2J4UP

E.coli ompc - camel lactoferrin complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
346
structure length
337
Chain Sequence
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/hydrolase
molecule keywords OUTER MEMBRANE PROTEIN C PRECURSOR
publication title Crystal Structure of the Membrane Protein Ompc Complex with Antibacterial Lactoferrin
rcsb
total genus 70
structure length 337
sequence length 346
chains with identical sequence Q, R, U, V, W
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2j4uP00
3FYXA 4FMSA 8PRNA 3POQA 3HW9A 2ZFGA 1HXTA 4GCPA 1GFOA 4D64A 3VY9X 1PRNA 2Y0LA 4GCSA 2Y0KA 4AUIA 5PRNA 1GFPA 3SY9A 3WI4A 3T20A 4LSFA 3VZWX 4C69X 4D65A 3VZTX 4LSHA 1MPFA 4FOZA 5DL5A 3A2SX 5DL6A 3T24A 3JTYA 4FRXA 2K4TA 4KR4A 3UPGA 4GCQA 3POXA 3SZDA 2Y2XA 4RJWA 2XE1A 4BUMX 1HXXA 2FGRA 4FRTA 1GFQA 2QTKA 3T0SA 1HXUA 6PRNA 3PORA 7PRNA 3SYBA 3POUA 3SYSA 3VZUX 4JFBA 1BH3A 3UU2A 3EMNX 5JDPA 2XE3A 4FT6A 1PHOA 2OMFA 5DL7A 4LSIA 2PRNA 2XE5A 1OSMA 3HWBA 1GFMA 2Y0HA 4KR8A 2ODJA 3O0EA 1H6S1 2J1NA 4FSOA 1E54A 2J4UP 3SY7A 3PRNA 1OPFA 1GFNA 3WI5A 3K19A 5DL8A 2XG6A 4RJXA 2PORA 5FVNA 4KRAA 1BT9A 4D5UA 3SZVA 3NSGA 4LSEA 2FGQX 2XE2A 4FSPA 2ZLDA 3VY8X 2O4VA
chains in the Genus database with same CATH superfamily
3FYXA 4O3YA 2AXTO 1S5LO 5G26A 2N2MA 4N58A 4FMSA 5AFUL 8PRNA 3AAEB 3POQA 2KZ7A 3HW9A 2WVPA 3PQUA 2ZFGA 3HOEA 4AYID 4FZNA 1HXTA 5H2FO 5T5FA 2N2LA 4GCPA 2KXPB 3BS0A 4FQEA 1GFOA 1T16A 4D64A 3VY9X 3DWNA 1ZHTA 5ADXL 1PRNA 1YS5A 2MHLA 3PGUA 4AFKA 5B5EO 5TISO 3VE2A 4AYNA 2Y0LA 5G3AA 2JQYA 3AA7B 4GCSA 3G7GA 2WJRA 2Y0KA 4AUIA 5PRNA 1GFPA 2M06A 4O3ZA 2Y7SA 2LFUA 3LK3B 3SY9A 3WI4A 1IZNA 3T20A 4LSFA 5GTIO 3VZWX 4C69X 4D65A 3AAAA 5EE2A 2X27X 4IL6O 4LSHA 4PR7A 3VZTX 1MPFA 4AKMA 2K0LA 2ERVA 4AYDC 3C5OA 2F1CX 3KZIO 5GV0A 2IWVA 2XTRA 3PGSA 2XMXA 2R8AA 3AA1B 4FOZA 4U9CA 4XNKA 4C4VA 5DL5A 3A2SX 5DL6A 3T24A 3JTYA 5D5DA 3PQSA 3JCUO 4AKRA 4FRXA 3LK2B 2K4TA 4KR4A 3UPGA 4GCQA 1QJ8A 2M07A 3VE1A 4E1SA 3AA0B 3POXA 4GHBA 4RLCA 2JMMA 3SZDA 3AAEA 2Y2XA 3PF1A 1G90A 1BXWA 1P4TA 1QJ9A 4RJWA 2XE1A 4QQ1A 4BUMX 1HXXA 2FGRA 5IYUA 2GE4A 4FRTA 4AYMC 2R4LA 3DWOX 2KXPA 3KVDD 4O49A 2F1TA 4C00A 1ZHWA 5G39A 1GFQA 2QTKA 2WJQA 3T0SA 4UB8O 5AFUK 