2J4UP

E.coli ompc - camel lactoferrin complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
346
structure length
337
Chain Sequence
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OUTER MEMBRANE PROTEIN C PRECURSOR
publication title Crystal Structure of the Membrane Protein Ompc Complex with Antibacterial Lactoferrin
rcsb
molecule tags Membrane protein/hydrolase
total genus 70
structure length 337
sequence length 346
chains with identical sequence Q, R, U, V, W
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2j4uP00
4KRAA 2PRNA 6PRNA 4KR8A 5DL5A 2XG6A 2ODJA 3SZDA 1BH3A 3FYXA 2ZLDA 1HXXA 3T24A 3A2SX 2FGRA 4FSOA 4FMSA 4FOZA 5FVNA 3UPGA 4LSFA 2K4TA 4FSPA 3WI5A 3VZWX 3O0EA 2XE3A 1E54A 2QTKA 3T20A 2Y0LA 3POQA 4D5UA 4GCPA 2J1NA 2XE5A 3PRNA 1PHOA 3T0SA 1GFNA 5JDPA 4LSEA 4LSHA 1H6S1 4FRTA 5DL7A 4JFBA 3SYBA 3JTYA 3POXA 4KR4A 3HW9A 1MPFA 3VZUX 2FGQX 4RJWA 4D65A 1BT9A 3HWBA 1GFOA 3VZTX 3SY7A 2O4VA 2Y2XA 2OMFA 1PRNA 2XE1A 1GFPA 4FT6A 4LSIA 3VY8X 2J4UP 1GFQA 1HXTA 3NSGA 2Y0KA 3SYSA 7PRNA 3POUA 1HXUA 3WI4A 4RJXA 4C69X 5DL6A 4BUMX 3K19A 4D64A 2XE2A 3UU2A 4GCSA 3VY9X 3EMNX 3SZVA 1OPFA 5PRNA 3PORA 4GCQA 4AUIA 3SY9A 4FRXA 1OSMA 8PRNA 2Y0HA 5DL8A 1GFMA 2PORA 2ZFGA
chains in the Genus database with same CATH superfamily
3AAAB 1QJ9A 4FZLA 4G75A 2PRNA 4KRAA 4N58A 5KAIO 3AA1A 6PRNA 3AA0A 4KR8A 2R4OA 5DL5A 5JDPA 2XG6A 4XNKA 2ODJA 5AFUL 1QJPA 2ERVA 1BH3A 3FYXA 3SZDA 4FESA 4CTDA 2ZLDA 1BXWA 4AKRB 1HXXA 1ZHWA 2KZ7B 4PJ0O 1Q9FA 3T24A 3A2SX 4N59A 4AFKA 2FGRA 4FSOA 3GP6A 4FMSA 1ZHYA 4FOZA 4N75A 5FVNA 3G7GA 3UPGA 4LSFA 2K4TA 2WJRA 3PF1A 2X9KA 2IWVA 4FSPA 3VZWX 3WI5A 3C5OA 3BRZA 3O0EA 2XE3A 1IZNB 2AXTO 4UB8O 3VE1A 3A0BO 4QQ1A 1E54A 1ORMA 4RL9A 2QTKA 4XNLA 4FQEA 5EE2A 1MM5A 2MHLA 5G38A 2XMXA 3LK2A 1Q9GA 4AYMC 3T20A 4E1SA 2Y0LA 3POQA 1T16A 5B5EO 4D5UA 5G26A 2MNHA 3QRAA 5G39A 4GCPA 4AYNA 2J1NA 3AA6A 2R89A 2XE5A 1PHOA 3AA7B 3PRNA 1GFNA 2YNKA 2KDYA 3DZMA 3BS0A 3LK3A 5T5FA 1ZHXA 4LSEA 5AFUK 3KZIO 4LSHA 3AA0B 1H6S1 3WU2O 4AYID 2GE4A 4FRTA 5DL7A 4JFBA 3PQUA 4FZNA 3SYBA 3JCUO 3JTYA 3PGUA 4IL6O 2F1CX 3DWOX 2M07A 3POXA 3V8UA 4RLCA 4AKMA 3KVDD 3NJTA 3PQSA 2F1TA 5IYUA 5E79O 4KR4A 2XTRA 3HW9A 5D5DA 5H2FO 5GTHO 4C4VB 1QJ8A 2KXPB 