1BT9A 2XE3A 4AUIA 2ZLDA 4D5UA 3T0SA 2Y0KA 2XE2A 3A2SX 4FSOA 2ODJA 3UU2A 3VZTX 1GFNA 2J1NA 4GCSA 3FYXA 4JFBA 2FGRA 4FOZA 4RJWA 4C69X 6PRNA 3T24A 1BH3A 1PHOA 3WI5A 3SZDA 3SZVA 2PORA 2Y0LA 5DL6A 4FRXA 2XE1A 3SYSA 1H6S1 3NSGA 3PORA 3SYBA 1GFQA 5DL5A 4RJXA
chains in the Genus database with same CATH superfamily
1Q9GA 4FRTA 4LSFA 3QRAA 3VE1A 3AA7B 5ADXK 2MHLA 5GV0A 2X27X 1T1LA 3AA7A 4G75A 3BRZA 3AAAB 4E1SA 2WJRA 2XE5A 5G3AA 3AAAA 1OSMA 5T5FA 2Y0HA 5KAFO 4QQ1A 2OMFA 3LK41 2R4NA 4FSPA 2WJQA 1QJPA 3JCUO 3POUA 4FQEA 2R88A 4RJXA 4UB8O 3PF1A 5GTIO 3TZGA 4AYEC 7PRNA 1ZHTA 4O3WA 3UPGA 1ORMA 3JTYA 1Q9FA 2X9KA 2N2MA 3VY9X 4BUMX 2F1TA 4O4XA 2JMMA 4GCQA 3PQUA 3SY9A 3KZIO 2KC0A 4AFKA 3HOEA 2Y2XA 3DA4A 1MPFA 2IWVA 2KXPB 2XMXA 3KVDD 4LSEA 4O3ZA 4AYID 4FT6A 5G38A 5TISO 2KXPA 1ZHWA 2PRNA 2M06A 3VZWX 2KZ7A 3WI4A 2W80C 4PUXA 2M07A 4KR8A 5DL7A 2O4VA 5G39A 4KR4A 2K0LA 4LSHA 5B5EO 3A0BO 3O0EA 8PRNA 4KRAA 4RLBA 4N75A 1GFPA 4C4VB 2IWWA 2R4LA 1BXWA 3PGUA 3AAEB 4C4VA 1HXTA 1GFOA 2GE4A 3K19A 3AAEA 2XG6A 1YS5A 2ZFGA 4O49A 1HXUA 1E54A 3BRYA 1THQA 2K4TA 2QTKA 4CTDA 3BS0A 4AZLA 4AYNA 2J4UP 3DA3A 3DWOX 3POQA 1PRNA 3GP6A 5E79O 3A0HO 3VY8X 4D65A 2MNHA 2JQYA 3AA0B 3C5OA 5B66O 5GTHO 3SY7A 4AKRB 1HXXA 4IL6O 3AA0A 3EMNX 3VE2A 5DL8A 4RL9A 5FVNA 2FGQX 1GFMA 1QJ8A 2KZ7B 4PR7A 3V8UA 4AKRA 1OPFA 4GCPA 3RBHA 5PRNA 3HWBA 4O3XB 4UB6O 3DWNA 4FZMA 3PRNA 3HW9A 3POXA 3VZUX 5JDPA 1ZHYA 2ERVA 3T20A 1IZNB 5EE2A 4D64A 2R8AA 4LSIA 1IZNA 5IYUA 4FMSA 2LFUA 1BT9A 2XE3A 4O4UA 4AUIA 4AYDC 4O3YA 4F4BA 1QJ9A 5KAIO 1S5LO 2ZLDA 3SYBA 4D5UA 4K3CA 1P4TA 3T0SA 2XTQA 4FUVA 4FESA 2R4OA 2Y0KA 4Z3TA 2XE2A 4AYMC 1ZHXA 4FZLA 3A2SX 2N2LA 2ODJA 3AA1B 4FSOA 3UU2A 3VZTX 1GFNA 2J1NA 3AA1A 4FZNA 4GCSA 3FYXA 3QRCA 4JCHA 3LK42 3AA6B 2F1VA 3PGRA 2FGRA 4JFBA 4FOZA 1MM4A 4K3BA 4E1TA 3AA6A 4N59A 4RLCA 4RJWA 3UAQA 4C69X 1G90A 2YPVA 4XNKA 3NJTA 1T16A 3LK2B 2AXTO 6PRNA 4AKMA 5H2FO 2F1CX 3LK2A 4G76A 2R4PA 1BH3A 2XTRA 4GHBA 3T24A 1PHOA 3WI5A 3SZDA 2Y7SA 3SZVA 3PQSA 2PORA 5G26A 3WU2O 2Y0LA 5DL6A 4FRXA 2XE1A 4GF4A 4N74A 1MM5A 3SYSA 5AFUL 3G7GA 4C00A 2KDYA 3DZMA 1ZHZA 3HOLA 4XNLA 4PJ0O 2LHFA 5D5DA 5AFUK 2W81C 4B61A 2YNKA 3LK3B 3PGSA 1H6S1 2R89A 3NSGA 4U9CA 5ADXL 3PORA 3LK3A 1GFQA 5DL5A 4N58A 2WVPA