1HXUA 3AA6B 3AA0A 3DA3A 6PRNA 3PORA 7PRNA 2KDYA 3LK41 3SYBA 2R4PA 2R88A 3AA7A 4FZLA 1MM4A 2R4NA 1ZHZA 3POUA 2KC0A 3LK3A 4G75A 2IWWA 4AZLA 5B66O 1ZHXA 4AYEC 3SYSA 1MM5A 5ADXK 2XTQA 3VZUX 4JFBA 4E1TA 5GTHO 3BRYA 1BH3A 3GP6A 1ZHYA 4G76A 4K3BA 4PJ0O 2R4OA 3EMNX 3RBHA 4K3CA 3TZGA 4FUVA 4O4UA 1Q9GA 3UAQA 2XE3A 5JDPA 4FT6A 3DA4A 1PHOA 2W81C 2KZ7B 2OMFA 5DL7A 4LSIA 2PRNA 2XE5A 1OSMA 3AA1A 1Q9FA 5KAFO 3WU2O 3V8UA 4JCHA 3HWBA 4N59A 1GFMA 2Y0HA 4FZMA 2LHFA 2ODJA 4KR8A 4CTDA 3O0EA 3LK42 3BRZA 3LK2A 3NJTA 1H6S1 2F1VA 2J1NA 4FSOA 4O4XA 4B61A 4F4BA 2W80C 1E54A 3PGRA 5E79O 1ORMA 3HOLA 2J4UP 3UU2A 3SY7A 4O3WA 3PRNA 1OPFA 1GFNA 1T1LA 3QRAA 4PUXA 1IZNB 3K19A 5DL8A 3WI5A 2R89A 2XG6A 3AAAB 4N75A 4XNLA 3QRCA 5G38A 2YPVA 3A0BO 4RLBA 3A0HO 2MNHA 4FESA 4RJXA 2PORA 5FVNA 4KRAA 3DZMA 4N74A 4O3XB 5KAIO 2YNKA 4GF4A 3AA6A 1BT9A 4D5UA 3SZVA 4Z3TA 4RL9A 3NSGA 4LSEA 1QJPA 2FGQX 2XE2A 2X9KA 4C4VB 1THQA 2ZLDA 4FSPA 3VY8X 4UB6O 4AKRB 2O4VA
chains in the Genus database with same CATH topology
3FYXA 4O3YA 5G26A 2N2MA 4N58A 4FMSA 5AFUL 8PRNA 3AAEB 3POQA 2KZ7A 3HW9A 3PQUA 2ZFGA 3HOEA 4FZNA 1HXTA 5T5FA 2N2LA 4GCPA 2KXPB 1GFOA 4D64A 3VY9X 1ZHTA 5ADXL 1PRNA 1YS5A 2MHLA 4AFKA 3VE2A 4AYNA 2Y0LA 4GCSA 3AA7B 3G7GA 2Y0KA 4AUIA 5PRNA 1GFPA 2M06A 4O3ZA 2Y7SA 2LFUA 3LK3B 3SY9A 3WI4A 1IZNA 3T20A 4LSFA 3VZWX 4C69X 4D65A 3AAAA 5EE2A 2X27X 4LSHA 3VZTX 1MPFA 4AKMA 2K0LA 2ERVA 4AYDC 3C5OA 5GV0A 2XTRA 2XMXA 3AA1B 4FOZA 4U9CA 4XNKA 5DL5A 3A2SX 5DL6A 3T24A 3JTYA 5D5DA 3PQSA 4AKRA 4FRXA 3LK2B 2K4TA 4KR4A 3UPGA 4GCQA 1QJ8A 2M07A 3VE1A 4E1SA 3AA0B 3POXA 4GHBA 4RLCA 2JMMA 3SZDA 3AAEA 2Y2XA 1G90A 1BXWA 1P4TA 1QJ9A 4RJWA 2XE1A 4QQ1A 4BUMX 1HXXA 2FGRA 5IYUA 2GE4A 4FRTA 4AYMC 2KXPA 3KVDD 4O49A 2F1TA 1ZHWA 1GFQA 2QTKA 3T0SA 5AFUK 1HXUA 3AA6B 3AA0A 3DA3A 6PRNA 3PORA 7PRNA 2KDYA 3LK41 3SYBA 3AA7A 4FZLA 1MM4A 1ZHZA 3POUA 2KC0A 3LK3A 4G75A 4AZLA 1ZHXA 4AYEC 3SYSA 1MM5A 5ADXK 2XTQA 3VZUX 4JFBA 4E1TA 3GP6A 1BH3A 4AYID 1ZHYA 4G76A 3UU2A 3RBHA 3EMNX 3TZGA 3UAQA 4FUVA 4O4UA 1Q9GA 5JDPA 2XE3A 4FT6A 3DA4A 1PHOA 2W81C 2KZ7B 2OMFA 5DL7A 4LSIA 2PRNA 2XE5A 1OSMA 3AA1A 1Q9FA 3V8UA 4JCHA 3HWBA 4N59A 1GFMA 2Y0HA 4FZMA 2LHFA 2ODJA 4KR8A 3O0EA 3LK42 3LK2A 1H6S1 2F1VA 2J1NA 4FSOA 4O4XA 