2J4UP

E.coli ompc - camel lactoferrin complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
346
structure length
337
Chain Sequence
b'AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OUTER MEMBRANE PROTEIN C PRECURSOR
publication title Crystal Structure of the Membrane Protein Ompc Complex with Antibacterial Lactoferrin
rcsb
molecule tags Membrane protein/hydrolase
total genus 70
structure length 337
sequence length 346
chains with identical sequence Q, R, U, V, W
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2j4uP00
1BT9A 1OSMA 2J1NA 2FGQX 4FOZA 2FGRA 3SYBA 3SZDA 6PRNA 2Y0HA 3JTYA 3SY9A 4D64A 5DL7A 2PORA 5PRNA 2XE2A 3HW9A 2XE5A 3T0SA 4FT6A 4LSFA 5DL8A 4C69X 4GCPA 1GFMA 1GFOA 4FMSA 1BH3A 3EMNX 3PRNA 7PRNA 5JDPA 3UPGA 4FSOA 3FYXA 1H6S1 3UU2A 1GFQA 5DL6A 4D5UA 3SZVA 4RJWA 4LSEA 4FSPA 3VZUX 3VY9X 4KR4A 1GFPA 3VZWX 3WI5A 4JFBA 2XG6A 8PRNA 3NSGA 1E54A 1PRNA 4GCQA 2XE3A 3POUA 4KRAA 3A2SX 2ZFGA 3VY8X 2PRNA 3POQA 1MPFA 2Y0KA 2K4TA 3POXA 2ODJA 1HXXA 2Y2XA 4GCSA 3T24A 4KR8A 4LSIA 3VZTX 1PHOA 3SY7A 1HXTA 4FRXA 3T20A 4AUIA 4BUMX 4FRTA 2J4UP 3K19A 2OMFA 5FVNA 4RJXA 2ZLDA 3O0EA 3PORA 3SYSA 4LSHA 3WI4A 1GFNA 2Y0LA 2O4VA 2XE1A 2QTKA 1OPFA 1HXUA 4D65A 3HWBA 5DL5A
chains in the Genus database with same CATH superfamily
1BT9A 1OSMA 2J1NA 2FGQX 3BS0A 3KZIO 4IL6O 2X9KA 3DWNA 3BRYA 3HOLA 4FOZA 3QRAA 2GE4A 3JCUO 3LK2B 2FGRA 4QQ1A 3SYBA 4AKRB 1P4TA 3PGRA 3SZDA 6PRNA 2Y0HA 3JTYA 3SY9A 4RLCA 4D64A 2F1VA 4O4UA 5DL7A 5AFUK 4FZLA 2PORA 1QJPA 2XE2A 2KDYA 3HW9A 5G39A 2XE5A 2WJRA 4FUVA 5PRNA 1Q9FA 4FT6A 2XMXA 3T0SA 4AKMA 1THQA 4E1TA 2XTRA 2W81C 3DA3A 4LSFA 5DL8A 1IZNA 3AA7A 4FQEA 5TISO 5B66O 4RL9A 3AAEB 4C69X 1ZHZA 2IWVA 2R8AA 3LK3B 3NJTA 4GCPA 1GFMA 1GFOA 3C5OA 4C4VA 4FMSA 2MHLA 1IZNB 3AA7B 3DA4A 4K3BA 5AFUL 4RLBA 1BH3A 3EMNX 3PRNA 4G76A 3AAAA 4Z3TA 2YPVA 1ZHYA 4AYID 7PRNA 3AA0A 2ERVA 2AXTO 5JDPA 3UPGA 4FSOA 3LK42 2Y7SA 3AA1B 4XNKA 3FYXA 1H6S1 3AAAB 4CTDA 3PGUA 3UU2A 5B5EO 4U9CA 3AA0B 3V8UA 4O49A 1GFQA 5DL6A 4D5UA 3VE2A 3KVDD 4O3ZA 2R4OA 4K3CA 5GTIO 2KZ7A 3GP6A 2JQYA 4FZMA 3SZVA 4RJWA 2WJQA 4LSEA 2N2MA 4FSPA 3PQSA 3VZUX 2KZ7B 3A0BO 3VY9X 4KR4A 4PR7A 1GFPA 3VZWX 3BRZA 2WVPA 4O3XB 4AYNA 4E1SA 1ZHTA 5ADXK 4N59A 4FESA 