chains in the Genus database with same CATH topology
1Q9GA 4FRTA 4LSFA 3QRAA 3VE1A 3AA7B 5ADXK 2MHLA 5GV0A 2X27X 3AA7A 4G75A 4E1SA 3AAAB 2XE5A 3AAAA 1OSMA 5T5FA 2Y0HA 4QQ1A 2OMFA 3LK41 4FSPA 1QJPA 3POUA 3TZGA 3UPGA 7PRNA 4AYEC 1ZHTA 4O3WA 1ORMA 3JTYA 1Q9FA 3VY9X 2N2MA 4BUMX 2F1TA 4O4XA 2JMMA 4GCQA 3PQUA 3SY9A 2KC0A 4AFKA 3HOEA 2Y2XA 3DA4A 1MPFA 2XMXA 2KXPB 3KVDD 4O3ZA 4LSEA 4AYID 8PRNA 4FT6A 2KXPA 1ZHWA 2PRNA 2M06A 3VZWX 2KZ7A 3WI4A 2W80C 4PUXA 2M07A 4KR8A 5DL7A 2O4VA 4KR4A 2K0LA 4LSHA 3O0EA 4KRAA 4RLBA 1GFPA 1BXWA 3AAEB 1HXTA 1GFOA 2GE4A 3K19A 3AAEA 2XG6A 1YS5A 2ZFGA 4O49A 1HXUA 1E54A 1THQA 2K4TA 2QTKA 4AZLA 4AYNA 2J4UP 3DA3A 3POQA 1PRNA 3GP6A 3VY8X 4D65A 2MNHA 3AA0B 3C5OA 3SY7A 4AKRB 1HXXA 3AA0A 3EMNX 3VE2A 5DL8A 4RL9A 5FVNA 2FGQX 1GFMA 1QJ8A 2KZ7B 4AKRA 3V8UA 1OPFA 4GCPA 3RBHA 5PRNA 3HWBA 4O3XB 4FZMA 3PRNA 3HW9A 3POXA 3VZUX 5JDPA 1ZHYA 2ERVA 3T20A 1IZNB 5EE2A 4D64A 4LSIA 1IZNA 5IYUA 4FMSA 2LFUA 1BT9A 2XE3A 4O4UA 4AUIA 4AYDC 4O3YA 4F4BA 1QJ9A 2ZLDA 3SYBA 4D5UA 1P4TA 3T0SA 2XTQA 4FUVA 4FESA 2Y0KA 4Z3TA 2XE2A 4AYMC 1ZHXA 4FZLA 3A2SX 2N2LA 2ODJA 3AA1B 4FSOA 3UU2A 3VZTX 1GFNA 2J1NA 3AA1A 4FZNA 4GCSA 3FYXA 3QRCA 4JCHA 3LK42 3AA6B 2F1VA 4JFBA 2FGRA 4FOZA 1MM4A 4E1TA 3AA6A 4N59A 4RLCA 4RJWA 3UAQA 4C69X 1G90A 2YPVA 4XNKA 3LK2B 6PRNA 4AKMA 3LK2A 4G76A 3T24A 1BH3A 2XTRA 4GHBA 1PHOA 3WI5A 3SZDA 2Y7SA 3SZVA 3PQSA 2PORA 5G26A 2Y0LA 5DL6A 4FRXA 2XE1A 4GF4A 3SYSA 1MM5A 5AFUL 3G7GA 2KDYA 3HOLA 1ZHZA 4XNLA 2LHFA 5D5DA 5AFUK 2W81C 4B61A 2YNKA 3LK3B 1H6S1 3NSGA 4U9CA 5ADXL 3PORA 3LK3A 1GFQA 5DL5A 4N58A 4RJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRT A;  4LSF A;  2XE5 A;  1OSM A;  2Y0H A;  2OMF A;  4FSP A;  3POU A;  3UPG A;  7PRN A;  3JTY A;  3VY9 X;  4BUM X;  4GCQ A;  3SY9 A;  2Y2X A;  1MPF A;  8PRN A;  4LSE A;  4FT6 A;  2PRN A;  3VZW X;  3WI4 