3A0HO

Crystal structure of i-substituted photosystem ii complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
pubmed doi rcsb
molecule tags Electron transport
total genus 28
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2009-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3a0hO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3a0hO02
5B66O 5H2FO 5GTHO 5B5EO 3JCUO 5GTIO 4PJ0O 5E79O 1S5LO 2AXTO 4IL6O 5G39A 3A0BO 4UB8O 4UB6O 5KAIO 5G38A 5KAFO 3A0HO 5TISO 5G3AA 3KZIO 3WU2O
chains in the Genus database with same CATH superfamily
3SY7A 4U9CA 4FSPA 1H6S1 4K3CA 3EMNX 4FSOA 4LSFA 4FQEA 4B61A 1T16A 2PORA 2W81C 2JMMA 4FT6A 4RLBA 5G26A 2KXPB 4AFKA 3JCUO 1E54A 2LHFA 1Q9GA 1GFPA 2QTKA 3HWBA 4O4XA 4O3ZA 2YPVA 3A2SX 2R4PA 4RJXA 3WI4A 5GV0A 1QJPA 4GHBA 4KR8A 2XE2A 5AFUL 2XTRA 3SZVA 5ADXK 3FYXA 2N2LA 3BS0A 3LK3A 1GFOA 4G75A 1P4TA 5DL8A 2Y2XA 3HOEA 4AYNA 2R4OA 4C00A 3BRYA 2R89A 2ERVA 3PRNA 3TZGA 3VZTX 3BRZA 3AAAB 5KAIO 1ORMA 1T1LA 2F1VA 5T5FA 4O3XB 4AYEC 2KXPA 4AUIA 2ODJA 3UPGA 3VZUX 5G3AA 1YS5A 2F1CX 2MNHA 4GF4A 4C69X 3KZIO 5IYUA 3AA1A 2X9KA 3PORA 1ZHXA 3NJTA 4N58A 4O3YA 2Y7SA 3T20A 1G90A 4LSIA 2O4VA 5GTHO 2JQYA 3RBHA 2Y0KA 5JDPA 1ZHWA 3DWOX 3DA4A 2R88A 1IZNA 1PRNA 4PJ0O 4XNLA 2K0LA 2FGQX 1QJ8A 2W80C 3AAAA 1MPFA 3HOLA 3PGSA 3PQUA 4PR7A 2FGRA 2K4TA 2WJRA 3AA1B 2R4NA 4FOZA 1ZHYA 5D5DA 1S5LO 3G7GA 4PUXA 1GFQA 3VY9X 3JTYA 4IL6O 2XG6A 2M07A 4FRXA 2GE4A 1IZNB 3UAQA 3WI5A 2MHLA 3AA6A 4C4VA 4BUMX 4QQ1A 4UB8O 2IWVA 3A0HO 3AA7B 3K19A 2Y0HA 2KC0A 2N2MA 1OSMA 3SY9A 4KRAA 4FESA 3AAEB 1ZHZA 5B66O 3VZWX 4O3WA 3O0EA 4K3BA 4CTDA 4AKRB 4FMSA 5PRNA 2X27X 3VE2A 3VE1A 4GCSA 4AZLA 4LSHA 4RJWA 4KR4A 3AA6B 4C4VB 1PHOA 5B5EO 3LK42 3PGUA 3POXA 3LK41 1BXWA 5FVNA 2KZ7A 1HXTA 5E79O 5ADXL 3WU2O 4FZMA 3SZDA 7PRNA 3AA7A 3LK2B 4AYMC 4E1SA 3QRAA 4D64A 1THQA 4AYID 2AXTO 2R4LA 1MM4A 3AAEA 3UU2A 4E1TA 4F4BA 3QRCA 5G39A 5AFUK 2M06A 4FZLA 1BT9A 3A0BO 3HW9A 4O4UA 4AKRA 2PRNA 2KZ7B 3PQSA 4FRTA 2XMXA 1MM5A 4G76A 5G38A 5KAFO 3POQA 1QJ9A 4AKMA 3AA0B 4O49A 3SYBA 2R8AA 2YNKA 3T24A 3VY8X 