5ADXL 2JQYA 3HOEA 3PGSA 1MPFA 2LHFA 3VZUX 4AKRA 2FGQX 4GHBA 4RJWA 2IWWA 1G90A 4D65A 1BT9A 2W80C 3HWBA 2R4NA 3AAEB 3DWNA 1T1LA 4B61A 1YS5A 1ZHZA 1GFOA 2LFUA 2N2LA 3LK2B 2Y7SA 3A0HO 2W81C 3VZTX 3AA1B 3PGRA 4UB6O 3SY7A 2O4VA 3LK41 1IZNA 2Y2XA 1P4TA 3AA6B 4RLBA 3RBHA 4AZLA 2R88A 3VE2A 2WJQA 2OMFA 1PRNA 2XE1A 1GFPA 4FT6A 4LSIA 3VY8X 2J4UP 1GFQA 4U9CA 1HXTA 3AAAA 2YPVA 3NSGA 2WVPA 2Y0KA 4JCHA 3HOLA 4G76A 4F4BA 3SYSA 7PRNA 5KAFO 3QRCA 1THQA 3POUA 1HXUA 4O3XB 3WI4A 4C00A 4O49A 5ADXK 2KC0A 4RJXA 4K3BA 2R8AA 4AYEC 4C69X 2KZ7A 5DL6A 1MM4A 3K19A 2N2MA 3TZGA 2XE2A 4BUMX 4D64A 3UU2A 4GCSA 4FZMA 5GTIO 3VY9X 4PR7A 3EMNX 4E1TA 2K0LA 2F1VA 5G3AA 1OPFA 2JMMA 3SZVA 2M06A 5PRNA 3T0SA 2X27X 1ZHTA 3PORA 4GCQA 2R4LA 3UAQA 4AUIA 4C4VA 3SY9A 2KXPA 4O3ZA 4FRXA 4N74A 3DA3A 4O4UA 4O3WA 3LK3B 5GV0A 1OSMA 8PRNA 4Z3TA 2Y0HA 1S5LO 4O4XA 4FUVA 4AYDC 2XTQA 5B66O 2R4PA 3AAEA 5DL8A 3BRYA 4K3CA 4O3YA 1GFMA 3LK42 4GF4A 4PUXA 2PORA 3DA4A 5TISO 2ZFGA 3AA7A
chains in the Genus database with same CATH topology
3AAAB 1QJ9A 4FZLA 4G75A 2PRNA 4KRAA 4N58A 3AA1A 6PRNA 3AA0A 4KR8A 5DL5A 2XG6A 4XNKA 2ODJA 5AFUL 1QJPA 2ERVA 1BH3A 3FYXA 3SZDA 4FESA 2ZLDA 1BXWA 4AKRB 1HXXA 1ZHWA 2KZ7B 1Q9FA 3T24A 3A2SX 4N59A 4AFKA 2FGRA 4FSOA 3GP6A 4FMSA 1ZHYA 4FOZA 5FVNA 3UPGA 3G7GA 4LSFA 2K4TA 4FSPA 3WI5A 3VZWX 3C5OA 3O0EA 2XE3A 1IZNB 3VE1A 4QQ1A 1E54A 1ORMA 4RL9A 2QTKA 4XNLA 5EE2A 4AYMC 1MM5A 2MHLA 3T20A 2XMXA 3LK2A 1Q9GA 4E1SA 2Y0LA 3POQA 4D5UA 5G26A 2MNHA 3QRAA 4GCPA 4AYNA 2J1NA 3AA6A 2XE5A 3AA7B 1PHOA 3PRNA 5T5FA 1GFNA 2YNKA 2KDYA 3LK3A 3T0SA 5JDPA 1ZHXA 4LSEA 5AFUK 4LSHA 3AA0B 1H6S1 4AYID 2GE4A 4FRTA 5DL7A 4JFBA 3PQUA 4FZNA 3SYBA 3V8UA 3JTYA 3POXA 2M07A 4RLCA 4AKMA 3KVDD 3PQSA 2F1TA 5IYUA 4KR4A 2XTRA 3HW9A 5D5DA 1QJ8A 2KXPB 5ADXL 5GV0A 3HOEA 1MPFA 2LHFA 3VZUX 4AKRA 2FGQX 4GHBA 4RJWA 1G90A 4D65A 1BT9A 2W80C 3HWBA 3AAEB 4B61A 1YS5A 1ZHZA 1GFOA 2LFUA 2N2LA 3LK2B 2Y7SA 2W81C 3VZTX 3AA1B 3SY7A 2O4VA 3LK41 1IZNA 2Y2XA 1P4TA 3AA6B 4RLBA 3RBHA 4AZLA 3VE2A 2OMFA 1PRNA 2XE1A 1GFPA 4FT6A 4LSIA 3VY8X 2J4UP 1GFQA 4U9CA 1HXTA 3AAAA 2YPVA 3NSGA 2Y0KA 4JCHA 3HOLA 4G76A 4F4BA 3SYSA 7PRNA 3QRCA 1THQA 3POUA 1HXUA 4O3XB 3WI4A 4O49A 5ADXK 2KC0A 4RJXA 4AYEC 4C69X 2KZ7A 5DL6A 1MM4A 3K19A 