4B61A 4F4BA 2W80C 1E54A 1ORMA 3HOLA 2J4UP 3SY7A 4O3WA 3PRNA 1OPFA 1GFNA 3QRAA 4PUXA 3WI5A 1IZNB 3K19A 5DL8A 4XNLA 2XG6A 3AAAB 3QRCA 2YPVA 4RLBA 2MNHA 4FESA 4RJXA 2PORA 5FVNA 4KRAA 4O3XB 2YNKA 4GF4A 3AA6A 1BT9A 4D5UA 3SZVA 4Z3TA 4RL9A 3NSGA 4LSEA 1QJPA 2FGQX 2XE2A 1THQA 2ZLDA 4FSPA 3VY8X 4AKRB 2O4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FYX A;  4FMS A;  8PRN A;  3POQ A;  3HW9 A;  2ZFG A;  1HXT A;  4GCP A;  1GFO A;  4D64 A;  3VY9 X;  1PRN A;  2Y0L A;  4GCS A;  2Y0K A;  4AUI A;  5PRN A;  1GFP A;  3SY9 A;  3WI4 A;  3T20 A;  4LSF A;  3VZW X;  4C69 X;  4D65 A;  3VZT X;  4LSH A;  1MPF A;  4FOZ A;  5DL5 A;  3A2S X;  5DL6 A;  3T24 A;  3JTY A;  4FRX A;  2K4T A;  4KR4 A;  3UPG A;  4GCQ A;  3POX A;  3SZD A;  2Y2X A;  4RJW A;  2XE1 A;  4BUM X;  1HXX A;  2FGR A;  4FRT A;  1GFQ A;  2QTK A;  3T0S A;  1HXU A;  6PRN A;  3POR A;  7PRN A;  3SYB A;  3POU A;  3SYS A;  3VZU X;  4JFB A;  1BH3 A;  3UU2 A;  3EMN X;  5JDP A;  2XE3 A;  4FT6 A;  1PHO A;  2OMF A;  5DL7 A;  4LSI A;  2PRN A;  2XE5 A;  1OSM A;  3HWB A;  1GFM A;  2Y0H A;  4KR8 A;  2ODJ A;  3O0E A;  1H6S 1;  2J1N A;  4FSO A;  1E54 A;  2J4U P;  3SY7 A;  3PRN A;  1OPF A;  1GFN A;  3WI5 A;  3K19 A;  5DL8 A;  2XG6 A;  4RJX A;  2POR A;  5FVN A;  4KRA A;  1BT9 A;  4D5U A;  3SZV A;  3NSG A;  4LSE A;  2FGQ X;  2XE2 A;  4FSP A;  2ZLD A;  3VY8 X;  2O4V A; 
#chains in the Genus database with same CATH topology
 3FYX A;  4O3Y A;  2AXT O;  1S5L O;  5G26 A;  2N2M A;  4N58 A;  4FMS A;  5AFU L;  8PRN A;  3AAE B;  3POQ A;  2KZ7 A;  3HW9 A;  2WVP A;  3PQU A;  2ZFG A;  3HOE A;  4AYI D;  4FZN A;  1HXT A;  5H2F O;  5T5F A;  2N2L A;  4GCP A;  2KXP B;  3BS0 A;  4FQE A;  1GFO A;  1T16 A;  4D64 A;  3VY9 X;  3DWN A;  1ZHT A;  5ADX L;  1PRN A;  1YS5 A;  2MHL A;  3PGU A;  4AFK A;  5B5E O;  5TIS O;  3VE2 A;  4AYN A;  2Y0L A;  5G3A A;  2JQY A;  3AA7 B;  4GCS A;  3G7G A;  2WJR A;  2Y0K A;  4AUI A;  5PRN A;  1GFP A;  2M06 A;  4O3Z A;  2Y7S A;  2LFU A;  3LK3 B;  3SY9 A;  3WI4 A;  1IZN A;  3T20 A;  4LSF A;  5GTI O;  3VZW X;  4C69 X;  4D65 A;  3AAA A;  5EE2 A;  2X27 X;  4IL6 O;  4LSH A;  4PR7 A;  3VZT X;  1MPF A;  4AKM A;  2K0L A;  2ERV A;  4AYD C;  3C5O A;  2F1C X;  3KZI O;  5GV0 A;  2IWV A;  