3A0HO

Crystal structure of i-substituted photosystem ii complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
total genus 28
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2009-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3a0hO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3a0hO02
5E79O 3KZIO 4PJ0O 4UB8O 5H2FO 3WU2O 5GTIO 5B66O 3A0HO 5G3AA 5B5EO 3JCUO 5KAFO 4UB6O 5KAIO 4IL6O 5G39A 1S5LO 5GTHO 5TISO 3A0BO 2AXTO 5G38A
chains in the Genus database with same CATH superfamily
2M06A 4GCSA 4GCPA 2R4LA 3PF1A 2JQYA 4N74A 4FQEA 4AKRA 4GCQA 4BUMX 3AA7A 1GFOA 3T24A 1ZHWA 4K3CA 2IWWA 1THQA 3AA1A 1QJPA 2GE4A 2ODJA 2R8AA 2J1NA 4FZNA 4D65A 2ZFGA 4GF4A 1BT9A 1GFPA 4F4BA 3QRCA 3AAAB 3HWBA 4JCHA 1QJ8A 2WJQA 2MNHA 3LK3A 4LSEA 2JMMA 3JTYA 4QQ1A 1P4TA 3WI5A 3AA6B 2R4PA 3LK41 1IZNB 3POUA 5PRNA 4FZLA 5KAIO 1E54A 2F1VA 2W81C 3PQUA 6PRNA 1PRNA 3SY7A 2XTQA 3BRYA 4LSIA 5FVNA 4XNLA 1GFMA 3DWOX 4RL9A 1G90A 3T20A 1IZNA 3A0BO 3PGUA 3VZUX 3WI4A 3VZTX 2F1CX 4CTDA 2KC0A 4U9CA 3KZIO 4C00A 3SY9A 4PR7A 3AAEB 3VE2A 3QRAA 4O3XB 4LSHA 5DL5A 3HOLA 2YNKA 4N59A 4K3BA 4AKMA 4UB8O 2FGQX 2O4VA 1ZHXA 2KZ7A 1T16A 3A0HO 1T1LA 4O4XA 4RLBA 1MM4A 2R4NA 4GHBA 2X27X 4AFKA 4AYID 3PRNA 4FRTA 2XE3A 5EE2A 1BXWA 2MHLA 4LSFA 4O3WA 7PRNA 3VE1A 4N75A 5ADXK 4FESA 1BH3A 3LK2B 2XE2A 2ZLDA 3VY9X 3POQA 1OPFA 3AAAA 1QJ9A 3O0EA 2WJRA 5G26A 4B61A 4E1SA 4FSPA 4E1TA 2Y2XA 5AFUK 3AA6A 3LK2A 1MPFA 2Y7SA 5G38A 5E79O 4O4UA 4PJ0O 3PORA 4AZLA 4KR8A 2PORA 3EMNX 1ZHTA 5D5DA 2XTRA 3AA0B 5JDPA 1MM5A 5H2FO 2Y0LA 3NJTA 4PUXA 4KR4A 4JFBA 5AFUL 5B66O 5G3AA 2KXPB 5DL8A 5B5EO 3JCUO 3VZWX 4AYDC 3GP6A 2N2LA 3AAEA 2YPVA 3AA0A 3HOEA 3T0SA 2LFUA 3FYXA 1YS5A 2XG6A 2K0LA 4FZMA 4C69X 2PRNA 2KXPA 4KRAA 2N2MA 2XMXA 4O49A 4C4VB 1HXUA 4IL6O 5IYUA 1S5LO 4AKRB 1PHOA 3AA7B 3DA3A 5DL6A 4D64A 2LHFA 3PQSA 3G7GA 2K4TA 4N58A 1ZHZA 3RBHA 4AUIA 2XE5A 3AA1B 1OSMA 4AYMC 1GFNA 3PGSA 2ERVA 2M07A 4C4VA 4XNKA 5ADXL 4O3YA 3NSGA 3POXA 3K19A 4FMSA 1HXTA 4RJXA 2WVPA 4Z3TA 3LK3B 2X9KA 4FRXA 3V8UA 2QTKA 3WU2O 5GTIO 3PGRA 