2N2MA 3TZGA 2XE2A 4BUMX 4D64A 3UU2A 4GCSA 4FZMA 3VY9X 3EMNX 4E1TA 2K0LA 2F1VA 3SZVA 1OPFA 2JMMA 2M06A 5PRNA 2X27X 1ZHTA 3PORA 4GCQA 4AUIA 3UAQA 3SY9A 2KXPA 4O3ZA 4FRXA 4O3WA 3DA3A 4O4UA 3LK3B 1OSMA 8PRNA 4Z3TA 2Y0HA 4O4XA 4FUVA 4AYDC 2XTQA 3AAEA 5DL8A 4O3YA 1GFMA 3LK42 4GF4A 4PUXA 2PORA 3DA4A 2ZFGA 3AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRA A;  2PRN A;  6PRN A;  4KR8 A;  5DL5 A;  2XG6 A;  2ODJ A;  3SZD A;  1BH3 A;  3FYX A;  2ZLD A;  1HXX A;  3T24 A;  3A2S X;  2FGR A;  4FSO A;  4FMS A;  4FOZ A;  5FVN A;  3UPG A;  4LSF A;  2K4T A;  4FSP A;  3WI5 A;  3VZW X;  3O0E A;  2XE3 A;  1E54 A;  2QTK A;  3T20 A;  2Y0L A;  3POQ A;  4D5U A;  4GCP A;  2J1N A;  2XE5 A;  3PRN A;  1PHO A;  3T0S A;  1GFN A;  5JDP A;  4LSE A;  4LSH A;  1H6S 1;  4FRT A;  5DL7 A;  4JFB A;  3SYB A;  3JTY A;  3POX A;  4KR4 A;  3HW9 A;  1MPF A;  3VZU X;  2FGQ X;  4RJW A;  4D65 A;  1BT9 A;  3HWB A;  1GFO A;  3VZT X;  3SY7 A;  2O4V A;  2Y2X A;  2OMF A;  1PRN A;  2XE1 A;  1GFP A;  4FT6 A;  4LSI A;  3VY8 X;  2J4U P;  1GFQ A;  1HXT A;  3NSG A;  2Y0K A;  3SYS A;  7PRN A;  3POU A;  1HXU A;  3WI4 A;  4RJX A;  4C69 X;  5DL6 A;  4BUM X;  3K19 A;  4D64 A;  2XE2 A;  3UU2 A;  4GCS A;  3VY9 X;  3EMN X;  3SZV A;  1OPF A;  5PRN A;  3POR A;  4GCQ A;  4AUI A;  3SY9 A;  4FRX A;  1OSM A;  8PRN A;  2Y0H A;  5DL8 A;  1GFM A;  2POR A;  2ZFG A; 
#chains in the Genus database with same CATH topology
 3AAA B;  1QJ9 A;  4FZL A;  4G75 A;  2PRN A;  4KRA A;  4N58 A;  5KAI O;  3AA1 A;  6PRN A;  3AA0 A;  4KR8 A;  2R4O A;  5DL5 A;  5JDP A;  2XG6 A;  4XNK A;  2ODJ A;  5AFU L;  1QJP A;  2ERV A;  1BH3 A;  3FYX A;  3SZD A;  4FES A;  4CTD A;  2ZLD A;  1BXW A;  4AKR B;  1HXX A;  1ZHW A;  2KZ7 B;  4PJ0 O;  1Q9F A;  3T24 A;  3A2S X;  4N59 A;  4AFK A;  2FGR A;  4FSO A;  3GP6 A;  4FMS A;  1ZHY A;  4FOZ A;  4N75 A;  5FVN A;  3G7G A;  3UPG A;  4LSF A;  2K4T A;  2WJR A;  3PF1 A;  2X9K A;  2IWV A;  4FSP A;  3VZW X;  3WI5 A;  3C5O A;  3BRZ A;  3O0E A;  2XE3 A;  1IZN B;  2AXT O;  4UB8 O;  3VE1 A;  3A0B O;  4QQ1 A;  1E54 A;  1ORM A;  4RL9 A;  2QTK A;  4XNL A;  4FQE A;  5EE2 A;  1MM5 A;  2MHL A;  5G38 A;  2XMX A;  3LK2 A;  1Q9G A;  4AYM C;  3T20 A;  4E1S A;  2Y0L A;  3POQ A;  1T16 