4FOZA

Crystal structure of occd1 (oprd) y282r/d307h
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
420
structure length
377
Chain Sequence
DAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDDRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTGNLPVPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFARLFPQTATGFQLQSSEFEGLDLEAGHFTEELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNSNYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAVAYTLDAHTFTLAYQKVHGDQPFDRIGFIFLANSVQYSHFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin D
publication title Toward Understanding the Outer Membrane Uptake of Small Molecules by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 108
structure length 377
sequence length 420
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4fozA01
1H6S1 1BT9A 3HWBA 4LSFA 3POUA 3UU2A 2PRNA 4GCPA 4GCQA 3EMNX 2XE2A 2O4VA 5JDPA 1OSMA 1GFNA 3T0SA 4LSEA 4GCSA 4KR4A 6PRNA 4FMSA 2ODJA 1MPFA 4C69X 4FT6A 5DL7A 2J4UP 3JTYA 2K4TA 4LSIA 1OPFA 2XE5A 4LSHA 4AUIA 2Y0HA 1GFPA 1HXXA 4D65A 2ZFGA 5DL5A 1HXTA 3SZVA 4D64A 3O0EA 3SY9A 2Y0KA 2J1NA 7PRNA 3SYBA 3SZDA 4FSPA 2Y0LA 3POXA 4FSOA 3SY7A 3HW9A 3NSGA 3FYXA 2FGQX 3A2SX 3T20A 2QTKA 3VZWX 2ZLDA 3POQA 4BUMX 5FVNA 8PRNA 3PRNA 2XE1A 3VY8X 3VY9X 1BH3A 4KR8A 1PHOA 2OMFA 4D5UA 5DL8A 3PORA 3K19A 4JFBA 4KRAA 3UPGA 4FOZA 2XG6A 1GFMA 5PRNA 4RJXA 3SYSA 1GFOA 1E54A 3T24A 3VZTX 2PORA 2Y2XA 4FRXA 1PRNA 2XE3A 4RJWA 4FRTA 3WI4A 1HXUA 2FGRA 3WI5A 1GFQA 5DL6A 3VZUX
chains in the Genus database with same CATH superfamily
5G26A 2X27X 2N2LA 1H6S1 1BT9A 3HWBA 2K0LA 3DA3A 3LK2A 3POUA 4LSFA 4PUXA 3UU2A 2PRNA 4GCPA 4O3WA 5KAIO 2Y7SA 3LK2B 3UAQA 4GCQA 4AYNA 2WJQA 3EMNX 2XE2A 1MM4A 2O4VA 3VE1A 1ZHTA 5JDPA 3AA7B 1OSMA 4O4XA 1GFNA 4AYEC 4PJ0O 3T0SA 4LSEA 1S5LO 2KZ7B 4GCSA 4JCHA 4KR4A 4UB8O 6PRNA 4FMSA 2ODJA 2R4PA 2YPVA 1MPFA 4XNKA 3PQSA 4O49A 4C69X 4FT6A 3A0BO 5DL7A 1T16A 3JTYA 3TZGA 2J4UP 4E1SA 4FZNA 2WVPA 2K4TA 4LSIA 1OPFA 2XE5A 4LSHA 4AKRA 4AUIA 2Y0HA 5B5EO 3QRCA 4K3BA 2JQYA 1GFPA 3QRAA 1HXXA 5G38A 5KAFO 4AYMC 3WU2O 2X9KA 2XTRA 4D65A 2ZFGA 5DL6A 5GTHO 3BRYA 5DL5A 1HXTA 4FUVA 3SZVA 1G90A 2LFUA 5B66O 4RLCA 2F1VA 4AYDC 3AA7A 2F1CX 4D64A 3O0EA 3DWOX 2R89A 3VE2A 4N75A 3SY9A 2Y0KA 5D5DA 5AFUK 5H2FO 3HOEA 2J1NA 