2R88A

Crystal structure of the long-chain fatty acid transporter fadl mutant delta s3 kink
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
418
structure length
365
Chain Sequence
b'FQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITANDLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 96
structure length 365
sequence length 418
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r88A00
2R4NA 3BRYA 3PGSA 2R4LA 1T16A 3BRZA 3PF1A 2R89A 3PGRA 2R88A 3DWOX 3DWNA 2R4OA 3PGUA 3BS0A 2R4PA 2R8AA 1T1LA
chains in the Genus database with same CATH superfamily
5G3AA 2J4UP 2LFUA 3VY8X 4LSHA 3SZVA 3AA1A 3BS0A 2K0LA 3PGSA 3LK42 4K3CA 3AA0B 4CTDA 2OMFA 2Y7SA 3PQSA 4QQ1A 5DL8A 1YS5A 3AAEB 1GFMA 2MHLA 3DWOX 3AA6A 4PR7A 3HOEA 2N2MA 3POXA 3KVDD 2Y2XA 4FRXA 3UAQA 2R8AA 4FSOA 1Q9FA 4AKMA 2XG6A 3AAAA 4FZNA 4JFBA 1S5LO 1ZHYA 4N59A 2W80C 3A0HO 2PRNA 1ZHWA 2J1NA 4RLBA 3KZIO 3WI4A 5B5EO 3SY9A 4AZLA 2F1CX 1MM5A 3DZMA 4XNKA 1QJ9A 3WU2O 3O0EA 2JMMA 3QRAA 4KRAA 2YPVA 2ZFGA 3BRYA 3TZGA 3VZTX 3WI5A 2XE5A 1HXTA 4GCPA 5FVNA 2MNHA 4C69X 5KAFO 3SY7A 5G38A 4B61A 2KXPB 4LSFA 4GF4A 1HXUA 3LK3B 1BXWA 3C5OA 1QJPA 3LK41 4RLCA 5T5FA 2X27X 4GHBA 5KAIO 5B66O 4D65A 4FT6A 1P4TA 1GFPA 2R4PA 4AYDC 4Z3TA 4C4VA 2IWVA 4O4XA 3PRNA 3SYSA 3AA1B 1IZNA 4AYID 3DA3A 5PRNA 3VZWX 5AFUK 4O3XB 3A0BO 4UB6O 4IL6O 5IYUA 2WVPA 3AA6B 5G26A 4UB8O 5JDPA 5DL6A 1OSMA 2M06A 4FUVA 4G75A 3PQUA 4AYEC 2X9KA 3NJTA 3NSGA 4C4VB 1HXXA 1PHOA 3A2SX 3K19A 4GCQA 4O3ZA 4RJWA 2LHFA 1MM4A 2KDYA 3AAAB 3FYXA 3T24A 2ZLDA 3HWBA 4JCHA 7PRNA 3BRZA 3PF1A 1ZHTA 2R89A 4N75A 2R88A 3GP6A 5DL7A 3RBHA 4AYMC 2W81C 1Q9GA 4N58A 3SZDA 1MPFA 4FMSA 3UPGA 2N2LA 4U9CA 3UU2A 4FOZA 8PRNA 4AKRA 3AA7A 4FESA 2F1TA 2XE3A 3T0SA 4FSPA 6PRNA 3HOLA 4PUXA 3SYBA 4AUIA 2ODJA 2KZ7A 4AFKA 5AFUL 2GE4A 3VE1A 2FGRA 2XMXA 4FZMA 5E79O 4O3YA 3JCUO 2O4VA 1THQA 1ZHXA 4FQEA 3PGRA 4O4UA 2XE2A 2KZ7B 4F4BA 3PORA 4RJXA 4D64A 3VZUX 2AXTO 2R4LA 3EMNX 3AA0A 1OPFA 4O49A 3VY9X 4AYNA 2XTRA 5ADXK 1E54A 4E1SA 3DWNA 2ERVA 5ADXL 3AAEA 2YNKA 