2XTR A;  3PGS A;  2XMX A;  2R8A A;  3AA1 B;  4FOZ A;  4U9C A;  4XNK A;  4C4V A;  5DL5 A;  3A2S X;  5DL6 A;  3T24 A;  3JTY A;  5D5D A;  3PQS A;  3JCU O;  4AKR A;  4FRX A;  3LK2 B;  2K4T A;  4KR4 A;  3UPG A;  4GCQ A;  1QJ8 A;  2M07 A;  3VE1 A;  4E1S A;  3AA0 B;  3POX A;  4GHB A;  4RLC A;  2JMM A;  3SZD A;  3AAE A;  2Y2X A;  3PF1 A;  1G90 A;  1BXW A;  1P4T A;  1QJ9 A;  4RJW A;  2XE1 A;  4QQ1 A;  4BUM X;  1HXX A;  2FGR A;  5IYU A;  2GE4 A;  4FRT A;  4AYM C;  2R4L A;  3DWO X;  2KXP A;  3KVD D;  4O49 A;  2F1T A;  4C00 A;  1ZHW A;  5G39 A;  1GFQ A;  2QTK A;  2WJQ A;  3T0S A;  4UB8 O;  5AFU K;  1HXU A;  3AA6 B;  3AA0 A;  3DA3 A;  6PRN A;  3POR A;  7PRN A;  2KDY A;  3LK4 1;  3SYB A;  2R4P A;  2R88 A;  3AA7 A;  4FZL A;  1MM4 A;  2R4N A;  1ZHZ A;  3POU A;  2KC0 A;  3LK3 A;  4G75 A;  2IWW A;  4AZL A;  5B66 O;  1ZHX A;  4AYE C;  3SYS A;  1MM5 A;  5ADX K;  2XTQ A;  3VZU X;  4JFB A;  4E1T A;  5GTH O;  3BRY A;  1BH3 A;  3GP6 A;  1ZHY A;  4G76 A;  4K3B A;  4PJ0 O;  2R4O A;  3EMN X;  3RBH A;  4K3C A;  3TZG A;  4FUV A;  4O4U A;  1Q9G A;  3UAQ A;  2XE3 A;  5JDP A;  4FT6 A;  3DA4 A;  1PHO A;  2W81 C;  2KZ7 B;  2OMF A;  5DL7 A;  4LSI A;  2PRN A;  2XE5 A;  1OSM A;  3AA1 A;  1Q9F A;  5KAF O;  3WU2 O;  3V8U A;  4JCH A;  3HWB A;  4N59 A;  1GFM A;  2Y0H A;  4FZM A;  2LHF A;  2ODJ A;  4KR8 A;  4CTD A;  3O0E A;  3LK4 2;  3BRZ A;  3LK2 A;  3NJT A;  1H6S 1;  2F1V A;  2J1N A;  4FSO A;  4O4X A;  4B61 A;  4F4B A;  2W80 C;  1E54 A;  3PGR A;  5E79 O;  1ORM A;  3HOL A;  2J4U P;  3UU2 A;  3SY7 A;  4O3W A;  3PRN A;  1OPF A;  1GFN A;  1T1L A;  3QRA A;  4PUX A;  1IZN B;  3K19 A;  5DL8 A;  3WI5 A;  2R89 A;  2XG6 A;  3AAA B;  4N75 A;  4XNL A;  3QRC A;  5G38 A;  2YPV A;  3A0B O;  4RLB A;  3A0H O;  2MNH A;  4FES A;  4RJX A;  2POR A;  5FVN A;  4KRA A;  3DZM A;  4N74 A;  4O3X B;  5KAI O;  2YNK A;  4GF4 A;  3AA6 A;  1BT9 A;  4D5U A;  3SZV A;  4Z3T A;  4RL9 A;  3NSG A;  4LSE A;  1QJP A;  2FGQ X;  2XE2 A;  2X9K A;  4C4V B;  1THQ A;  2ZLD A;  4FSP A;  3VY8 X;  4UB6 O;  4AKR B;  2O4V A; 
#chains in the Genus database with same CATH homology