3DZMA 4G76A 3UAQA 3C5OA 4FUVA 4AYEC 3BRZA 5DL7A 4O3ZA 4FT6A 3UPGA 3SZDA 1ZHYA 4FSOA 2Y0HA 5T5FA 1Q9GA 3BS0A 4G75A 1Q9FA 2OMFA 3DA4A 3DWNA 2Y0KA 5KAFO 1ORMA 2R4OA 4RJWA 4UB6O 5GV0A 3UU2A 4RLCA 8PRNA 2J4UP 2W80C 2F1TA 2R89A 3KVDD 5G39A 3LK42 2FGRA 2KDYA 2XE1A 3SYBA 3TZGA 4FOZA 4AYNA 3SZVA 5GTHO 1HXXA 3A2SX 3SYSA 2R88A 3VY8X 1H6S1 5TISO 2IWVA 4D5UA 2KZ7B 2AXTO 3HW9A 1GFQA
chains in the Genus database with same CATH topology
5E79O 3KZIO 4PJ0O 4UB8O 5H2FO 3WU2O 5GTIO 5B66O 3A0HO 5G3AA 5B5EO 3JCUO 5KAFO 4UB6O 5KAIO 4IL6O 5G39A 1S5LO 5GTHO 5TISO 3A0BO 2AXTO 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 O;  3KZI O;  4PJ0 O;  4UB8 O;  5H2F O;  3WU2 O;  5GTI O;  5B66 O;  3A0H O;  5G3A A;  5B5E O;  3JCU O;  5KAF O;  4UB6 O;  5KAI O;  4IL6 O;  5G39 A;  1S5L O;  5GTH O;  5TIS O;  3A0B O;  2AXT O;  5G38 A; 
#chains in the Genus database with same CATH topology
 2M06 A;  4GCS A;  4GCP A;  2R4L A;  3PF1 A;  2JQY A;  4N74 A;  4FQE A;  4AKR A;  4GCQ A;  4BUM X;  3AA7 A;  1GFO A;  3T24 A;  1ZHW A;  4K3C A;  2IWW A;  1THQ A;  3AA1 A;  1QJP A;  2GE4 A;  2ODJ A;  2R8A A;  2J1N A;  4FZN A;  4D65 A;  2ZFG A;  4GF4 A;  1BT9 A;  1GFP A;  4F4B A;  3QRC A;  3AAA B;  3HWB A;  4JCH A;  1QJ8 A;  2WJQ A;  2MNH A;  3LK3 A;  4LSE A;  2JMM A;  3JTY A;  4QQ1 A;  1P4T A;  3WI5 A;  3AA6 B;  2R4P A;  3LK4 1;  1IZN B;  3POU A;  5PRN A;  4FZL A;  5KAI O;  1E54 A;  2F1V A;  2W81 C;  3PQU A;  6PRN A;  1PRN A;  3SY7 A;  2XTQ A;  3BRY A;  4LSI A;  5FVN A;  4XNL A;  1GFM A;  3DWO X;  4RL9 A;  1G90 A;  3T20 A;  1IZN A;  3A0B O;  3PGU A;  3VZU X;  3WI4 A;  3VZT X;  2F1C X;  4CTD A;  2KC0 A;  4U9C A;  3KZI O;  4C00 A;  3SY9 A;  4PR7 A;  3AAE B;  3VE2 A;  3QRA A;  4O3X B;  4LSH A;  5DL5 A;  3HOL A;  2YNK A;  4N59 A;  4K3B A;  4AKM A;  4UB8 O;  2FGQ X;  2O4V A;  1ZHX A;  2KZ7 A;  1T16 A;  3A0H O;  1T1L A;  4O4X A;  4RLB A;  1MM4 A;  2R4N A;  4GHB A;  2X27 X;  4AFK A;  4AYI D;  3PRN A;  4FRT A;  2XE3 A;  5EE2 A;  1BXW A;  2MHL A;  4LSF A;  4O3W A;  7PRN A;  3VE1 A;  