2R88A

Crystal structure of the long-chain fatty acid transporter fadl mutant delta s3 kink
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
418
structure length
365
Chain Sequence
FQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITANDLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 96
structure length 365
sequence length 418
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r88A00
1T1LA 3PF1A 3BRYA 3PGSA 2R4LA 2R89A 3BRZA 2R4NA 2R4OA 2R8AA 3DWNA 3DWOX 3PGUA 1T16A 3BS0A 3PGRA 2R4PA 2R88A
chains in the Genus database with same CATH superfamily
2J1NA 5DL8A 5DL7A 5B5EO 2W81C 2ZFGA 3V8UA 4N58A 3AAEA 3SZDA 3A0BO 4D5UA 1ZHWA 2R88A 3PQSA 3A0HO 3SZVA 3VE1A 2R4LA 1BXWA 3POXA 2R8AA 4GCSA 4N74A 4LSIA 5FVNA 4JFBA 4IL6O 3HOEA 4C4VB 2GE4A 2M07A 2W80C 2MHLA 2Y7SA 3SYSA 4B61A 3BS0A 1QJPA 4FSOA 2JMMA 2Y0KA 3AAAA 4N59A 2F1VA 3AA7A 4FQEA 4KR4A 2WJRA 4O3XB 3PGUA 3AAAB 5KAIO 3VE2A 3DWNA 3DWOX 3AA0A 3VY9X 4C00A 1S5LO 3AA1A 4O4XA 1G90A 5G3AA 2XG6A 4FZNA 4BUMX 1ZHZA 4D64A 5GTHO 1BT9A 4FT6A 1H6S1 3PQUA 4FESA 4FMSA 4O4UA 5TISO 2KXPA 4D65A 5GTIO 3TZGA 1GFQA 2PORA 2KZ7B 1QJ8A 2PRNA 4F4BA 5DL6A 3LK41 4AYNA 4AKMA 3T24A 4Z3TA 3LK42 4PUXA 4U9CA 3KVDD 4LSHA 3RBHA 5KAFO 1BH3A 6PRNA 3HW9A 2OMFA 3LK3A 2Y0LA 3UU2A 2XMXA 3PGSA 3AAEB 2KC0A 7PRNA 4O3ZA 5AFUL 4PJ0O 2YPVA 2K4TA 5H2FO 2XTRA 3SY9A 3WU2O 4RJWA 3POQA 3FYXA 2IWVA 3VZWX 4AUIA 3G7GA 4AZLA 2AXTO 2MNHA 2K0LA 2WVPA 3AA7B 3EMNX 3PGRA 3POUA 3VZTX 5ADXK 4O49A 5G39A 5G38A 3UPGA 3AA0B 1IZNA 1QJ9A 1GFNA 1ZHYA 3AA1B 3BRZA 2R4OA 4K3CA 5D5DA 4AKRA 1T16A 2ERVA 3O0EA 4UB6O 4FZLA 2KXPB 5JDPA 5IYUA 1ZHTA 2X27X 3PF1A 2WJQA 3BRYA 4AYEC 4PR7A 3HOLA 1ZHXA 1HXXA 1Q9FA 1THQA 4KRAA 4O3WA 5DL5A 1HXUA 4G76A 4AYID 1GFOA 1MPFA 1MM5A 2R4PA 3DA3A 4AYDC 5GV0A 1T1LA 2Y0HA 4N75A 5T5FA 3UAQA 2IWWA 3LK3B 2O4VA 2YNKA 1GFMA 3T0SA 4LSEA 5B66O 2F1TA 2LFUA 2XE3A 2M06A 1PHOA 1Q9GA 3K19A 2LHFA 2XE5A 3AA6A 4FOZA 3LK2A 2R4NA 4E1TA 4K3BA 3QRCA 3LK2B 4AFKA 4GCQA 1ORMA 5ADXL 2N2LA 3DA4A 3NSGA 5E79O 3HWBA 1E54A 4AYMC 