2R88A

Crystal structure of the long-chain fatty acid transporter fadl mutant delta s3 kink
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
418
structure length
365
Chain Sequence
FQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITANDLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 365
sequence length 418
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r88A00
2R8AA 1T1LA 3BRZA 3BS0A 3PF1A 2R4OA 3PGUA 2R4NA 2R4PA 3DWNA 3PGRA 2R88A 1T16A 3PGSA 2R89A 2R4LA 3DWOX 3BRYA
chains in the Genus database with same CATH superfamily
4GCSA 5IYUA 3KVDD 5KAIO 4C4VB 1ZHWA 3QRCA 4AKMA 2K0LA 7PRNA 3PQUA 3QRAA 4FZMA 2WVPA 2XG6A 3HOLA 1OPFA 4PJ0O 2WJRA 4RL9A 3SY9A 2PORA 1PHOA 4KR4A 3LK3A 2QTKA 3FYXA 1GFPA 3DZMA 3VZUX 3AA0B 5JDPA 3AA1B 1P4TA 3BS0A 2JQYA 4N75A 4O3ZA 3PQSA 3WI5A 3VY9X 1GFOA 2AXTO 3DA3A 4FESA 1THQA 3PGUA 3NSGA 3UAQA 1MM5A 3HW9A 2J1NA 3A0HO 4FRTA 2F1VA 1G90A 3VE1A 1HXTA 4JCHA 2FGRA 4O3WA 5TISO 4AKRA 5D5DA 4N58A 2M07A 5T5FA 5G38A 2F1TA 3PORA 3T0SA 3HWBA 3LK3B 5DL5A 1QJ9A 4UB8O 1ZHYA 2ODJA 2XMXA 3JCUO 2WJQA 1ORMA 3DWOX 4O4UA 3SZVA 3LK2A 4E1SA 4FUVA 4RLBA 4BUMX 5ADXL 3LK41 2W81C 4GCPA 2KC0A 4XNKA 5E79O 2XE3A 3VZTX 3WI4A 2K4TA 2R4NA 4QQ1A 1BT9A 4Z3TA 4LSEA 4KRAA 1YS5A 3POUA 5FVNA 4GHBA 2MHLA 4AKRB 3DA4A 3JTYA 2X27X 1Q9GA 2XE2A 3AAAA 2IWWA 4LSHA 4D65A 2Y0LA 2R89A 5AFUK 3BRYA 1MM4A 1E54A 5DL7A 4RJXA 3AAEA 2JMMA 4U9CA 2ERVA 4XNLA 4F4BA 4PR7A 3T20A 4LSIA 1QJPA 2ZLDA 3LK2B 4FSOA 2O4VA 3VE2A 5G26A 3PRNA 4AYNA 4AYEC 3K19A 1Q9FA 4AZLA 3SZDA 1IZNA 2GE4A 4G75A 3HOEA 1PRNA 4PUXA 3SYBA 2R4LA 2PRNA 3TZGA 2Y0HA 5GTHO 2IWVA 3AAAB 2OMFA 4FZLA 4O49A 3DWNA 4E1TA 3EMNX 1GFNA 3AA6A 2YPVA 3C5OA 3PGSA 4N59A 3AAEB 2R8AA 3A0BO 5G3AA 4AYDC 1ZHZA 4FMSA 2KZ7A 4FZNA 4O3YA 3POQA 4LSFA 4O4XA 5EE2A 8PRNA 2R4PA 2Y2XA 3SY7A 2R88A 1T16A 4K3CA 2KXPA 3V8UA 4C69X 1ZHXA 5G39A 4FOZA 1T1LA 2N2MA 1MPFA 1IZNB 4FT6A 3LK42 2LHFA 3A2SX 2X9KA 4O3XB 1GFMA 1HXXA 2Y0KA 4AUIA 4FRXA 1OSMA 4D5UA 3PF1A 5DL6A 2ZFGA 2XTRA 3AA7A 3AA6B 5DL8A 4IL6O 