3AA1B 7PRNA 2KZ7A 5ADXK 3A0HO 4XNLA 3SYBA 4IL6O 3SZDA 4FSPA 3AA6A 2Y0LA 3PGSA 3POXA 4FSOA 3SY7A 3HW9A 3NSGA 4G75A 3FYXA 2N2MA 2FGQX 1BXWA 3AA6B 3A2SX 4N74A 3LK42 3T20A 3DWNA 5EE2A 4U9CA 3C5OA 3AAAA 2QTKA 3VZWX 5T5FA 4GF4A 4AKRB 2W81C 2MHLA 2WJRA 4AFKA 4F4BA 4GHBA 3AAAB 2ZLDA 3NJTA 3JCUO 3AA0A 3POQA 4O3YA 4BUMX 4UB6O 5GTIO 3HOLA 5FVNA 5IYUA 3PF1A 2ERVA 8PRNA 3AA0B 3PRNA 2XE1A 2KDYA 1ZHWA 4C00A 3VY8X 5AFUL 4FQEA 3DA4A 3VY9X 4RLBA 1BH3A 3AA1A 3BS0A 4Z3TA 5ADXL 5G3AA 4KR8A 1MM5A 1PHOA 2MNHA 2OMFA 4D5UA 1ZHXA 2GE4A 2R4LA 2LHFA 2KC0A 2KXPA 5E79O 2R8AA 1P4TA 4C4VB 3VZUX 2W80C 1YS5A 3PGRA 3KVDD 2KXPB 4O4UA 5DL8A 5GV0A 3BRZA 3PORA 2M07A 3K19A 3PQUA 4AKMA 1QJ8A 4JFBA 3G7GA 4KRAA 3UPGA 4FOZA 2XG6A 1IZNB 3DZMA 4RL9A 4PR7A 1GFMA 4AYID 4AZLA 1Q9GA 5PRNA 4N58A 2IWWA 4K3CA 2XMXA 4RJXA 4E1TA 3SYSA 1GFOA 4FESA 2XTQA 1E54A 3RBHA 1QJ9A 4FZLA 2JMMA 2R88A 2F1TA 3GP6A 3V8UA 3LK3A 3T24A 1ZHZA 3KZIO 2IWVA 3VZTX 1ORMA 3PGUA 3LK3B 2PORA 2Y2XA 4FRXA 4G76A 4B61A 1PRNA 2XE3A 2YNKA 4O3XB 2AXTO 4C4VA 4FRTA 4RJWA 2R4NA 3WI4A 1HXUA 2FGRA 1QJPA 2R4OA 3AAEA 5TISO 4QQ1A 1ZHYA 5G39A 1Q9FA 3WI5A 4CTDA 3AAEB 1THQA 4FZMA 2M06A 4N59A 1GFQA 1T1LA 1IZNA 3LK41 4O3ZA
chains in the Genus database with same CATH topology
5G26A 2X27X 2N2LA 1H6S1 1BT9A 3HWBA 2K0LA 3DA3A 3LK2A 3POUA 4LSFA 4PUXA 3UU2A 2PRNA 4GCPA 4O3WA 2Y7SA 3LK2B 3UAQA 4GCQA 4AYNA 3EMNX 2XE2A 1MM4A 2O4VA 3VE1A 1ZHTA 5JDPA 3AA7B 1OSMA 4O4XA 1GFNA 4AYEC 3T0SA 4LSEA 2KZ7B 4GCSA 4JCHA 4KR4A 6PRNA 4FMSA 2ODJA 2YPVA 1MPFA 4XNKA 3PQSA 4O49A 4C69X 4FT6A 5DL7A 2J4UP 3JTYA 3TZGA 4E1SA 4FZNA 2K4TA 4LSIA 1OPFA 2XE5A 4LSHA 4AKRA 4AUIA 2Y0HA 3QRCA 1GFPA 3QRAA 1HXXA 4AYMC 2XTRA 4D65A 2ZFGA 5DL6A 5DL5A 1HXTA 4FUVA 3SZVA 1G90A 2LFUA 4RLCA 2F1VA 4AYDC 3AA7A 4D64A 3O0EA 3VE2A 3SY9A 5AFUK 2Y0KA 5D5DA 3HOEA 2J1NA 3AA1B 7PRNA 2KZ7A 5ADXK 4XNLA 3SYBA 3SZDA 4FSPA 3AA6A 2Y0LA 3POXA 4FSOA 3SY7A 3HW9A 3NSGA 4G75A 3FYXA 2N2MA 2FGQX 1BXWA 3AA6B 3A2SX 3LK42 3T20A 5EE2A 4U9CA 3C5OA 3AAAA 2QTKA 3VZWX 5T5FA 4GF4A 4AKRB 2W81C 2MHLA 4AFKA 4F4BA 4GHBA 3AAAB 2ZLDA 3AA0A 3POQA 4O3YA 4BUMX 3HOLA 5FVNA 5IYUA 8PRNA 2ERVA 3AA0B 3PRNA 2XE1A 2KDYA 1ZHWA 3VY8X 5AFUL 3DA4A 3VY9X 4RLBA 1BH3A 3AA1A 4Z3TA 5ADXL 4KR8A 1MM5A 1PHOA 2MNHA 2OMFA 4D5UA 1ZHXA 2GE4A 2LHFA 2KC0A 2KXPA 1P4TA 