A;  5DL7 A;  4KR8 A;  2O4V A;  4KR4 A;  4LSH A;  3O0E A;  4KRA A;  1GFP A;  1HXT A;  1GFO A;  3K19 A;  2XG6 A;  2ZFG A;  1HXU A;  1E54 A;  2K4T A;  2QTK A;  2J4U P;  3POQ A;  1PRN A;  3VY8 X;  4D65 A;  3SY7 A;  1HXX A;  3EMN X;  5DL8 A;  5FVN A;  1GFM A;  2FGQ X;  1OPF A;  4GCP A;  5PRN A;  3HWB A;  3PRN A;  3HW9 A;  3POX A;  3VZU X;  5JDP A;  3T20 A;  4D64 A;  4LSI A;  4FMS A;  1BT9 A;  2XE3 A;  4AUI A;  2ZLD A;  4D5U A;  3T0S A;  2Y0K A;  2XE2 A;  3A2S X;  4FSO A;  2ODJ A;  3UU2 A;  3VZT X;  1GFN A;  2J1N A;  4GCS A;  3FYX A;  4JFB A;  2FGR A;  4FOZ A;  4RJW A;  4C69 X;  6PRN A;  3T24 A;  1BH3 A;  1PHO A;  3WI5 A;  3SZD A;  3SZV A;  2POR A;  2Y0L A;  5DL6 A;  4FRX A;  2XE1 A;  3SYS A;  1H6S 1;  3NSG A;  3POR A;  3SYB A;  1GFQ A;  5DL5 A;  4RJX A; 
#chains in the Genus database with same CATH topology
 1Q9G A;  4FRT A;  4LSF A;  3QRA A;  3VE1 A;  3AA7 B;  5ADX K;  2MHL A;  5GV0 A;  2X27 X;  1T1L A;  3AA7 A;  4G75 A;  3BRZ A;  3AAA B;  4E1S A;  2WJR A;  2XE5 A;  5G3A A;  3AAA A;  1OSM A;  5T5F A;  2Y0H A;  5KAF O;  4QQ1 A;  2OMF A;  3LK4 1;  2R4N A;  4FSP A;  2WJQ A;  1QJP A;  3JCU O;  3POU A;  4FQE A;  2R88 A;  4RJX A;  4UB8 O;  3PF1 A;  5GTI O;  3TZG A;  4AYE C;  7PRN A;  1ZHT A;  4O3W A;  3UPG A;  1ORM A;  3JTY A;  1Q9F A;  2X9K A;  2N2M A;  3VY9 X;  4BUM X;  2F1T A;  4O4X A;  2JMM A;  4GCQ A;  3PQU A;  3SY9 A;  3KZI O;  2KC0 A;  4AFK A;  3HOE A;  2Y2X A;  3DA4 A;  1MPF A;  2IWV A;  2KXP B;  2XMX A;  3KVD D;  4LSE A;  4O3Z A;  4AYI D;  4FT6 A;  5G38 A;  5TIS O;  2KXP A;  1ZHW A;  2PRN A;  2M06 A;  3VZW X;  2KZ7 A;  3WI4 A;  2W80 C;  4PUX A;  2M07 A;  4KR8 A;  5DL7 A;  2O4V A;  5G39 A;  4KR4 A;  2K0L A;  4LSH A;  5B5E O;  3A0B O;  3O0E A;  8PRN A;  4KRA A;  4RLB A;  4N75 A;  1GFP A;  4C4V B;  2IWW A;  2R4L A;  1BXW A;  3PGU A;  3AAE B;  4C4V A;  1HXT A;  1GFO A;  2GE4 A;  3K19 A;  3AAE A;  2XG6 A;  1YS5 A;  2ZFG A;  4O49 A;  1HXU A;  1E54 A;  3BRY A;  1THQ A;  2K4T A;  2QTK A;  4CTD A;  3BS0 A;  4AZL A;  4AYN A;  2J4U