2J4UP 2F1CX 3UU2A 3O0EA 1ZHTA 5GTIO 2W80C 2FGQX 2KZ7B 4RLCA 2XE5A 2R4OA 4RJWA 3RBHA 2Y7SA 2KXPB 2XTQA 5PRNA 3VY8X 3WU2O 4C4VA 5ADXK 4UB6O 4N74A 3VZWX 4FSPA 2M06A 4AYMC 1BH3A 3T24A 2LFUA 4B61A 3UPGA 3NJTA 4GF4A 3G7GA 2YNKA 5AFUL 1GFQA 1H6S1 1HXUA 2XE1A 5H2FO 4G76A 3GP6A 3POXA 4JFBA 5B5EO 1BXWA 4AFKA 4AYID 3SYSA 3BRZA 2KDYA 3AA7B 4FQEA 4CTDA 1S5LO 2N2LA 5B66O 3AA0A 6PRNA 3AA1A 2MNHA 4KR8A 4C00A 5GV0A 4GCQA 1QJ8A 3KZIO 3PGRA 5KAFO 4D64A 4K3BA
chains in the Genus database with same CATH topology
2R8AA 1T1LA 3BRZA 3BS0A 3PF1A 2R4OA 3PGUA 2R4NA 2R4PA 3DWNA 3PGRA 2R88A 1T16A 3PGSA 2R89A 2R4LA 3DWOX 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8A A;  1T1L A;  3BRZ A;  3BS0 A;  3PF1 A;  2R4O A;  3PGU A;  2R4N A;  2R4P A;  3DWN A;  3PGR A;  2R88 A;  1T16 A;  3PGS A;  2R89 A;  2R4L A;  3DWO X;  3BRY A; 
#chains in the Genus database with same CATH topology
 4GCS A;  5IYU A;  3KVD D;  5KAI O;  4C4V B;  1ZHW A;  3QRC A;  4AKM A;  2K0L A;  7PRN A;  3PQU A;  3QRA A;  4FZM A;  2WVP A;  2XG6 A;  3HOL A;  1OPF A;  4PJ0 O;  2WJR A;  4RL9 A;  3SY9 A;  2POR A;  1PHO A;  4KR4 A;  3LK3 A;  2QTK A;  3FYX A;  1GFP A;  3DZM A;  3VZU X;  3AA0 B;  5JDP A;  3AA1 B;  1P4T A;  3BS0 A;  2JQY A;  4N75 A;  4O3Z A;  3PQS A;  3WI5 A;  3VY9 X;  1GFO A;  2AXT O;  3DA3 A;  4FES A;  1THQ A;  3PGU A;  3NSG A;  3UAQ A;  1MM5 A;  3HW9 A;  2J1N A;  3A0H O;  4FRT A;  2F1V A;  1G90 A;  3VE1 A;  1HXT A;  4JCH A;  2FGR A;  4O3W A;  5TIS O;  4AKR A;  5D5D A;  4N58 A;  2M07 A;  5T5F A;  5G38 A;  2F1T A;  3POR A;  3T0S A;  3HWB A;  3LK3 B;  5DL5 A;  1QJ9 A;  4UB8 O;  1ZHY A;  2ODJ A;  2XMX A;  3JCU O;  2WJQ A;  1ORM A;  3DWO X;  4O4U A;  3SZV A;  3LK2 A;  4E1S A;  4FUV A;  4RLB A;  4BUM X;  5ADX L;  3LK4 1;  2W81 C;  4GCP A;  2KC0 A;  4XNK A;  5E79 O;  2XE3 A;  3VZT X;  3WI4 A;  2K4T A;  2R4N A;  4QQ1 A;  1BT9 A;  4Z3T A;  4LSE A;  4KRA A;  1YS5 A;  3POU A;  5FVN A;  4GHB A;  2MHL A;  4AKR B;  3DA4 A;  3JTY A;  2X27 X;  1Q9G A;  2XE2 A;  3AAA A;  