3WI5A 2LFUA 4JFBA 4C00A 4D65A 3A0HO 2F1TA 4UB8O 2K0LA 5IYUA 2JMMA 4C4VB 2XG6A 8PRNA 3NSGA 1E54A 2LHFA 2XTQA 4GF4A 4N74A 1ZHWA 1PRNA 4GCQA 2YNKA 4O3YA 2M06A 4AFKA 5ADXL 3DZMA 2XE3A 3POUA 4FZNA 5G3AA 2KXPA 5G26A 4KRAA 3A2SX 2R89A 4N58A 3AA6A 2KXPB 5T5FA 2ZFGA 4B61A 1BXWA 3PF1A 3VY8X 4F4BA 2PRNA 4O4XA 3WU2O 5KAFO 4UB6O 1T1LA 2X27X 2KC0A 3POQA 1MPFA 2Y0KA 5G38A 1G90A 2K4TA 3POXA 2ODJA 1Q9GA 2R88A 1HXXA 2N2LA 5E79O 1ZHXA 3LK2A 1YS5A 2Y2XA 1ORMA 4GCSA 4AKRA 4N75A 4PUXA 2F1CX 3RBHA 3T24A 2R4LA 3QRCA 4KR8A 4LSIA 1QJ9A 5GV0A 4AZLA 3VZTX 3PGSA 1PHOA 3SY7A 1HXTA 3UAQA 4FRXA 3T20A 4AUIA 4BUMX 2R4PA 4FRTA 3HOEA 2J4UP 3K19A 3G7GA 1MM5A 2OMFA 3AAEA 5FVNA 4AYDC 3LK3A 1S5LO 2MNHA 5EE2A 4RJXA 5GTHO 1QJ8A 2W80C 3VE1A 2ZLDA 3O0EA 3PORA 3PQUA 2IWWA 5D5DA 2R4NA 4O3WA 3SYSA 4LSHA 3WI4A 4AYMC 5H2FO 4GHBA 4JCHA 1GFNA 2Y0LA 3LK41 4XNLA 3AA6B 1T16A 2O4VA 3AA1A 2XE1A 5KAIO 3TZGA 4PJ0O 2QTKA 1OPFA 3DWOX 2M07A 1MM4A 1HXUA 4G75A 4AYEC 3HWBA 5DL5A
chains in the Genus database with same CATH topology
1BT9A 1OSMA 2J1NA 2FGQX 3HOLA 4FOZA 3QRAA 2GE4A 3LK2B 4QQ1A 2FGRA 3SYBA 4AKRB 1P4TA 3SZDA 6PRNA 2Y0HA 3JTYA 3SY9A 4RLCA 4D64A 2F1VA 4O4UA 5DL7A 5AFUK 4FZLA 2PORA 1QJPA 2XE2A 2KDYA 3HW9A 5PRNA 2XE5A 3T0SA 4FUVA 4AFKA 1Q9FA 4FT6A 2XMXA 4AKMA 4E1TA 1THQA 2XTRA 2W81C 3DA3A 4LSFA 5DL8A 1IZNA 3AA7A 4RL9A 3AAEB 4C69X 1ZHZA 3LK3B 4GCPA 1GFMA 1GFOA 3C5OA 4FMSA 2MHLA 1IZNB 3AA7B 3DA4A 5AFUL 4RLBA 1BH3A 3EMNX 3PRNA 4G76A 3AAAA 4Z3TA 2YPVA 1ZHYA 4AYID 7PRNA 3AA0A 2ERVA 5JDPA 3UPGA 4FSOA 3LK42 2Y7SA 3AA1B 4XNKA 3FYXA 1H6S1 3AAAB 3UU2A 4U9CA 3AA0B 3V8UA 4O49A 1GFQA 5DL6A 4D5UA 3VE2A 3KVDD 4O3ZA 2KZ7A 3GP6A 4FZMA 3SZVA 4RJWA 4LSEA 2N2MA 4FSPA 3PQSA 3VZUX 2KZ7B 3VY9X 4KR4A 4AYNA 1GFPA 3VZWX 4E1SA 4O3XB 5ADXK 1ZHTA 4N59A 4FESA 3WI5A 2LFUA 4JFBA 4D65A 2F1TA 5IYUA 2K0LA 2JMMA 2XG6A 8PRNA 3NSGA 1E54A 2LHFA 2XTQA 4GF4A 1ZHWA 1PRNA 4GCQA 2YNKA 4O3YA 2M06A 5ADXL 2XE3A 3POUA 4FZNA 2KXPA 5G26A 4KRAA 3A2SX 4N58A 3AA6A 2KXPB 5T5FA 2ZFGA 4B61A 1BXWA 3VY8X 4F4BA 2PRNA 4O4XA 2X27X 2KC0A 3POQA 1MPFA 2Y0KA 1G90A 2K4TA 3POXA 2ODJA 1Q9GA 1HXXA 2N2LA 1ZHXA 3LK2A 1YS5A 2Y2XA 1ORMA 4GCSA 4AKRA 3T24A 4PUXA 3RBHA 3QRCA 4KR8A 4LSIA 1QJ9A 5GV0A 4AZLA 3VZTX 1PHOA 3SY7A 1HXTA 3UAQA 