3POQA 1T1LA 5GTHO 2R4NA 1IZNB 5H2FO 2IWWA 2XTQA 1BT9A 3QRCA 4PJ0O 3JTYA 4XNLA 2R4OA 4G76A 3G7GA 2KC0A 1ORMA 2XE1A 3VE2A 2WJQA 4C00A 4E1TA 4FRTA 1GFOA 1T16A 4D5UA 2F1VA 1ZHZA 2Y0LA 4GCSA 4K3BA 4KR4A 5GTIO 4LSEA 5TISO 2QTKA 3POUA 3LK2A 4RL9A 5GV0A 2WJRA 2Y0HA 4FZLA 3DA4A 3HW9A 4N74A 3AA7B 4AKRB 1G90A 4LSIA 5DL5A 1GFQA 2KXPA 5D5DA 2K4TA 2PORA 1H6S1 2Y0KA 2FGQX 3LK3A 4O3WA 1PRNA 3T20A 1BH3A 1QJ8A 3LK2B 4KR8A 1GFNA 3V8UA 3PGUA 5EE2A 2JQYA 4BUMX 2M07A 5G39A
chains in the Genus database with same CATH topology
2R4NA 3BRYA 3PGSA 2R4LA 1T16A 3BRZA 3PF1A 2R89A 3PGRA 2R88A 3DWOX 3DWNA 2R4OA 3PGUA 3BS0A 2R4PA 2R8AA 1T1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4N A;  3BRY A;  3PGS A;  2R4L A;  1T16 A;  3BRZ A;  3PF1 A;  2R89 A;  3PGR A;  2R88 A;  3DWO X;  3DWN A;  2R4O A;  3PGU A;  3BS0 A;  2R4P A;  2R8A A;  1T1L A; 
#chains in the Genus database with same CATH topology
 5G3A A;  2J4U P;  2LFU A;  3VY8 X;  4LSH A;  3SZV A;  3AA1 A;  3BS0 A;  2K0L A;  3PGS A;  3LK4 2;  4K3C A;  3AA0 B;  4CTD A;  2OMF A;  2Y7S A;  3PQS A;  4QQ1 A;  5DL8 A;  1YS5 A;  3AAE B;  1GFM A;  2MHL A;  3DWO X;  3AA6 A;  4PR7 A;  3HOE A;  2N2M A;  3POX A;  3KVD D;  2Y2X A;  4FRX A;  3UAQ A;  2R8A A;  4FSO A;  1Q9F A;  4AKM A;  2XG6 A;  3AAA A;  4FZN A;  4JFB A;  1S5L O;  1ZHY A;  4N59 A;  2W80 C;  3A0H O;  2PRN A;  1ZHW A;  2J1N A;  4RLB A;  3KZI O;  3WI4 A;  5B5E O;  3SY9 A;  4AZL A;  2F1C X;  1MM5 A;  3DZM A;  4XNK A;  1QJ9 A;  3WU2 O;  3O0E A;  2JMM A;  3QRA A;  4KRA A;  2YPV A;  2ZFG A;  3BRY A;  3TZG A;  3VZT X;  3WI5 A;  2XE5 A;  1HXT A;  4GCP A;  5FVN A;  2MNH A;  4C69 X;  5KAF O;  3SY7 A;  5G38 A;  4B61 A;  2KXP B;  4LSF A;  4GF4 A;  1HXU A;  3LK3 B;  1BXW A;  3C5O A;  1QJP A;  3LK4 1;  4RLC A;  5T5F A;  2X27 X;  4GHB A;  5KAI O;  5B66 O;  4D65 A;  4FT6 A;  1P4T A;  1GFP A;  2R4P A;  4AYD C;  4Z3T A;  4C4V A;  2IWV A;  4O4X A;  3PRN A;  3SYS A;  3AA1 B;  1IZN A;  4AYI D;  3DA3 A;  5PRN A;  3VZW X;  5AFU K;  4O3X B;  3A0B O;  4UB6 O;  4IL6 