2IWW A;  4LSH A;  4D65 A;  2Y0L A;  2R89 A;  5AFU K;  3BRY A;  1MM4 A;  1E54 A;  5DL7 A;  4RJX A;  3AAE A;  2JMM A;  4U9C A;  2ERV A;  4XNL A;  4F4B A;  4PR7 A;  3T20 A;  4LSI A;  1QJP A;  2ZLD A;  3LK2 B;  4FSO A;  2O4V A;  3VE2 A;  5G26 A;  3PRN A;  4AYN A;  4AYE C;  3K19 A;  1Q9F A;  4AZL A;  3SZD A;  1IZN A;  2GE4 A;  4G75 A;  3HOE A;  1PRN A;  4PUX A;  3SYB A;  2R4L A;  2PRN A;  3TZG A;  2Y0H A;  5GTH O;  2IWV A;  3AAA B;  2OMF A;  4FZL A;  4O49 A;  3DWN A;  4E1T A;  3EMN X;  1GFN A;  3AA6 A;  2YPV A;  3C5O A;  3PGS A;  4N59 A;  3AAE B;  2R8A A;  3A0B O;  5G3A A;  4AYD C;  1ZHZ A;  4FMS A;  2KZ7 A;  4FZN A;  4O3Y A;  3POQ A;  4LSF A;  4O4X A;  5EE2 A;  8PRN A;  2R4P A;  2Y2X A;  3SY7 A;  2R88 A;  1T16 A;  4K3C A;  2KXP A;  3V8U A;  4C69 X;  1ZHX A;  5G39 A;  4FOZ A;  1T1L A;  2N2M A;  1MPF A;  1IZN B;  4FT6 A;  3LK4 2;  2LHF A;  3A2S X;  2X9K A;  4O3X B;  1GFM A;  1HXX A;  2Y0K A;  4AUI A;  4FRX A;  1OSM A;  4D5U A;  3PF1 A;  5DL6 A;  2ZFG A;  2XTR A;  3AA7 A;  3AA6 B;  5DL8 A;  4IL6 O;  2J4U P;  2F1C X;  3UU2 A;  3O0E A;  1ZHT A;  5GTI O;  2W80 C;  2FGQ X;  2KZ7 B;  4RLC A;  2XE5 A;  2R4O A;  4RJW A;  3RBH A;  2Y7S A;  2KXP B;  2XTQ A;  5PRN A;  3VY8 X;  3WU2 O;  4C4V A;  5ADX K;  4UB6 O;  4N74 A;  3VZW X;  4FSP A;  2M06 A;  4AYM C;  1BH3 A;  3T24 A;  2LFU A;  4B61 A;  3UPG A;  3NJT A;  4GF4 A;  3G7G A;  2YNK A;  5AFU L;  1GFQ A;  1H6S 1;  1HXU A;  2XE1 A;  5H2F O;  4G76 A;  3GP6 A;  3POX A;  4JFB A;  5B5E O;  1BXW A;  4AFK A;  4AYI D;  3SYS A;  3BRZ A;  2KDY A;  3AA7 B;  4FQE A;  4CTD A;  1S5L O;  2N2L A;  5B66 O;  3AA0 A;  6PRN A;  3AA1 A;  2MNH A;  4KR8 A;  4C00 A;  5GV0 A;  4GCQ A;  1QJ8 A;  3KZI O;  3PGR A;  5KAF O;  4D64 A;  4K3B A; 
#chains in the Genus database with same CATH homology
 2R8A A;  1T1L A;  3BRZ A;  3BS0 A;  3PF1 A;  2R4O A;  3PGU A;  2R4N A;  2R4P A;  3DWN A;  3PGR A;  2R88 A;  1T16 A;  3PGS A;  2R89 A;  2R4L A;  3DWO X;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...