4D5UA

Structure of ompf in i2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Two Different Centered Monoclinic Crystals of the E. Coli Outer-Membrane Protein Ompf Originate from the Same Building Block.
pubmed doi rcsb
molecule tags Structural protein
total genus 94
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d5uA00
4FRTA 2O4VA 4KR4A 3T24A 4D65A 7PRNA 2XG6A 1HXTA 3UU2A 2J4UP 1MPFA 1GFPA 3JTYA 4GCSA 4KRAA 3WI5A 3POUA 2Y0LA 4RJWA 1PHOA 4JFBA 1GFMA 1OSMA 5DL8A 5PRNA 3K19A 2Y0KA 3POQA 2QTKA 3VY8X 1BH3A 3HW9A 1GFNA 1OPFA 6PRNA 3VZWX 2XE3A 3VZUX 2PRNA 3SY9A 2ODJA 4D64A 5DL5A 5JDPA 2ZFGA 3UPGA 1PRNA 2OMFA 2XE1A 4LSEA 3WI4A 2J1NA 3SZDA 2FGQX 4KR8A 3FYXA 4BUMX 2Y2XA 3SY7A 2Y0HA 4FSOA 4GCPA 4LSFA 3PRNA 4C69X 3VY9X 3A2SX 3PORA 2K4TA 4FMSA 4FSPA 1HXUA 3POXA 3T0SA 4AUIA 4FRXA 1HXXA 4D5UA 1BT9A 5DL7A 5DL6A 3SYSA 3T20A 3HWBA 1GFQA 2ZLDA 5FVNA 3SZVA 1H6S1 1E54A 2XE5A 4RJXA 2FGRA 3O0EA 4FOZA 8PRNA 3SYBA 3EMNX 4LSIA 2XE2A 1GFOA 4LSHA 4FT6A 3VZTX 2PORA 3NSGA 4GCQA
chains in the Genus database with same CATH superfamily
1T16A 4FESA 2R4OA 5G3AA 4FRTA 2O4VA 3QRCA 2R4NA 4KR4A 3T24A 5ADXL 4D65A 1MM4A 2XTRA 3TZGA 2R88A 7PRNA 2GE4A 4CTDA 4AFKA 2XG6A 1HXTA 3DWOX 4O4UA 3UU2A 1IZNB 5GV0A 5EE2A 3AA7A 2J4UP 1MPFA 4JCHA 3DWNA 1GFPA 1QJPA 2W81C 2WJQA 2M06A 3JTYA 5GTHO 4GCSA 4KRAA 4XNLA 3WI5A 4FUVA 4O3ZA 2R4LA 3POUA 4U9CA 3V8UA 2AXTO 1BXWA 2Y0LA 3PGSA 4O49A 5AFUK 2KZ7B 3A0HO 4RJWA 3AAEB 4O3WA 4GCQA 4O3XB 5AFUL 3WU2O 3PGRA 1ZHTA 1PHOA 4JFBA 2MNHA 3UPGA 4XNKA 4N74A 1GFMA 1ZHZA 1OSMA 3LK2A 3UAQA 5DL8A 5PRNA 5G26A 3K19A 3PQSA 2Y0KA 4K3BA 4AZLA 4AYMC 4E1TA 3AA0B 3HOEA 2WJRA 3DA3A 4RL9A 4PUXA 3POQA 4Z3TA 2QTKA 3VY8X 1BH3A 3HW9A 4QQ1A 1ZHXA 4GF4A 4N75A 1GFNA 4AKRA 1OPFA 4AYEC 6PRNA 3VZWX 2XE3A 3VZUX 2PRNA 3SY9A 3AAAB 3NJTA 2ODJA 4D64A 2Y7SA 4RLBA 5DL5A 3A0BO 5JDPA 4B61A 2ZFGA 2IWWA 3VE2A 1PRNA 1Q9GA 4F4BA 2KXPB 1IZNA 2OMFA 4G75A 2R8AA 2XE1A 4LSEA 3WI4A 1P4TA 3G7GA 3JCUO 2J1NA 4C4VB 2M07A 3AA1B 4UB8O 3SZDA 3AA6B 1YS5A 4C00A 4AYDC 2FGQX 2WVPA 4KR8A 4O4XA 2KC0A 2N2LA 2N2MA 2Y2XA 3C5OA 3FYXA 3BRZA 2Y0HA 4FZMA 3SY7A 