2LFUA 5DL7A 4GCQA 5DL6A 2XE5A 5H2FO 3LK2A 3PGRA 2ZLDA 4FZNA 4JFBA 5DL5A 4LSEA 3POUA 4GCPA 3PF1A 4FUVA 5EE2A 4N75A 4XNKA 4N74A 2OMFA 5GTIO 2J4UP 4RL9A 4AYDC 6PRNA 4D65A 2Y0LA 2XE1A 2XE3A 3SYSA 2F1TA 1GFMA 2KDYA 2ZFGA 3AA0A 3DZMA 4RLCA 2J1NA 4N59A 4D5UA 1BH3A 3T0SA 1HXXA 3GP6A 1ZHTA 3DWNA 3DA3A 4JCHA 4UB6O 2WVPA 2IWWA 5TISO 2WJQA 4Z3TA 1OPFA 3LK3B 3KVDD 3V8UA 8PRNA 3NSGA 1HXUA 3C5OA 1Q9FA 2XTQA 1GFNA
chains in the Genus database with same CATH topology
5B66O 5H2FO 5GTHO 5B5EO 3JCUO 5GTIO 4PJ0O 5E79O 1S5LO 2AXTO 4IL6O 5G39A 3A0BO 4UB8O 4UB6O 5KAIO 5G38A 5KAFO 3A0HO 5TISO 5G3AA 3KZIO 3WU2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 O;  5H2F O;  5GTH O;  5B5E O;  3JCU O;  5GTI O;  4PJ0 O;  5E79 O;  1S5L O;  2AXT O;  4IL6 O;  5G39 A;  3A0B O;  4UB8 O;  4UB6 O;  5KAI O;  5G38 A;  5KAF O;  3A0H O;  5TIS O;  5G3A A;  3KZI O;  3WU2 O; 
#chains in the Genus database with same CATH topology
 3SY7 A;  4U9C A;  4FSP A;  1H6S 1;  4K3C A;  3EMN X;  4FSO A;  4LSF A;  4FQE A;  4B61 A;  1T16 A;  2POR A;  2W81 C;  2JMM A;  4FT6 A;  4RLB A;  5G26 A;  2KXP B;  4AFK A;  3JCU O;  1E54 A;  2LHF A;  1Q9G A;  1GFP A;  2QTK A;  3HWB A;  4O4X A;  4O3Z A;  2YPV A;  3A2S X;  2R4P A;  4RJX A;  3WI4 A;  5GV0 A;  1QJP A;  4GHB A;  4KR8 A;  2XE2 A;  5AFU L;  2XTR A;  3SZV A;  5ADX K;  3FYX A;  2N2L A;  3BS0 A;  3LK3 A;  1GFO A;  4G75 A;  1P4T A;  5DL8 A;  2Y2X A;  3HOE A;  4AYN A;  2R4O A;  4C00 A;  3BRY A;  2R89 A;  2ERV A;  3PRN A;  3TZG A;  3VZT X;  3BRZ A;  3AAA B;  5KAI O;  1ORM A;  1T1L A;  2F1V A;  5T5F A;  4O3X B;  4AYE C;  2KXP A;  4AUI A;  2ODJ A;  3UPG A;  3VZU X;  5G3A A;  1YS5 A;  2F1C X;  2MNH A;  4GF4 A;  4C69 X;  3KZI O;  5IYU A;  3AA1 A;  2X9K A;  3POR A;  1ZHX A;  3NJT A;  4N58 A;  4O3Y A;  2Y7S A;  3T20 A;  1G90 A;  4LSI A;  2O4V A;  5GTH O;  2JQY A;  3RBH A;  2Y0K A;  5JDP A;  1ZHW A;  3DWO X;  3DA4 A;  2R88 A;  1IZN A;  1PRN A;  4PJ0 O;  4XNL A;  2K0L A;  2FGQ X;  1QJ8 A;  2W80 C;  3AAA A;  1MPF A;  3HOL A;  3PGS A;  3PQU A;  4PR7 A;  2FGR A;  2K4T A;  