3A0HO

Crystal structure of i-substituted photosystem ii complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 28
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2009-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3a0hO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3a0hO02
5G38A 5KAIO 5GTHO 5G3AA 3WU2O 5H2FO 4UB6O 5TISO 5KAFO 5GTIO 3JCUO 4UB8O 4PJ0O 4IL6O 5B5EO 5E79O 5B66O 2AXTO 3KZIO 5G39A 3A0HO 3A0BO 1S5LO
chains in the Genus database with same CATH superfamily
1IZNB 2Y7SA 2X9KA 3AA7A 3SYSA 1BXWA 2K0LA 2LHFA 4O3YA 4C69X 4KR4A 3AA1B 2XTQA 4F4BA 4JFBA 2FGQX 4RLCA 4JCHA 5AFUL 2R8AA 1ZHYA 3PORA 3VZUX 3VE2A 3PQSA 1OSMA 2WVPA 4XNKA 4N74A 3SZDA 2QTKA 2JQYA 3AA6A 3HW9A 1Q9FA 2R88A 5GV0A 3T20A 4CTDA 5IYUA 3HOLA 4FOZA 2XE3A 3PGRA 5E79O 3SZVA 1HXUA 1MPFA 2N2LA 3KZIO 1GFQA 2JMMA 2R4OA 2F1CX 3BS0A 3HOEA 3PQUA 3QRAA 1MM5A 1T16A 2Y0HA 3PGUA 5G39A 1GFNA 4N58A 3DA4A 3UAQA 2XTRA 1YS5A 1QJ8A 2KC0A 4RL9A 1P4TA 3LK2B 3LK2A 3WI5A 5H2FO 1ZHTA 2WJRA 2LFUA 3LK3B 3POXA 3RBHA 3SY7A 1H6S1 1E54A 4AYID 1Q9GA 1PHOA 2MHLA 2F1VA 3LK42 4RLBA 1G90A 3SY9A 4FUVA 3A0BO 2W80C 4AKRB 4FZNA 5D5DA 3WI4A 2XE1A 1BT9A 3AA0B 3AAAB 1HXXA 3POUA 4KRAA 2X27X 2FGRA 4U9CA 1QJ9A 1T1LA 4K3BA 5ADXK 3DA3A 2XMXA 4E1TA 5B5EO 2N2MA 3AA0A 4K3CA 2J1NA 2XE2A 4E1SA 4RJXA 4D5UA 3POQA 2XG6A 7PRNA 2YPVA 4G75A 2PORA 1HXTA 3FYXA 3GP6A 1QJPA 3VZWX 5KAIO 3AA1A 5DL5A 5GTHO 3EMNX 5G3AA 4AYMC 2ZLDA 1THQA 5DL7A 5T5FA 4C00A 2ERVA 2Y0LA 1IZNA 4FSOA 4AFKA 1ORMA 4UB6O 2WJQA 3AAEB 3T24A 2ODJA 3PRNA 4FSPA 4O3ZA 4AKRA 4FESA 2PRNA 4KR8A 4O3XB 3C5OA 5GTIO 2O4VA 4BUMX 2M06A 2KDYA 4PUXA 3AAEA 4FRXA 5G26A 5FVNA 3SYBA 3TZGA 3BRYA 2Y0KA 5ADXL 3NSGA 2R4PA 3QRCA 4FZLA 5EE2A 8PRNA 3DZMA 4GCSA 3NJTA 4AYDC 3VE1A 4C4VB 2XE5A 3HWBA 4GHBA 3UPGA 4GCQA 2AXTO 2M07A 2ZFGA 3UU2A 3VY9X 1ZHXA 2YNKA 3LK41 4FZMA 4RJWA 2Y2XA 4QQ1A 1GFPA 1S5LO 4LSIA 3PGSA 4AZLA 4O49A 1PRNA 2J4UP 5DL8A 5G38A 4AYNA 2GE4A 3VY8X 3A2SX 4PR7A 4GCPA 3K19A 5DL6A 3WU2O 2IWVA 3AA7B 2MNHA 4G76A 3AAAA 4N59A 3AA6B 1BH3A 4N75A 1GFOA 5JDPA 