3VZUX 2W80C 1YS5A 5GV0A 3KVDD 2KXPB 4O4UA 5DL8A 3PORA 2M07A 3K19A 3PQUA 4AKMA 1QJ8A 4JFBA 3G7GA 4KRAA 3UPGA 4FOZA 2XG6A 1IZNB 4RL9A 4AZLA 1GFMA 4AYID 1Q9GA 5PRNA 4N58A 4RJXA 2XMXA 4E1TA 3SYSA 1GFOA 4FESA 2XTQA 1E54A 3RBHA 1QJ9A 4FZLA 2JMMA 2F1TA 3GP6A 3V8UA 3LK3A 3T24A 1ZHZA 3VZTX 1ORMA 3LK3B 2PORA 2Y2XA 4FRXA 4G76A 4B61A 1PRNA 2XE3A 2YNKA 4O3XB 4FRTA 4RJWA 3WI4A 1HXUA 2FGRA 1QJPA 3AAEA 4QQ1A 1ZHYA 1Q9FA 3WI5A 3AAEB 1THQA 4FZMA 2M06A 4N59A 1GFQA 1IZNA 3LK41 4O3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6S 1;  1BT9 A;  3HWB A;  4LSF A;  3POU A;  3UU2 A;  2PRN A;  4GCP A;  4GCQ A;  3EMN X;  2XE2 A;  2O4V A;  5JDP A;  1OSM A;  1GFN A;  3T0S A;  4LSE A;  4GCS A;  4KR4 A;  6PRN A;  4FMS A;  2ODJ A;  1MPF A;  4C69 X;  4FT6 A;  5DL7 A;  2J4U P;  3JTY A;  2K4T A;  4LSI A;  1OPF A;  2XE5 A;  4LSH A;  4AUI A;  2Y0H A;  1GFP A;  1HXX A;  4D65 A;  2ZFG A;  5DL5 A;  1HXT A;  3SZV A;  4D64 A;  3O0E A;  3SY9 A;  2Y0K A;  2J1N A;  7PRN A;  3SYB A;  3SZD A;  4FSP A;  2Y0L A;  3POX A;  4FSO A;  3SY7 A;  3HW9 A;  3NSG A;  3FYX A;  2FGQ X;  3A2S X;  3T20 A;  2QTK A;  3VZW X;  2ZLD A;  3POQ A;  4BUM X;  5FVN A;  8PRN A;  3PRN A;  2XE1 A;  3VY8 X;  3VY9 X;  1BH3 A;  4KR8 A;  1PHO A;  2OMF A;  4D5U A;  5DL8 A;  3POR A;  3K19 A;  4JFB A;  4KRA A;  3UPG A;  4FOZ A;  2XG6 A;  1GFM A;  5PRN A;  4RJX A;  3SYS A;  1GFO A;  1E54 A;  3T24 A;  3VZT X;  2POR A;  2Y2X A;  4FRX A;  1PRN A;  2XE3 A;  4RJW A;  4FRT A;  3WI4 A;  1HXU A;  2FGR A;  3WI5 A;  1GFQ A;  5DL6 A;  3VZU X; 
#chains in the Genus database with same CATH topology
 5G26 A;  2X27 X;  2N2L A;  1H6S 1;  1BT9 A;  3HWB A;  2K0L A;  3DA3 A;  3LK2 A;  3POU A;  4LSF A;  4PUX A;  3UU2 A;  2PRN A;  4GCP A;  4O3W A;  5KAI O;  2Y7S A;  3LK2 B;  3UAQ A;  4GCQ A;  4AYN A;  2WJQ A;  3EMN X;  2XE2 A;  1MM4 A;  2O4V A;  3VE1 A;  1ZHT A;  5JDP A;  3AA7 B;  1OSM A;  4O4X A;  1GFN A;  4AYE C;  4PJ0 O;  3T0S A;  4LSE A;  1S5L O;  2KZ7 B;  4GCS A;  4JCH A;  4KR4 A;  4UB8 O;  6PRN A;  4FMS A;  2ODJ A;  2R4P A;  2YPV A;  1MPF A;  4XNK A;  3PQS A;  4O49 A;  4C69 X;  4FT6 A;  3A0B O;  5DL7 A;  1T16 A;  3JTY A;  3TZG A;  2J4U P;  4E1S A;  4FZN A;  2WVP A;  2K4T A;  4LSI A;  1OPF A;  2XE5 A;  4LSH A;  4AKR A;  4AUI A;  2Y0H A;  5B5E O;  3QRC