4FRXA 3T20A 4AUIA 4BUMX 4FRTA 3HOEA 2J4UP 3K19A 3G7GA 1MM5A 2OMFA 3AAEA 5FVNA 4AYDC 3LK3A 2MNHA 5EE2A 4RJXA 1QJ8A 2W80C 3VE1A 2ZLDA 3O0EA 3PORA 3PQUA 5D5DA 4O3WA 3SYSA 4LSHA 3WI4A 4AYMC 4GHBA 4JCHA 1GFNA 2Y0LA 3LK41 4XNLA 3AA6B 2O4VA 3AA1A 2XE1A 3TZGA 2QTKA 1OPFA 2M07A 1MM4A 1HXUA 4G75A 4AYEC 3HWBA 5DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT9 A;  1OSM A;  2J1N A;  2FGQ X;  4FOZ A;  2FGR A;  3SYB A;  3SZD A;  6PRN A;  2Y0H A;  3JTY A;  3SY9 A;  4D64 A;  5DL7 A;  2POR A;  5PRN A;  2XE2 A;  3HW9 A;  2XE5 A;  3T0S A;  4FT6 A;  4LSF A;  5DL8 A;  4C69 X;  4GCP A;  1GFM A;  1GFO A;  4FMS A;  1BH3 A;  3EMN X;  3PRN A;  7PRN A;  5JDP A;  3UPG A;  4FSO A;  3FYX A;  1H6S 1;  3UU2 A;  1GFQ A;  5DL6 A;  4D5U A;  3SZV A;  4RJW A;  4LSE A;  4FSP A;  3VZU X;  3VY9 X;  4KR4 A;  1GFP A;  3VZW X;  3WI5 A;  4JFB A;  2XG6 A;  8PRN A;  3NSG A;  1E54 A;  1PRN A;  4GCQ A;  2XE3 A;  3POU A;  4KRA A;  3A2S X;  2ZFG A;  3VY8 X;  2PRN A;  3POQ A;  1MPF A;  2Y0K A;  2K4T A;  3POX A;  2ODJ A;  1HXX A;  2Y2X A;  4GCS A;  3T24 A;  4KR8 A;  4LSI A;  3VZT X;  1PHO A;  3SY7 A;  1HXT A;  4FRX A;  3T20 A;  4AUI A;  4BUM X;  4FRT A;  2J4U P;  3K19 A;  2OMF A;  5FVN A;  4RJX A;  2ZLD A;  3O0E A;  3POR A;  3SYS A;  4LSH A;  3WI4 A;  1GFN A;  2Y0L A;  2O4V A;  2XE1 A;  2QTK A;  1OPF A;  1HXU A;  4D65 A;  3HWB A;  5DL5 A; 
#chains in the Genus database with same CATH topology
 1BT9 A;  1OSM A;  2J1N A;  2FGQ X;  3BS0 A;  3KZI O;  4IL6 O;  2X9K A;  3DWN A;  3BRY A;  3HOL A;  4FOZ A;  3QRA A;  2GE4 A;  3JCU O;  3LK2 B;  2FGR A;  4QQ1 A;  3SYB A;  4AKR B;  1P4T A;  3PGR A;  3SZD A;  6PRN A;  2Y0H A;  3JTY A;  3SY9 A;  4RLC A;  4D64 A;  2F1V A;  4O4U A;  5DL7 A;  5AFU K;  4FZL A;  2POR A;  1QJP A;  2XE2 A;  2KDY A;  3HW9 A;  5G39 A;  2XE5 A;  2WJR A;  4FUV A;  5PRN A;  1Q9F A;  4FT6 A;  2XMX A;  3T0S A;  4AKM A;  1THQ A;  4E1T A;  2XTR A;  2W81 C;  3DA3 A;  4LSF A;  5DL8 A;  1IZN A;  3AA7 A;  4FQE A;  5TIS O;  5B66 O;  4RL9 A;  3AAE B;  4C69 X;  1ZHZ A;  2IWV A;  2R8A A;  3LK3 B;  3NJT A;  4GCP A;  1GFM A;  1GFO A;  3C5O A;  4C4V A;  4FMS A;  2MHL A;  1IZN B;  3AA7 B;  3DA4 A;  4K3B A;  5AFU L;  4RLB A;  1BH3 A;  3EMN X;  3PRN A;  