4UB8O 1IZNB 2XE2A 3KZIO 4GF4A 3C5OA 1HXTA 4LSFA 4XNLA 2QTKA 4AKRB 3T20A 4JCHA 2FGQX 1P4TA 4XNKA 4GCPA 3GP6A 4GHBA 3VZUX 4KR8A 4C4VA 1PRNA 3DZMA 1GFPA 1MM4A 4FUVA 3JCUO 3SY7A 2XTQA 4C69X 5AFUK 2ZLDA 2XE1A 8PRNA 3NJTA 4O3YA 4CTDA 4FZMA 3SYBA 5PRNA 3VY8X 2N2MA 3PORA 2ODJA 3WI4A 2R89A 3QRAA 4FRTA 4E1SA 2Y2XA 3AA6B 2FGRA 4G75A 4RJXA 1OPFA 1OSMA 3PRNA 2KZ7A 4RL9A 4FRXA 5G26A 2JQYA 2KDYA 5EE2A 2X9KA 4RLCA 1YS5A 2F1CX 3JTYA 4QQ1A 3WI5A 4RLBA 4FSPA 3A2SX 2J4UP
chains in the Genus database with same CATH topology
1T1LA 3PF1A 3BRYA 3PGSA 2R4LA 2R89A 3BRZA 2R4NA 2R4OA 2R8AA 3DWNA 3DWOX 3PGUA 1T16A 3BS0A 3PGRA 2R4PA 2R88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  3PF1 A;  3BRY A;  3PGS A;  2R4L A;  2R89 A;  3BRZ A;  2R4N A;  2R4O A;  2R8A A;  3DWN A;  3DWO X;  3PGU A;  1T16 A;  3BS0 A;  3PGR A;  2R4P A;  2R88 A; 
#chains in the Genus database with same CATH topology
 2J1N A;  5DL8 A;  5DL7 A;  5B5E O;  2W81 C;  2ZFG A;  3V8U A;  4N58 A;  3AAE A;  3SZD A;  3A0B O;  4D5U A;  1ZHW A;  2R88 A;  3PQS A;  3A0H O;  3SZV A;  3VE1 A;  2R4L A;  1BXW A;  3POX A;  2R8A A;  4GCS A;  4N74 A;  4LSI A;  5FVN A;  4JFB A;  4IL6 O;  3HOE A;  4C4V B;  2GE4 A;  2M07 A;  2W80 C;  2MHL A;  2Y7S A;  3SYS A;  4B61 A;  3BS0 A;  1QJP A;  4FSO A;  2JMM A;  2Y0K A;  3AAA A;  4N59 A;  2F1V A;  3AA7 A;  4FQE A;  4KR4 A;  2WJR A;  4O3X B;  3PGU A;  3AAA B;  5KAI O;  3VE2 A;  3DWN A;  3DWO X;  3AA0 A;  3VY9 X;  4C00 A;  1S5L O;  3AA1 A;  4O4X A;  1G90 A;  5G3A A;  2XG6 A;  4FZN A;  4BUM X;  1ZHZ A;  4D64 A;  5GTH O;  1BT9 A;  4FT6 A;  1H6S 1;  3PQU A;  4FES A;  4FMS A;  4O4U A;  5TIS O;  2KXP A;  4D65 A;  5GTI O;  3TZG A;  1GFQ A;  2POR A;  2KZ7 B;  1QJ8 A;  2PRN A;  4F4B A;  5DL6 A;  3LK4 1;  4AYN A;  4AKM A;  3T24 A;  4Z3T A;  3LK4 2;  4PUX A;  4U9C A;  3KVD D;  4LSH A;  3RBH A;  5KAF O;  1BH3 A;  6PRN A;  3HW9 A;  2OMF A;  3LK3 A;  2Y0L A;  3UU2 A;  2XMX A;  3PGS A;  3AAE B;  2KC0 A;  7PRN A;  4O3Z A;  5AFU L;  4PJ0 O;  2YPV A;  2K4T A;  5H2F