4FSOA 3LK3B 4FQEA 4FZNA 4GCPA 4IL6O 5G38A 4LSFA 3DZMA 1QJ8A 4RLCA 2KZ7A 3PRNA 2KXPA 4UB6O 3AAEA 5GTIO 3BRYA 1MM5A 3LK42 2F1VA 3PGUA 3VY9X 4C69X 2K0LA 2F1CX 2XTQA 3A2SX 2K4TA 3GP6A 3PORA 3PQUA 4FMSA 5G39A 4FZLA 2YPVA 3LK41 4FSPA 2LHFA 3VE1A 1S5LO 3AA7B 1ORMA 2JQYA 3AA6A 4K3CA 4AKMA 1HXUA 4BUMX 3POXA 3T0SA 5B66O 5T5FA 4AUIA 3PF1A 3LK3A 4FRXA 3AA0A 1HXXA 4D5UA 1BT9A 5DL7A 1ZHYA 5DL6A 3SYSA 3KZIO 4AYNA 3T20A 1ZHWA 1QJ9A 3HWBA 2IWVA 3QRAA 2X27X 3RBHA 5IYUA 1GFQA 2ZLDA 5FVNA 3AAAA 1H6S1 1T1LA 3SZVA 1E54A 2XE5A 8PRNA 2XMXA 1G90A 4RJXA 2X9KA 2FGRA 3O0EA 4FOZA 2YNKA 2JMMA 4O3YA 2R4PA 2R89A 2F1TA 3DA4A 3SYBA 3BS0A 3EMNX 4AYID 5B5EO 3KVDD 3LK2B 3HOLA 4E1SA 4LSIA 5KAFO 2W80C 2ERVA 4G76A 2XE2A 4N58A 5KAIO 4C4VA 3AA1A 2MHLA 2KDYA 1GFOA 4GHBA 4PJ0O 4PR7A 4LSHA 5H2FO 4FT6A 3VZTX 2LFUA 2PORA 5D5DA 4AKRB 5E79O 5TISO 1THQA 3NSGA 5ADXK 1Q9FA 4N59A
chains in the Genus database with same CATH topology
4FESA 4FRTA 2O4VA 3QRCA 4KR4A 5ADXL 3T24A 4D65A 1MM4A 2XTRA 3TZGA 7PRNA 2GE4A 4AFKA 2XG6A 1HXTA 4O4UA 3UU2A 5GV0A 1IZNB 5EE2A 3AA7A 2J4UP 1MPFA 4JCHA 1GFPA 1QJPA 2W81C 3JTYA 2M06A 4GCSA 4KRAA 4XNLA 3WI5A 4FUVA 4O3ZA 3POUA 4U9CA 3V8UA 1BXWA 2Y0LA 4O49A 5AFUK 2KZ7B 4RJWA 3AAEB 4O3WA 4GCQA 4O3XB 5AFUL 1ZHTA 1PHOA 4JFBA 2MNHA 4XNKA 3UAQA 1GFMA 1ZHZA 1OSMA 3LK2A 5DL8A 5PRNA 5G26A 3K19A 3PQSA 2Y0KA 4AZLA 4AYMC 4E1TA 3AA0B 3HOEA 3DA3A 4RL9A 4PUXA 3POQA 4Z3TA 2QTKA 3VY8X 1BH3A 3HW9A 4QQ1A 1ZHXA 4GF4A 4AKRA 1GFNA 1OPFA 4AYEC 6PRNA 3VZWX 2XE3A 3VZUX 2PRNA 3SY9A 3AAAB 2ODJA 4D64A 2Y7SA 4RLBA 5DL5A 5JDPA 4B61A 2ZFGA 3VE2A 1PRNA 1Q9GA 4F4BA 2KXPB 1IZNA 2OMFA 4G75A 3UPGA 2XE1A 4LSEA 3WI4A 1P4TA 3G7GA 2J1NA 2M07A 3AA1B 3SZDA 3AA6B 1YS5A 4AYDC 2FGQX 4KR8A 4O4XA 2KC0A 2N2LA 2N2MA 2Y2XA 3C5OA 3FYXA 4FZMA 2Y0HA 3SY7A 4BUMX 4FSOA 3LK3B 4GCPA 4FZNA 4LSFA 1QJ8A 4RLCA 2KZ7A 3PRNA 2KXPA 3AAEA 4C69X 3VY9X 1MM5A 3LK42 2F1VA 2K0LA 2XTQA 3A2SX 3GP6A 2K4TA 3PORA 3PQUA 4FMSA 4FZLA 2YPVA 3LK41 4FSPA 2LHFA 3VE1A 3AA6A 3AA7B 1ORMA 4AKMA 1HXUA 3POXA 3T0SA 5T5FA 4AUIA 3LK3A 4FRXA 3AA0A 1HXXA 4D5UA 1BT9A 5DL7A 1ZHYA 5DL6A 3SYSA 3T20A 4AYNA 1ZHWA 