A;  4K3B A;  2JQY A;  1GFP A;  3QRA A;  1HXX A;  5G38 A;  5KAF O;  4AYM C;  3WU2 O;  2X9K A;  2XTR A;  4D65 A;  2ZFG A;  5DL6 A;  5GTH O;  3BRY A;  5DL5 A;  1HXT A;  4FUV A;  3SZV A;  1G90 A;  2LFU A;  5B66 O;  4RLC A;  2F1V A;  4AYD C;  3AA7 A;  2F1C X;  4D64 A;  3O0E A;  3DWO X;  2R89 A;  3VE2 A;  4N75 A;  3SY9 A;  2Y0K A;  5D5D A;  5AFU K;  5H2F O;  3HOE A;  2J1N A;  3AA1 B;  7PRN A;  2KZ7 A;  5ADX K;  3A0H O;  4XNL A;  3SYB A;  4IL6 O;  3SZD A;  4FSP A;  3AA6 A;  2Y0L A;  3PGS A;  3POX A;  4FSO A;  3SY7 A;  3HW9 A;  3NSG A;  4G75 A;  3FYX A;  2N2M A;  2FGQ X;  1BXW A;  3AA6 B;  3A2S X;  4N74 A;  3LK4 2;  3T20 A;  3DWN A;  5EE2 A;  4U9C A;  3C5O A;  3AAA A;  2QTK A;  3VZW X;  5T5F A;  4GF4 A;  4AKR B;  2W81 C;  2MHL A;  2WJR A;  4AFK A;  4F4B A;  4GHB A;  3AAA B;  2ZLD A;  3NJT A;  3JCU O;  3AA0 A;  3POQ A;  4O3Y A;  4BUM X;  4UB6 O;  5GTI O;  3HOL A;  5FVN A;  5IYU A;  3PF1 A;  2ERV A;  8PRN A;  3AA0 B;  3PRN A;  2XE1 A;  2KDY A;  1ZHW A;  4C00 A;  3VY8 X;  5AFU L;  4FQE A;  3DA4 A;  3VY9 X;  4RLB A;  1BH3 A;  3AA1 A;  3BS0 A;  4Z3T A;  5ADX L;  5G3A A;  4KR8 A;  1MM5 A;  1PHO A;  2MNH A;  2OMF A;  4D5U A;  1ZHX A;  2GE4 A;  2R4L A;  2LHF A;  2KC0 A;  2KXP A;  5E79 O;  2R8A A;  1P4T A;  4C4V B;  3VZU X;  2W80 C;  1YS5 A;  3PGR A;  3KVD D;  2KXP B;  4O4U A;  5DL8 A;  5GV0 A;  3BRZ A;  3POR A;  2M07 A;  3K19 A;  3PQU A;  4AKM A;  1QJ8 A;  4JFB A;  3G7G A;  4KRA A;  3UPG A;  4FOZ A;  2XG6 A;  1IZN B;  3DZM A;  4RL9 A;  4PR7 A;  1GFM A;  4AYI D;  4AZL A;  1Q9G A;  5PRN A;  4N58 A;  2IWW A;  4K3C A;  2XMX A;  4RJX A;  4E1T A;  3SYS A;  1GFO A;  4FES A;  2XTQ A;  1E54 A;  3RBH A;  1QJ9 A;  4FZL A;  2JMM A;  2R88 A;  2F1T A;  3GP6 A;  3V8U A;  3LK3 A;  3T24 A;  1ZHZ A;  3KZI O;  2IWV A;  3VZT X;  1ORM A;  3PGU A;  3LK3 B;  2POR A;  2Y2X A;  4FRX A;  4G76 A;  4B61 A;  1PRN A;  2XE3 A;  2YNK A;  4O3X B;  2AXT O;  4C4V A;  4FRT A;  4RJW A;  2R4N A;  3WI4 A;  1HXU A;  2FGR A;  1QJP A;  2R4O A;  3AAE A;  5TIS O;  4QQ1 A;  1ZHY A;  5G39 A;  1Q9F A;  3WI5 A;  4CTD A;  3AAE B;  1THQ A;  4FZM A;  2M06 A;  4N59 A;  1GFQ A;  1T1L A;  1IZN A;  3LK4 1;  4O3Z A; 
#chains in the Genus database with same CATH homology