O;  2XTR A;  3SY9 A;  3WU2 O;  4RJW A;  3POQ A;  3FYX A;  2IWV A;  3VZW X;  4AUI A;  3G7G A;  4AZL A;  2AXT O;  2MNH A;  2K0L A;  2WVP A;  3AA7 B;  3EMN X;  3PGR A;  3POU A;  3VZT X;  5ADX K;  4O49 A;  5G39 A;  5G38 A;  3UPG A;  3AA0 B;  1IZN A;  1QJ9 A;  1GFN A;  1ZHY A;  3AA1 B;  3BRZ A;  2R4O A;  4K3C A;  5D5D A;  4AKR A;  1T16 A;  2ERV A;  3O0E A;  4UB6 O;  4FZL A;  2KXP B;  5JDP A;  5IYU A;  1ZHT A;  2X27 X;  3PF1 A;  2WJQ A;  3BRY A;  4AYE C;  4PR7 A;  3HOL A;  1ZHX A;  1HXX A;  1Q9F A;  1THQ A;  4KRA A;  4O3W A;  5DL5 A;  1HXU A;  4G76 A;  4AYI D;  1GFO A;  1MPF A;  1MM5 A;  2R4P A;  3DA3 A;  4AYD C;  5GV0 A;  1T1L A;  2Y0H A;  4N75 A;  5T5F A;  3UAQ A;  2IWW A;  3LK3 B;  2O4V A;  2YNK A;  1GFM A;  3T0S A;  4LSE A;  5B66 O;  2F1T A;  2LFU A;  2XE3 A;  2M06 A;  1PHO A;  1Q9G A;  3K19 A;  2LHF A;  2XE5 A;  3AA6 A;  4FOZ A;  3LK2 A;  2R4N A;  4E1T A;  4K3B A;  3QRC A;  3LK2 B;  4AFK A;  4GCQ A;  1ORM A;  5ADX L;  2N2L A;  3DA4 A;  3NSG A;  5E79 O;  3HWB A;  1E54 A;  4AYM C;  4UB8 O;  1IZN B;  2XE2 A;  3KZI O;  4GF4 A;  3C5O A;  1HXT A;  4LSF A;  4XNL A;  2QTK A;  4AKR B;  3T20 A;  4JCH A;  2FGQ X;  1P4T A;  4XNK A;  4GCP A;  3GP6 A;  4GHB A;  3VZU X;  4KR8 A;  4C4V A;  1PRN A;  3DZM A;  1GFP A;  1MM4 A;  4FUV A;  3JCU O;  3SY7 A;  2XTQ A;  4C69 X;  5AFU K;  2ZLD A;  2XE1 A;  8PRN A;  3NJT A;  4O3Y A;  4CTD A;  4FZM A;  3SYB A;  5PRN A;  3VY8 X;  2N2M A;  3POR A;  2ODJ A;  3WI4 A;  2R89 A;  3QRA A;  4FRT A;  4E1S A;  2Y2X A;  3AA6 B;  2FGR A;  4G75 A;  4RJX A;  1OPF A;  1OSM A;  3PRN A;  2KZ7 A;  4RL9 A;  4FRX A;  5G26 A;  2JQY A;  2KDY A;  5EE2 A;  2X9K A;  4RLC A;  1YS5 A;  2F1C X;  3JTY A;  4QQ1 A;  3WI5 A;  4RLB A;  4FSP A;  3A2S X;  2J4U P; 
#chains in the Genus database with same CATH homology
 1T1L A;  3PF1 A;  3BRY A;  3PGS A;  2R4L A;  2R89 A;  3BRZ A;  2R4N A;  2R4O A;  2R8A A;  3DWN A;  3DWO X;  3PGU A;  1T16 A;  3BS0 A;  3PGR A;  2R4P A;  2R88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...