A;  5B5E O;  4D5U A;  5G26 A;  2MNH A;  3QRA A;  5G39 A;  4GCP A;  4AYN A;  2J1N A;  3AA6 A;  2R89 A;  2XE5 A;  1PHO A;  3AA7 B;  3PRN A;  1GFN A;  2YNK A;  2KDY A;  3DZM A;  3BS0 A;  3LK3 A;  5T5F A;  1ZHX A;  4LSE A;  5AFU K;  3KZI O;  4LSH A;  3AA0 B;  1H6S 1;  3WU2 O;  4AYI D;  2GE4 A;  4FRT A;  5DL7 A;  4JFB A;  3PQU A;  4FZN A;  3SYB A;  3JCU O;  3JTY A;  3PGU A;  4IL6 O;  2F1C X;  3DWO X;  2M07 A;  3POX A;  3V8U A;  4RLC A;  4AKM A;  3KVD D;  3NJT A;  3PQS A;  2F1T A;  5IYU A;  5E79 O;  4KR4 A;  2XTR A;  3HW9 A;  5D5D A;  5H2F O;  5GTH O;  4C4V B;  1QJ8 A;  2KXP B;  5ADX L;  2JQY A;  3HOE A;  3PGS A;  1MPF A;  2LHF A;  3VZU X;  4AKR A;  2FGQ X;  4GHB A;  4RJW A;  2IWW A;  1G90 A;  4D65 A;  1BT9 A;  2W80 C;  3HWB A;  2R4N A;  3AAE B;  3DWN A;  1T1L A;  4B61 A;  1YS5 A;  1ZHZ A;  1GFO A;  2LFU A;  2N2L A;  3LK2 B;  2Y7S A;  3A0H O;  2W81 C;  3VZT X;  3AA1 B;  3PGR A;  4UB6 O;  3SY7 A;  2O4V A;  3LK4 1;  1IZN A;  2Y2X A;  1P4T A;  3AA6 B;  4RLB A;  3RBH A;  4AZL A;  2R88 A;  3VE2 A;  2WJQ A;  2OMF A;  1PRN A;  2XE1 A;  1GFP A;  4FT6 A;  4LSI A;  3VY8 X;  2J4U P;  1GFQ A;  4U9C A;  1HXT A;  3AAA A;  2YPV A;  3NSG A;  2WVP A;  2Y0K A;  4JCH A;  3HOL A;  4G76 A;  4F4B A;  3SYS A;  7PRN A;  5KAF O;  3QRC A;  1THQ A;  3POU A;  1HXU A;  4O3X B;  3WI4 A;  4C00 A;  4O49 A;  5ADX K;  2KC0 A;  4RJX A;  4K3B A;  2R8A A;  4AYE C;  4C69 X;  2KZ7 A;  5DL6 A;  1MM4 A;  3K19 A;  2N2M A;  3TZG A;  2XE2 A;  4BUM X;  4D64 A;  3UU2 A;  4GCS A;  4FZM A;  5GTI O;  3VY9 X;  4PR7 A;  3EMN X;  4E1T A;  2K0L A;  2F1V A;  5G3A A;  1OPF A;  2JMM A;  3SZV A;  2M06 A;  5PRN A;  3T0S A;  2X27 X;  1ZHT A;  3POR A;  4GCQ A;  2R4L A;  3UAQ A;  4AUI A;  4C4V A;  3SY9 A;  2KXP A;  4O3Z A;  4FRX A;  4N74 A;  3DA3 A;  4O4U A;  4O3W A;  3LK3 B;  5GV0 A;  1OSM A;  8PRN A;  4Z3T A;  2Y0H A;  1S5L O;  4O4X A;  4FUV A;  4AYD C;  2XTQ A;  5B66 O;  2R4P A;  3AAE A;  5DL8 A;  3BRY A;  4K3C A;  4O3Y A;  1GFM A;  3LK4 2;  4GF4 A;  4PUX A;  2POR A;  3DA4 A;  5TIS O;  2ZFG A;  3AA7 A; 
#chains in the Genus database with same CATH homology