4G76 A;  3AAA A;  4Z3T A;  2YPV A;  1ZHY A;  4AYI D;  7PRN A;  3AA0 A;  2ERV A;  2AXT O;  5JDP A;  3UPG A;  4FSO A;  3LK4 2;  2Y7S A;  3AA1 B;  4XNK A;  3FYX A;  1H6S 1;  3AAA B;  4CTD A;  3PGU A;  3UU2 A;  5B5E O;  4U9C A;  3AA0 B;  3V8U A;  4O49 A;  1GFQ A;  5DL6 A;  4D5U A;  3VE2 A;  3KVD D;  4O3Z A;  2R4O A;  4K3C A;  5GTI O;  2KZ7 A;  3GP6 A;  2JQY A;  4FZM A;  3SZV A;  4RJW A;  2WJQ A;  4LSE A;  2N2M A;  4FSP A;  3PQS A;  3VZU X;  2KZ7 B;  3A0B O;  3VY9 X;  4KR4 A;  4PR7 A;  1GFP A;  3VZW X;  3BRZ A;  2WVP A;  4O3X B;  4AYN A;  4E1S A;  1ZHT A;  5ADX K;  4N59 A;  4FES A;  3WI5 A;  2LFU A;  4JFB A;  4C00 A;  4D65 A;  3A0H O;  2F1T A;  4UB8 O;  2K0L A;  5IYU A;  2JMM A;  4C4V B;  2XG6 A;  8PRN A;  3NSG A;  1E54 A;  2LHF A;  2XTQ A;  4GF4 A;  4N74 A;  1ZHW A;  1PRN A;  4GCQ A;  2YNK A;  4O3Y A;  2M06 A;  4AFK A;  5ADX L;  3DZM A;  2XE3 A;  3POU A;  4FZN A;  5G3A A;  2KXP A;  5G26 A;  4KRA A;  3A2S X;  2R89 A;  4N58 A;  3AA6 A;  2KXP B;  5T5F A;  2ZFG A;  4B61 A;  1BXW A;  3PF1 A;  3VY8 X;  4F4B A;  2PRN A;  4O4X A;  3WU2 O;  5KAF O;  4UB6 O;  1T1L A;  2X27 X;  2KC0 A;  3POQ A;  1MPF A;  2Y0K A;  5G38 A;  1G90 A;  2K4T A;  3POX A;  2ODJ A;  1Q9G A;  2R88 A;  1HXX A;  2N2L A;  5E79 O;  1ZHX A;  3LK2 A;  1YS5 A;  2Y2X A;  1ORM A;  4GCS A;  4AKR A;  4N75 A;  4PUX A;  2F1C X;  3RBH A;  3T24 A;  2R4L A;  3QRC A;  4KR8 A;  4LSI A;  1QJ9 A;  5GV0 A;  4AZL A;  3VZT X;  3PGS A;  1PHO A;  3SY7 A;  1HXT A;  3UAQ A;  4FRX A;  3T20 A;  4AUI A;  4BUM X;  2R4P A;  4FRT A;  3HOE A;  2J4U P;  3K19 A;  3G7G A;  1MM5 A;  2OMF A;  3AAE A;  5FVN A;  4AYD C;  3LK3 A;  1S5L O;  2MNH A;  5EE2 A;  4RJX A;  5GTH O;  1QJ8 A;  2W80 C;  3VE1 A;  2ZLD A;  3O0E A;  3POR A;  3PQU A;  2IWW A;  5D5D A;  2R4N A;  4O3W A;  3SYS A;  4LSH A;  3WI4 A;  4AYM C;  5H2F O;  4GHB A;  4JCH A;  1GFN A;  2Y0L A;  3LK4 1;  4XNL A;  3AA6 B;  1T16 A;  2O4V A;  3AA1 A;  2XE1 A;  5KAI O;  3TZG A;  4PJ0 O;  2QTK A;  1OPF A;  3DWO X;  2M07 A;  1MM4 A;  1HXU A;  4G75 A;  4AYE C;  3HWB A;  5DL5 A; 
#chains in the Genus database with same CATH homology