2WJR A;  3AA1 B;  2R4N A;  4FOZ A;  1ZHY A;  5D5D A;  1S5L O;  3G7G A;  4PUX A;  1GFQ A;  3VY9 X;  3JTY A;  4IL6 O;  2XG6 A;  2M07 A;  4FRX A;  2GE4 A;  1IZN B;  3UAQ A;  3WI5 A;  2MHL A;  3AA6 A;  4C4V A;  4BUM X;  4QQ1 A;  4UB8 O;  2IWV A;  3A0H O;  3AA7 B;  3K19 A;  2Y0H A;  2KC0 A;  2N2M A;  1OSM A;  3SY9 A;  4KRA A;  4FES A;  3AAE B;  1ZHZ A;  5B66 O;  3VZW X;  4O3W A;  3O0E A;  4K3B A;  4CTD A;  4AKR B;  4FMS A;  5PRN A;  2X27 X;  3VE2 A;  3VE1 A;  4GCS A;  4AZL A;  4LSH A;  4RJW A;  4KR4 A;  3AA6 B;  4C4V B;  1PHO A;  5B5E O;  3LK4 2;  3PGU A;  3POX A;  3LK4 1;  1BXW A;  5FVN A;  2KZ7 A;  1HXT A;  5E79 O;  5ADX L;  3WU2 O;  4FZM A;  3SZD A;  7PRN A;  3AA7 A;  3LK2 B;  4AYM C;  4E1S A;  3QRA A;  4D64 A;  1THQ A;  4AYI D;  2AXT O;  2R4L A;  1MM4 A;  3AAE A;  3UU2 A;  4E1T A;  4F4B A;  3QRC A;  5G39 A;  5AFU K;  2M06 A;  4FZL A;  1BT9 A;  3A0B O;  3HW9 A;  4O4U A;  4AKR A;  2PRN A;  2KZ7 B;  3PQS A;  4FRT A;  2XMX A;  1MM5 A;  4G76 A;  5G38 A;  5KAF O;  3POQ A;  1QJ9 A;  4AKM A;  3AA0 B;  4O49 A;  3SYB A;  2R8A A;  2YNK A;  3T24 A;  3VY8 X;  2LFU A;  5DL7 A;  4GCQ A;  5DL6 A;  2XE5 A;  5H2F O;  3LK2 A;  3PGR A;  2ZLD A;  4FZN A;  4JFB A;  5DL5 A;  4LSE A;  3POU A;  4GCP A;  3PF1 A;  4FUV A;  5EE2 A;  4N75 A;  4XNK A;  4N74 A;  2OMF A;  5GTI O;  2J4U P;  4RL9 A;  4AYD C;  6PRN A;  4D65 A;  2Y0L A;  2XE1 A;  2XE3 A;  3SYS A;  2F1T A;  1GFM A;  2KDY A;  2ZFG A;  3AA0 A;  3DZM A;  4RLC A;  2J1N A;  4N59 A;  4D5U A;  1BH3 A;  3T0S A;  1HXX A;  3GP6 A;  1ZHT A;  3DWN A;  3DA3 A;  4JCH A;  4UB6 O;  2WVP A;  2IWW A;  5TIS O;  2WJQ A;  4Z3T A;  1OPF A;  3LK3 B;  3KVD D;  3V8U A;  8PRN A;  3NSG A;  1HXU A;  3C5O A;  1Q9F A;  2XTQ A;  1GFN A; 
#chains in the Genus database with same CATH homology
 5B66 O;  5H2F O;  5GTH O;  5B5E O;  3JCU O;  5GTI O;  4PJ0 O;  5E79 O;  1S5L O;  2AXT O;  4IL6 O;  5G39 A;  3A0B O;  4UB8 O;  4UB6 O;  5KAI O;  5G38 A;  5KAF O;  3A0H O;  5TIS O;  5G3A A;  3KZI O;  3WU2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...