 3AAA B;  1QJ9 A;  4FZL A;  4G75 A;  2PRN A;  4KRA A;  4N58 A;  3AA1 A;  6PRN A;  3AA0 A;  4KR8 A;  5DL5 A;  2XG6 A;  4XNK A;  2ODJ A;  5AFU L;  1QJP A;  2ERV A;  1BH3 A;  3FYX A;  3SZD A;  4FES A;  2ZLD A;  1BXW A;  4AKR B;  1HXX A;  1ZHW A;  2KZ7 B;  1Q9F A;  3T24 A;  3A2S X;  4N59 A;  4AFK A;  2FGR A;  4FSO A;  3GP6 A;  4FMS A;  1ZHY A;  4FOZ A;  5FVN A;  3UPG A;  3G7G A;  4LSF A;  2K4T A;  4FSP A;  3WI5 A;  3VZW X;  3C5O A;  3O0E A;  2XE3 A;  1IZN B;  3VE1 A;  4QQ1 A;  1E54 A;  1ORM A;  4RL9 A;  2QTK A;  4XNL A;  5EE2 A;  4AYM C;  1MM5 A;  2MHL A;  3T20 A;  2XMX A;  3LK2 A;  1Q9G A;  4E1S A;  2Y0L A;  3POQ A;  4D5U A;  5G26 A;  2MNH A;  3QRA A;  4GCP A;  4AYN A;  2J1N A;  3AA6 A;  2XE5 A;  3AA7 B;  1PHO A;  3PRN A;  5T5F A;  1GFN A;  2YNK A;  2KDY A;  3LK3 A;  3T0S A;  5JDP A;  1ZHX A;  4LSE A;  5AFU K;  4LSH A;  3AA0 B;  1H6S 1;  4AYI D;  2GE4 A;  4FRT A;  5DL7 A;  4JFB A;  3PQU A;  4FZN A;  3SYB A;  3V8U A;  3JTY A;  3POX A;  2M07 A;  4RLC A;  4AKM A;  3KVD D;  3PQS A;  2F1T A;  5IYU A;  4KR4 A;  2XTR A;  3HW9 A;  5D5D A;  1QJ8 A;  2KXP B;  5ADX L;  5GV0 A;  3HOE A;  1MPF A;  2LHF A;  3VZU X;  4AKR A;  2FGQ X;  4GHB A;  4RJW A;  1G90 A;  4D65 A;  1BT9 A;  2W80 C;  3HWB A;  3AAE B;  4B61 A;  1YS5 A;  1ZHZ A;  1GFO A;  2LFU A;  2N2L A;  3LK2 B;  2Y7S A;  2W81 C;  3VZT X;  3AA1 B;  3SY7 A;  2O4V A;  3LK4 1;  1IZN A;  2Y2X A;  1P4T A;  3AA6 B;  4RLB A;  3RBH A;  4AZL A;  3VE2 A;  2OMF A;  1PRN A;  2XE1 A;  1GFP A;  4FT6 A;  4LSI A;  3VY8 X;  2J4U P;  1GFQ A;  4U9C A;  1HXT A;  3AAA A;  2YPV A;  3NSG A;  2Y0K A;  4JCH A;  3HOL A;  4G76 A;  4F4B A;  3SYS A;  7PRN A;  3QRC A;  1THQ A;  3POU A;  1HXU A;  4O3X B;  3WI4 A;  4O49 A;  5ADX K;  2KC0 A;  4RJX A;  4AYE C;  4C69 X;  2KZ7 A;  5DL6 A;  1MM4 A;  3K19 A;  2N2M A;  3TZG A;  2XE2 A;  4BUM X;  4D64 A;  3UU2 A;  4GCS A;  4FZM A;  3VY9 X;  3EMN X;  4E1T A;  2K0L A;  2F1V A;  3SZV A;  1OPF A;  2JMM A;  2M06 A;  5PRN A;  2X27 X;  1ZHT A;  3POR A;  4GCQ A;  4AUI A;  3UAQ A;  3SY9 A;  2KXP A;  4O3Z A;  4FRX A;  4O3W A;  3DA3 A;  4O4U A;  3LK3 B;  1OSM A;  8PRN A;  4Z3T A;  2Y0H A;  4O4X A;  4FUV A;  4AYD C;  2XTQ A;  3AAE A;  5DL8 A;  4O3Y A;  1GFM A;  3LK4 2;  4GF4 A;  4PUX A;  2POR A;  3DA4 A;  2ZFG A;  3AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...