 5G26 A;  2X27 X;  2N2L A;  1H6S 1;  1BT9 A;  3HWB A;  2K0L A;  3DA3 A;  3LK2 A;  3POU A;  4LSF A;  4PUX A;  3UU2 A;  2PRN A;  4GCP A;  4O3W A;  2Y7S A;  3LK2 B;  3UAQ A;  4GCQ A;  4AYN A;  3EMN X;  2XE2 A;  1MM4 A;  2O4V A;  3VE1 A;  1ZHT A;  5JDP A;  3AA7 B;  1OSM A;  4O4X A;  1GFN A;  4AYE C;  3T0S A;  4LSE A;  2KZ7 B;  4GCS A;  4JCH A;  4KR4 A;  6PRN A;  4FMS A;  2ODJ A;  2YPV A;  1MPF A;  4XNK A;  3PQS A;  4O49 A;  4C69 X;  4FT6 A;  5DL7 A;  2J4U P;  3JTY A;  3TZG A;  4E1S A;  4FZN A;  2K4T A;  4LSI A;  1OPF A;  2XE5 A;  4LSH A;  4AKR A;  4AUI A;  2Y0H A;  3QRC A;  1GFP A;  3QRA A;  1HXX A;  4AYM C;  2XTR A;  4D65 A;  2ZFG A;  5DL6 A;  5DL5 A;  1HXT A;  4FUV A;  3SZV A;  1G90 A;  2LFU A;  4RLC A;  2F1V A;  4AYD C;  3AA7 A;  4D64 A;  3O0E A;  3VE2 A;  3SY9 A;  5AFU K;  2Y0K A;  5D5D A;  3HOE A;  2J1N A;  3AA1 B;  7PRN A;  2KZ7 A;  5ADX K;  4XNL A;  3SYB A;  3SZD A;  4FSP A;  3AA6 A;  2Y0L A;  3POX A;  4FSO A;  3SY7 A;  3HW9 A;  3NSG A;  4G75 A;  3FYX A;  2N2M A;  2FGQ X;  1BXW A;  3AA6 B;  3A2S X;  3LK4 2;  3T20 A;  5EE2 A;  4U9C A;  3C5O A;  3AAA A;  2QTK A;  3VZW X;  5T5F A;  4GF4 A;  4AKR B;  2W81 C;  2MHL A;  4AFK A;  4F4B A;  4GHB A;  3AAA B;  2ZLD A;  3AA0 A;  3POQ A;  4O3Y A;  4BUM X;  3HOL A;  5FVN A;  5IYU A;  8PRN A;  2ERV A;  3AA0 B;  3PRN A;  2XE1 A;  2KDY A;  1ZHW A;  3VY8 X;  5AFU L;  3DA4 A;  3VY9 X;  4RLB A;  1BH3 A;  3AA1 A;  4Z3T A;  5ADX L;  4KR8 A;  1MM5 A;  1PHO A;  2MNH A;  2OMF A;  4D5U A;  1ZHX A;  2GE4 A;  2LHF A;  2KC0 A;  2KXP A;  1P4T A;  3VZU X;  2W80 C;  1YS5 A;  5GV0 A;  3KVD D;  2KXP B;  4O4U A;  5DL8 A;  3POR A;  2M07 A;  3K19 A;  3PQU A;  4AKM A;  1QJ8 A;  4JFB A;  3G7G A;  4KRA A;  3UPG A;  4FOZ A;  2XG6 A;  1IZN B;  4RL9 A;  4AZL A;  1GFM A;  4AYI D;  1Q9G A;  5PRN A;  4N58 A;  4RJX A;  2XMX A;  4E1T A;  3SYS A;  1GFO A;  4FES A;  2XTQ A;  1E54 A;  3RBH A;  1QJ9 A;  4FZL A;  2JMM A;  2F1T A;  3GP6 A;  3V8U A;  3LK3 A;  3T24 A;  1ZHZ A;  3VZT X;  1ORM A;  3LK3 B;  2POR A;  2Y2X A;  4FRX A;  4G76 A;  4B61 A;  1PRN A;  2XE3 A;  2YNK A;  4O3X B;  4FRT A;  4RJW A;  3WI4 A;  1HXU A;  2FGR A;  1QJP A;  3AAE A;  4QQ1 A;  1ZHY A;  1Q9F A;  3WI5 A;  3AAE B;  1THQ A;  4FZM A;  2M06 A;  4N59 A;  1GFQ A;  1IZN A;  3LK4 1;  4O3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...