O;  5IYU A;  2WVP A;  3AA6 B;  5G26 A;  4UB8 O;  5JDP A;  5DL6 A;  1OSM A;  2M06 A;  4FUV A;  4G75 A;  3PQU A;  4AYE C;  2X9K A;  3NJT A;  3NSG A;  4C4V B;  1HXX A;  1PHO A;  3A2S X;  3K19 A;  4GCQ A;  4O3Z A;  4RJW A;  2LHF A;  1MM4 A;  2KDY A;  3AAA B;  3FYX A;  3T24 A;  2ZLD A;  3HWB A;  4JCH A;  7PRN A;  3BRZ A;  3PF1 A;  1ZHT A;  2R89 A;  4N75 A;  2R88 A;  3GP6 A;  5DL7 A;  3RBH A;  4AYM C;  2W81 C;  1Q9G A;  4N58 A;  3SZD A;  1MPF A;  4FMS A;  3UPG A;  2N2L A;  4U9C A;  3UU2 A;  4FOZ A;  8PRN A;  4AKR A;  3AA7 A;  4FES A;  2F1T A;  2XE3 A;  3T0S A;  4FSP A;  6PRN A;  3HOL A;  4PUX A;  3SYB A;  4AUI A;  2ODJ A;  2KZ7 A;  4AFK A;  5AFU L;  2GE4 A;  3VE1 A;  2FGR A;  2XMX A;  4FZM A;  5E79 O;  4O3Y A;  3JCU O;  2O4V A;  1THQ A;  1ZHX A;  4FQE A;  3PGR A;  4O4U A;  2XE2 A;  2KZ7 B;  4F4B A;  3POR A;  4RJX A;  4D64 A;  3VZU X;  2AXT O;  2R4L A;  3EMN X;  3AA0 A;  1OPF A;  4O49 A;  3VY9 X;  4AYN A;  2XTR A;  5ADX K;  1E54 A;  4E1S A;  3DWN A;  2ERV A;  5ADX L;  3AAE A;  2YNK A;  3POQ A;  1T1L A;  5GTH O;  2R4N A;  1IZN B;  5H2F O;  2IWW A;  2XTQ A;  1BT9 A;  3QRC A;  4PJ0 O;  3JTY A;  4XNL A;  2R4O A;  4G76 A;  3G7G A;  2KC0 A;  1ORM A;  2XE1 A;  3VE2 A;  2WJQ A;  4C00 A;  4E1T A;  4FRT A;  1GFO A;  1T16 A;  4D5U A;  2F1V A;  1ZHZ A;  2Y0L A;  4GCS A;  4K3B A;  4KR4 A;  5GTI O;  4LSE A;  5TIS O;  2QTK A;  3POU A;  3LK2 A;  4RL9 A;  5GV0 A;  2WJR A;  2Y0H A;  4FZL A;  3DA4 A;  3HW9 A;  4N74 A;  3AA7 B;  4AKR B;  1G90 A;  4LSI A;  5DL5 A;  1GFQ A;  2KXP A;  5D5D A;  2K4T A;  2POR A;  1H6S 1;  2Y0K A;  2FGQ X;  3LK3 A;  4O3W A;  1PRN A;  3T20 A;  1BH3 A;  1QJ8 A;  3LK2 B;  4KR8 A;  1GFN A;  3V8U A;  3PGU A;  5EE2 A;  2JQY A;  4BUM X;  2M07 A;  5G39 A; 
#chains in the Genus database with same CATH homology
 2R4N A;  3BRY A;  3PGS A;  2R4L A;  1T16 A;  3BRZ A;  3PF1 A;  2R89 A;  3PGR A;  2R88 A;  3DWO X;  3DWN A;  2R4O A;  3PGU A;  3BS0 A;  2R4P A;  2R8A A;  1T1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...