P;  3DA3 A;  3DWO X;  3POQ A;  1PRN A;  3GP6 A;  5E79 O;  3A0H O;  3VY8 X;  4D65 A;  2MNH A;  2JQY A;  3AA0 B;  3C5O A;  5B66 O;  5GTH O;  3SY7 A;  4AKR B;  1HXX A;  4IL6 O;  3AA0 A;  3EMN X;  3VE2 A;  5DL8 A;  4RL9 A;  5FVN A;  2FGQ X;  1GFM A;  1QJ8 A;  2KZ7 B;  4PR7 A;  3V8U A;  4AKR A;  1OPF A;  4GCP A;  3RBH A;  5PRN A;  3HWB A;  4O3X B;  4UB6 O;  3DWN A;  4FZM A;  3PRN A;  3HW9 A;  3POX A;  3VZU X;  5JDP A;  1ZHY A;  2ERV A;  3T20 A;  1IZN B;  5EE2 A;  4D64 A;  2R8A A;  4LSI A;  1IZN A;  5IYU A;  4FMS A;  2LFU A;  1BT9 A;  2XE3 A;  4O4U A;  4AUI A;  4AYD C;  4O3Y A;  4F4B A;  1QJ9 A;  5KAI O;  1S5L O;  2ZLD A;  3SYB A;  4D5U A;  4K3C A;  1P4T A;  3T0S A;  2XTQ A;  4FUV A;  4FES A;  2R4O A;  2Y0K A;  4Z3T A;  2XE2 A;  4AYM C;  1ZHX A;  4FZL A;  3A2S X;  2N2L A;  2ODJ A;  3AA1 B;  4FSO A;  3UU2 A;  3VZT X;  1GFN A;  2J1N A;  3AA1 A;  4FZN A;  4GCS A;  3FYX A;  3QRC A;  4JCH A;  3LK4 2;  3AA6 B;  2F1V A;  3PGR A;  2FGR A;  4JFB A;  4FOZ A;  1MM4 A;  4K3B A;  4E1T A;  3AA6 A;  4N59 A;  4RLC A;  4RJW A;  3UAQ A;  4C69 X;  1G90 A;  2YPV A;  4XNK A;  3NJT A;  1T16 A;  3LK2 B;  2AXT O;  6PRN A;  4AKM A;  5H2F O;  2F1C X;  3LK2 A;  4G76 A;  2R4P A;  1BH3 A;  2XTR A;  4GHB A;  3T24 A;  1PHO A;  3WI5 A;  3SZD A;  2Y7S A;  3SZV A;  3PQS A;  2POR A;  5G26 A;  3WU2 O;  2Y0L A;  5DL6 A;  4FRX A;  2XE1 A;  4GF4 A;  4N74 A;  1MM5 A;  3SYS A;  5AFU L;  3G7G A;  4C00 A;  2KDY A;  3DZM A;  1ZHZ A;  3HOL A;  4XNL A;  4PJ0 O;  2LHF A;  5D5D A;  5AFU K;  2W81 C;  4B61 A;  2YNK A;  3LK3 B;  3PGS A;  1H6S 1;  2R89 A;  3NSG A;  4U9C A;  5ADX L;  3POR A;  3LK3 A;  1GFQ A;  5DL5 A;  4N58 A;  2WVP A; 
#chains in the Genus database with same CATH homology
 1Q9G A;  4FRT A;  4LSF A;  3QRA A;  3VE1 A;  3AA7 B;  5ADX K;  2MHL A;  5GV0 A;  2X27 X;  3AA7 A;  4G75 A;  4E1S A;  3AAA B;  2XE5 A;  3AAA A;  1OSM A;  5T5F A;  2Y0H A;  4QQ1 A;  2OMF A;  3LK4 1;  4FSP A;  1QJP A;  3POU A;  3TZG A;  3UPG A;  7PRN A;  4AYE C;  1ZHT A;  4O3W A;  1ORM A;  3JTY