5TISO 4AKMA 2R89A 1ZHWA 4B61A 5KAFO 4AYEC 4FRTA 3DWOX 3O0EA 4FT6A 3T0SA 2KXPA 4LSEA 2R4LA 4Z3TA 4D65A 3LK3A 3KVDD 3JCUO 4O3WA 6PRNA 4C4VA 2R4NA 2KZ7A 2KZ7B 2OMFA 4D64A 1MM4A 4LSHA 4PJ0O 4IL6O 4O4XA 4UB8O 4AUIA 5B66O 2F1TA 1GFMA 2K4TA 2KXPB 3G7GA 3V8UA 5AFUK 2W81C 4O4UA 3PF1A 1OPFA 3BRZA 4FQEA 5PRNA 3VZTX 4LSFA 2IWWA 3A0HO 1ZHZA 3DWNA 4FMSA 4XNLA 3JTYA 4GF4A
chains in the Genus database with same CATH topology
5G38A 5KAIO 5GTHO 5G3AA 3WU2O 5H2FO 4UB6O 5TISO 5KAFO 5GTIO 3JCUO 4UB8O 4PJ0O 4IL6O 5B5EO 5E79O 5B66O 2AXTO 3KZIO 5G39A 3A0HO 3A0BO 1S5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G38 A;  5KAI O;  5GTH O;  5G3A A;  3WU2 O;  5H2F O;  4UB6 O;  5TIS O;  5KAF O;  5GTI O;  3JCU O;  4UB8 O;  4PJ0 O;  4IL6 O;  5B5E O;  5E79 O;  5B66 O;  2AXT O;  3KZI O;  5G39 A;  3A0H O;  3A0B O;  1S5L O; 
#chains in the Genus database with same CATH topology
 1IZN B;  2Y7S A;  2X9K A;  3AA7 A;  3SYS A;  1BXW A;  2K0L A;  2LHF A;  4O3Y A;  4C69 X;  4KR4 A;  3AA1 B;  2XTQ A;  4F4B A;  4JFB A;  2FGQ X;  4RLC A;  4JCH A;  5AFU L;  2R8A A;  1ZHY A;  3POR A;  3VZU X;  3VE2 A;  3PQS A;  1OSM A;  2WVP A;  4XNK A;  4N74 A;  3SZD A;  2QTK A;  2JQY A;  3AA6 A;  3HW9 A;  1Q9F A;  2R88 A;  5GV0 A;  3T20 A;  4CTD A;  5IYU A;  3HOL A;  4FOZ A;  2XE3 A;  3PGR A;  5E79 O;  3SZV A;  1HXU A;  1MPF A;  2N2L A;  3KZI O;  1GFQ A;  2JMM A;  2R4O A;  2F1C X;  3BS0 A;  3HOE A;  3PQU A;  3QRA A;  1MM5 A;  1T16 A;  2Y0H A;  3PGU A;  5G39 A;  1GFN A;  4N58 A;  3DA4 A;  3UAQ A;  2XTR A;  1YS5 A;  1QJ8 A;  2KC0 A;  4RL9 A;  1P4T A;  3LK2 B;  3LK2 A;  3WI5 A;  5H2F O;  1ZHT A;  2WJR A;  2LFU A;  3LK3 B;  3POX A;  3RBH A;  3SY7 A;  1H6S 1;  1E54 A;  4AYI D;  1Q9G A;  1PHO A;  2MHL A;  2F1V A;  3LK4 2;  4RLB A;  1G90 A;  3SY9 A;  4FUV A;  3A0B O;  2W80 C;  4AKR B;  4FZN A;  5D5D A;  3WI4 A;  2XE1 A;  1BT9 A;  3AA0 B;  3AAA B;  1HXX A;  3POU A;  4KRA A;  2X27 X;  2FGR A;  4U9C A;  1QJ9 A;  1T1L A;  4K3B A;  5ADX K;  3DA3 A;  2XMX A;  4E1T A;  5B5E O;  2N2M A;  3AA0 A;  