 1BT9 A;  1OSM A;  2J1N A;  2FGQ X;  3HOL A;  4FOZ A;  3QRA A;  2GE4 A;  3LK2 B;  4QQ1 A;  2FGR A;  3SYB A;  4AKR B;  1P4T A;  3SZD A;  6PRN A;  2Y0H A;  3JTY A;  3SY9 A;  4RLC A;  4D64 A;  2F1V A;  4O4U A;  5DL7 A;  5AFU K;  4FZL A;  2POR A;  1QJP A;  2XE2 A;  2KDY A;  3HW9 A;  5PRN A;  2XE5 A;  3T0S A;  4FUV A;  4AFK A;  1Q9F A;  4FT6 A;  2XMX A;  4AKM A;  4E1T A;  1THQ A;  2XTR A;  2W81 C;  3DA3 A;  4LSF A;  5DL8 A;  1IZN A;  3AA7 A;  4RL9 A;  3AAE B;  4C69 X;  1ZHZ A;  3LK3 B;  4GCP A;  1GFM A;  1GFO A;  3C5O A;  4FMS A;  2MHL A;  1IZN B;  3AA7 B;  3DA4 A;  5AFU L;  4RLB A;  1BH3 A;  3EMN X;  3PRN A;  4G76 A;  3AAA A;  4Z3T A;  2YPV A;  1ZHY A;  4AYI D;  7PRN A;  3AA0 A;  2ERV A;  5JDP A;  3UPG A;  4FSO A;  3LK4 2;  2Y7S A;  3AA1 B;  4XNK A;  3FYX A;  1H6S 1;  3AAA B;  3UU2 A;  4U9C A;  3AA0 B;  3V8U A;  4O49 A;  1GFQ A;  5DL6 A;  4D5U A;  3VE2 A;  3KVD D;  4O3Z A;  2KZ7 A;  3GP6 A;  4FZM A;  3SZV A;  4RJW A;  4LSE A;  2N2M A;  4FSP A;  3PQS A;  3VZU X;  2KZ7 B;  3VY9 X;  4KR4 A;  4AYN A;  1GFP A;  3VZW X;  4E1S A;  4O3X B;  5ADX K;  1ZHT A;  4N59 A;  4FES A;  3WI5 A;  2LFU A;  4JFB A;  4D65 A;  2F1T A;  5IYU A;  2K0L A;  2JMM A;  2XG6 A;  8PRN A;  3NSG A;  1E54 A;  2LHF A;  2XTQ A;  4GF4 A;  1ZHW A;  1PRN A;  4GCQ A;  2YNK A;  4O3Y A;  2M06 A;  5ADX L;  2XE3 A;  3POU A;  4FZN A;  2KXP A;  5G26 A;  4KRA A;  3A2S X;  4N58 A;  3AA6 A;  2KXP B;  5T5F A;  2ZFG A;  4B61 A;  1BXW A;  3VY8 X;  4F4B A;  2PRN A;  4O4X A;  2X27 X;  2KC0 A;  3POQ A;  1MPF A;  2Y0K A;  1G90 A;  2K4T A;  3POX A;  2ODJ A;  1Q9G A;  1HXX A;  2N2L A;  1ZHX A;  3LK2 A;  1YS5 A;  2Y2X A;  1ORM A;  4GCS A;  4AKR A;  3T24 A;  4PUX A;  3RBH A;  3QRC A;  4KR8 A;  4LSI A;  1QJ9 A;  5GV0 A;  4AZL A;  3VZT X;  1PHO A;  3SY7 A;  1HXT A;  3UAQ A;  4FRX A;  3T20 A;  4AUI A;  4BUM X;  4FRT A;  3HOE A;  2J4U P;  3K19 A;  3G7G A;  1MM5 A;  2OMF A;  3AAE A;  5FVN A;  4AYD C;  3LK3 A;  2MNH A;  5EE2 A;  4RJX A;  1QJ8 A;  2W80 C;  3VE1 A;  2ZLD A;  3O0E A;  3POR A;  3PQU A;  5D5D A;  4O3W A;  3SYS A;  4LSH A;  3WI4 A;  4AYM C;  4GHB A;  4JCH A;  1GFN A;  2Y0L A;  3LK4 1;  4XNL A;  3AA6 B;  2O4V A;  3AA1 A;  2XE1 A;  3TZG A;  2QTK A;  1OPF A;  2M07 A;  1MM4 A;  1HXU A;  4G75 A;  4AYE C;  3HWB A;  5DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...