 3FYX A;  4O3Y A;  5G26 A;  2N2M A;  4N58 A;  4FMS A;  5AFU L;  8PRN A;  3AAE B;  3POQ A;  2KZ7 A;  3HW9 A;  3PQU A;  2ZFG A;  3HOE A;  4FZN A;  1HXT A;  5T5F A;  2N2L A;  4GCP A;  2KXP B;  1GFO A;  4D64 A;  3VY9 X;  1ZHT A;  5ADX L;  1PRN A;  1YS5 A;  2MHL A;  4AFK A;  3VE2 A;  4AYN A;  2Y0L A;  4GCS A;  3AA7 B;  3G7G A;  2Y0K A;  4AUI A;  5PRN A;  1GFP A;  2M06 A;  4O3Z A;  2Y7S A;  2LFU A;  3LK3 B;  3SY9 A;  3WI4 A;  1IZN A;  3T20 A;  4LSF A;  3VZW X;  4C69 X;  4D65 A;  3AAA A;  5EE2 A;  2X27 X;  4LSH A;  3VZT X;  1MPF A;  4AKM A;  2K0L A;  2ERV A;  4AYD C;  3C5O A;  5GV0 A;  2XTR A;  2XMX A;  3AA1 B;  4FOZ A;  4U9C A;  4XNK A;  5DL5 A;  3A2S X;  5DL6 A;  3T24 A;  3JTY A;  5D5D A;  3PQS A;  4AKR A;  4FRX A;  3LK2 B;  2K4T A;  4KR4 A;  3UPG A;  4GCQ A;  1QJ8 A;  2M07 A;  3VE1 A;  4E1S A;  3AA0 B;  3POX A;  4GHB A;  4RLC A;  2JMM A;  3SZD A;  3AAE A;  2Y2X A;  1G90 A;  1BXW A;  1P4T A;  1QJ9 A;  4RJW A;  2XE1 A;  4QQ1 A;  4BUM X;  1HXX A;  2FGR A;  5IYU A;  2GE4 A;  4FRT A;  4AYM C;  2KXP A;  3KVD D;  4O49 A;  2F1T A;  1ZHW A;  1GFQ A;  2QTK A;  3T0S A;  5AFU K;  1HXU A;  3AA6 B;  3AA0 A;  3DA3 A;  6PRN A;  3POR A;  7PRN A;  2KDY A;  3LK4 1;  3SYB A;  3AA7 A;  4FZL A;  1MM4 A;  1ZHZ A;  3POU A;  2KC0 A;  3LK3 A;  4G75 A;  4AZL A;  1ZHX A;  4AYE C;  3SYS A;  1MM5 A;  5ADX K;  2XTQ A;  3VZU X;  4JFB A;  4E1T A;  3GP6 A;  1BH3 A;  4AYI D;  1ZHY A;  4G76 A;  3UU2 A;  3RBH A;  3EMN X;  3TZG A;  3UAQ A;  4FUV A;  4O4U A;  1Q9G A;  5JDP A;  2XE3 A;  4FT6 A;  3DA4 A;  1PHO A;  2W81 C;  2KZ7 B;  2OMF A;  5DL7 A;  4LSI A;  2PRN A;  2XE5 A;  1OSM A;  3AA1 A;  1Q9F A;  3V8U A;  4JCH A;  3HWB A;  4N59 A;  1GFM A;  2Y0H A;  4FZM A;  2LHF A;  2ODJ A;  4KR8 A;  3O0E A;  3LK4 2;  3LK2 A;  1H6S 1;  2F1V A;  2J1N A;  4FSO A;  4O4X A;  4B61 A;  4F4B A;  2W80 C;  1E54 A;  1ORM A;  3HOL A;  2J4U P;  3SY7 A;  4O3W A;  3PRN A;  1OPF A;  1GFN A;  3QRA A;  4PUX A;  3WI5 A;  1IZN B;  3K19 A;  5DL8 A;  4XNL A;  2XG6 A;  3AAA B;  3QRC A;  2YPV A;  4RLB A;  2MNH A;  4FES A;  4RJX A;  2POR A;  5FVN A;  4KRA A;  4O3X B;  2YNK A;  4GF4 A;  3AA6 A;  1BT9 A;  4D5U A;  3SZV A;  4Z3T A;  4RL9 A;  3NSG A;  4LSE A;  1QJP A;  2FGQ X;  2XE2 A;  1THQ A;  2ZLD A;  4FSP A;  3VY8 X;  4AKR B;  2O4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...