4K3C A;  2J1N A;  2XE2 A;  4E1S A;  4RJX A;  4D5U A;  3POQ A;  2XG6 A;  7PRN A;  2YPV A;  4G75 A;  2POR A;  1HXT A;  3FYX A;  3GP6 A;  1QJP A;  3VZW X;  5KAI O;  3AA1 A;  5DL5 A;  5GTH O;  3EMN X;  5G3A A;  4AYM C;  2ZLD A;  1THQ A;  5DL7 A;  5T5F A;  4C00 A;  2ERV A;  2Y0L A;  1IZN A;  4FSO A;  4AFK A;  1ORM A;  4UB6 O;  2WJQ A;  3AAE B;  3T24 A;  2ODJ A;  3PRN A;  4FSP A;  4O3Z A;  4AKR A;  4FES A;  2PRN A;  4KR8 A;  4O3X B;  3C5O A;  5GTI O;  2O4V A;  4BUM X;  2M06 A;  2KDY A;  4PUX A;  3AAE A;  4FRX A;  5G26 A;  5FVN A;  3SYB A;  3TZG A;  3BRY A;  2Y0K A;  5ADX L;  3NSG A;  2R4P A;  3QRC A;  4FZL A;  5EE2 A;  8PRN A;  3DZM A;  4GCS A;  3NJT A;  4AYD C;  3VE1 A;  4C4V B;  2XE5 A;  3HWB A;  4GHB A;  3UPG A;  4GCQ A;  2AXT O;  2M07 A;  2ZFG A;  3UU2 A;  3VY9 X;  1ZHX A;  2YNK A;  3LK4 1;  4FZM A;  4RJW A;  2Y2X A;  4QQ1 A;  1GFP A;  1S5L O;  4LSI A;  3PGS A;  4AZL A;  4O49 A;  1PRN A;  2J4U P;  5DL8 A;  5G38 A;  4AYN A;  2GE4 A;  3VY8 X;  3A2S X;  4PR7 A;  4GCP A;  3K19 A;  5DL6 A;  3WU2 O;  2IWV A;  3AA7 B;  2MNH A;  4G76 A;  3AAA A;  4N59 A;  3AA6 B;  1BH3 A;  4N75 A;  1GFO A;  5JDP A;  5TIS O;  4AKM A;  2R89 A;  1ZHW A;  4B61 A;  5KAF O;  4AYE C;  4FRT A;  3DWO X;  3O0E A;  4FT6 A;  3T0S A;  2KXP A;  4LSE A;  2R4L A;  4Z3T A;  4D65 A;  3LK3 A;  3KVD D;  3JCU O;  4O3W A;  6PRN A;  4C4V A;  2R4N A;  2KZ7 A;  2KZ7 B;  2OMF A;  4D64 A;  1MM4 A;  4LSH A;  4PJ0 O;  4IL6 O;  4O4X A;  4UB8 O;  4AUI A;  5B66 O;  2F1T A;  1GFM A;  2K4T A;  2KXP B;  3G7G A;  3V8U A;  5AFU K;  2W81 C;  4O4U A;  3PF1 A;  1OPF A;  3BRZ A;  4FQE A;  5PRN A;  3VZT X;  4LSF A;  2IWW A;  3A0H O;  1ZHZ A;  3DWN A;  4FMS A;  4XNL A;  3JTY A;  4GF4 A; 
#chains in the Genus database with same CATH homology
 5G38 A;  5KAI O;  5GTH O;  5G3A A;  3WU2 O;  5H2F O;  4UB6 O;  5TIS O;  5KAF O;  5GTI O;  3JCU O;  4UB8 O;  4PJ0 O;  4IL6 O;  5B5E O;  5E79 O;  5B66 O;  2AXT O;  3KZI O;  5G39 A;  3A0H O;  3A0B O;  1S5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...