4N75 A;  5ADX K;  4FES A;  1BH3 A;  3LK2 B;  2XE2 A;  2ZLD A;  3VY9 X;  3POQ A;  1OPF A;  3AAA A;  1QJ9 A;  3O0E A;  2WJR A;  5G26 A;  4B61 A;  4E1S A;  4FSP A;  4E1T A;  2Y2X A;  5AFU K;  3AA6 A;  3LK2 A;  1MPF A;  2Y7S A;  5G38 A;  5E79 O;  4O4U A;  4PJ0 O;  3POR A;  4AZL A;  4KR8 A;  2POR A;  3EMN X;  1ZHT A;  5D5D A;  2XTR A;  3AA0 B;  5JDP A;  1MM5 A;  5H2F O;  2Y0L A;  3NJT A;  4PUX A;  4KR4 A;  4JFB A;  5AFU L;  5B66 O;  5G3A A;  2KXP B;  5DL8 A;  5B5E O;  3JCU O;  3VZW X;  4AYD C;  3GP6 A;  2N2L A;  3AAE A;  2YPV A;  3AA0 A;  3HOE A;  3T0S A;  2LFU A;  3FYX A;  1YS5 A;  2XG6 A;  2K0L A;  4FZM A;  4C69 X;  2PRN A;  2KXP A;  4KRA A;  2N2M A;  2XMX A;  4O49 A;  4C4V B;  1HXU A;  4IL6 O;  5IYU A;  1S5L O;  4AKR B;  1PHO A;  3AA7 B;  3DA3 A;  5DL6 A;  4D64 A;  2LHF A;  3PQS A;  3G7G A;  2K4T A;  4N58 A;  1ZHZ A;  3RBH A;  4AUI A;  2XE5 A;  3AA1 B;  1OSM A;  4AYM C;  1GFN A;  3PGS A;  2ERV A;  2M07 A;  4C4V A;  4XNK A;  5ADX L;  4O3Y A;  3NSG A;  3POX A;  3K19 A;  4FMS A;  1HXT A;  4RJX A;  2WVP A;  4Z3T A;  3LK3 B;  2X9K A;  4FRX A;  3V8U A;  2QTK A;  3WU2 O;  5GTI O;  3PGR A;  3DZM A;  4G76 A;  3UAQ A;  3C5O A;  4FUV A;  4AYE C;  3BRZ A;  5DL7 A;  4O3Z A;  4FT6 A;  3UPG A;  3SZD A;  1ZHY A;  4FSO A;  2Y0H A;  5T5F A;  1Q9G A;  3BS0 A;  4G75 A;  1Q9F A;  2OMF A;  3DA4 A;  3DWN A;  2Y0K A;  5KAF O;  1ORM A;  2R4O A;  4RJW A;  4UB6 O;  5GV0 A;  3UU2 A;  4RLC A;  8PRN A;  2J4U P;  2W80 C;  2F1T A;  2R89 A;  3KVD D;  5G39 A;  3LK4 2;  2FGR A;  2KDY A;  2XE1 A;  3SYB A;  3TZG A;  4FOZ A;  4AYN A;  3SZV A;  5GTH O;  1HXX A;  3A2S X;  3SYS A;  2R88 A;  3VY8 X;  1H6S 1;  5TIS O;  2IWV A;  4D5U A;  2KZ7 B;  2AXT O;  3HW9 A;  1GFQ A; 
#chains in the Genus database with same CATH homology
 5E79 O;  3KZI O;  4PJ0 O;  4UB8 O;  5H2F O;  3WU2 O;  5GTI O;  5B66 O;  3A0H O;  5G3A A;  5B5E O;  3JCU O;  5KAF O;  4UB6 O;  5KAI O;  4IL6 O;  5G39 A;  1S5L O;  5GTH O;  5TIS O;  3A0B O;  2AXT O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...