A;  1Q9F A;  3VY9 X;  2N2M A;  4BUM X;  2F1T A;  4O4X A;  2JMM A;  4GCQ A;  3PQU A;  3SY9 A;  2KC0 A;  4AFK A;  3HOE A;  2Y2X A;  3DA4 A;  1MPF A;  2XMX A;  2KXP B;  3KVD D;  4O3Z A;  4LSE A;  4AYI D;  8PRN A;  4FT6 A;  2KXP A;  1ZHW A;  2PRN A;  2M06 A;  3VZW X;  2KZ7 A;  3WI4 A;  2W80 C;  4PUX A;  2M07 A;  4KR8 A;  5DL7 A;  2O4V A;  4KR4 A;  2K0L A;  4LSH A;  3O0E A;  4KRA A;  4RLB A;  1GFP A;  1BXW A;  3AAE B;  1HXT A;  1GFO A;  2GE4 A;  3K19 A;  3AAE A;  2XG6 A;  1YS5 A;  2ZFG A;  4O49 A;  1HXU A;  1E54 A;  1THQ A;  2K4T A;  2QTK A;  4AZL A;  4AYN A;  2J4U P;  3DA3 A;  3POQ A;  1PRN A;  3GP6 A;  3VY8 X;  4D65 A;  2MNH A;  3AA0 B;  3C5O A;  3SY7 A;  4AKR B;  1HXX A;  3AA0 A;  3EMN X;  3VE2 A;  5DL8 A;  4RL9 A;  5FVN A;  2FGQ X;  1GFM A;  1QJ8 A;  2KZ7 B;  4AKR A;  3V8U A;  1OPF A;  4GCP A;  3RBH A;  5PRN A;  3HWB A;  4O3X B;  4FZM A;  3PRN A;  3HW9 A;  3POX A;  3VZU X;  5JDP A;  1ZHY A;  2ERV A;  3T20 A;  1IZN B;  5EE2 A;  4D64 A;  4LSI A;  1IZN A;  5IYU A;  4FMS A;  2LFU A;  1BT9 A;  2XE3 A;  4O4U A;  4AUI A;  4AYD C;  4O3Y A;  4F4B A;  1QJ9 A;  2ZLD A;  3SYB A;  4D5U A;  1P4T A;  3T0S A;  2XTQ A;  4FUV A;  4FES A;  2Y0K A;  4Z3T A;  2XE2 A;  4AYM C;  1ZHX A;  4FZL A;  3A2S X;  2N2L A;  2ODJ A;  3AA1 B;  4FSO A;  3UU2 A;  3VZT X;  1GFN A;  2J1N A;  3AA1 A;  4FZN A;  4GCS A;  3FYX A;  3QRC A;  4JCH A;  3LK4 2;  3AA6 B;  2F1V A;  4JFB A;  2FGR A;  4FOZ A;  1MM4 A;  4E1T A;  3AA6 A;  4N59 A;  4RLC A;  4RJW A;  3UAQ A;  4C69 X;  1G90 A;  2YPV A;  4XNK A;  3LK2 B;  6PRN A;  4AKM A;  3LK2 A;  4G76 A;  3T24 A;  1BH3 A;  2XTR A;  4GHB A;  1PHO A;  3WI5 A;  3SZD A;  2Y7S A;  3SZV A;  3PQS A;  2POR A;  5G26 A;  2Y0L A;  5DL6 A;  4FRX A;  2XE1 A;  4GF4 A;  3SYS A;  1MM5 A;  5AFU L;  3G7G A;  2KDY A;  3HOL A;  1ZHZ A;  4XNL A;  2LHF A;  5D5D A;  5AFU K;  2W81 C;  4B61 A;  2YNK A;  3LK3 B;  1H6S 1;  3NSG A;  4U9C A;  5ADX L;  3POR A;  3LK3 A;  1GFQ A;  5DL5 A;  4N58 A;  4RJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...