1QJ9A 3HWBA 3QRAA 2X27X 3RBHA 5IYUA 1GFQA 2ZLDA 5FVNA 3AAAA 1H6S1 3SZVA 1E54A 2XE5A 1G90A 2XMXA 4RJXA 2FGRA 3O0EA 4FOZA 2YNKA 2JMMA 4O3YA 3DA4A 3SYBA 2F1TA 8PRNA 3EMNX 4AYID 3KVDD 3LK2B 3HOLA 4E1SA 4LSIA 2W80C 2ERVA 4G76A 2XE2A 4N58A 3AA1A 2MHLA 2KDYA 1GFOA 4GHBA 4LSHA 4FT6A 3VZTX 2LFUA 2PORA 5D5DA 4AKRB 1THQA 3NSGA 5ADXK 1Q9FA 4N59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRT A;  2O4V A;  4KR4 A;  3T24 A;  4D65 A;  7PRN A;  2XG6 A;  1HXT A;  3UU2 A;  2J4U P;  1MPF A;  1GFP A;  3JTY A;  4GCS A;  4KRA A;  3WI5 A;  3POU A;  2Y0L A;  4RJW A;  1PHO A;  4JFB A;  1GFM A;  1OSM A;  5DL8 A;  5PRN A;  3K19 A;  2Y0K A;  3POQ A;  2QTK A;  3VY8 X;  1BH3 A;  3HW9 A;  1GFN A;  1OPF A;  6PRN A;  3VZW X;  2XE3 A;  3VZU X;  2PRN A;  3SY9 A;  2ODJ A;  4D64 A;  5DL5 A;  5JDP A;  2ZFG A;  3UPG A;  1PRN A;  2OMF A;  2XE1 A;  4LSE A;  3WI4 A;  2J1N A;  3SZD A;  2FGQ X;  4KR8 A;  3FYX A;  4BUM X;  2Y2X A;  3SY7 A;  2Y0H A;  4FSO A;  4GCP A;  4LSF A;  3PRN A;  4C69 X;  3VY9 X;  3A2S X;  3POR A;  2K4T A;  4FMS A;  4FSP A;  1HXU A;  3POX A;  3T0S A;  4AUI A;  4FRX A;  1HXX A;  4D5U A;  1BT9 A;  5DL7 A;  5DL6 A;  3SYS A;  3T20 A;  3HWB A;  1GFQ A;  2ZLD A;  5FVN A;  3SZV A;  1H6S 1;  1E54 A;  2XE5 A;  4RJX A;  2FGR A;  3O0E A;  4FOZ A;  8PRN A;  3SYB A;  3EMN X;  4LSI A;  2XE2 A;  1GFO A;  4LSH A;  4FT6 A;  3VZT X;  2POR A;  3NSG A;  4GCQ A; 
#chains in the Genus database with same CATH topology
 1T16 A;  4FES A;  2R4O A;  5G3A A;  4FRT A;  2O4V A;  3QRC A;  2R4N A;  4KR4 A;  3T24 A;  5ADX L;  4D65 A;  1MM4 A;  2XTR A;  3TZG A;  2R88 A;  7PRN A;  2GE4 A;  4CTD A;  4AFK A;  2XG6 A;  1HXT A;  3DWO X;  4O4U A;  3UU2 A;  1IZN B;  5GV0 A;  5EE2 A;  3AA7 A;  2J4U P;  1MPF A;  4JCH A;  3DWN A;  1GFP A;  1QJP A;  2W81 C;  2WJQ A;  2M06 A;  3JTY A;  5GTH O;  4GCS A;  4KRA A;  4XNL A;  3WI5 A;  4FUV A;  4O3Z A;  2R4L A;  3POU A;  4U9C A;  3V8U A;  2AXT O;  1BXW A;  2Y0L A;  3PGS A;  4O49 A;  5AFU K;  2KZ7 B;  3A0H O;  4RJW A;  3AAE B;  4O3W A;  4GCQ A;  4O3X B;  5AFU L;  3WU2 O;  3PGR A;  1ZHT A;  1PHO A;  4JFB A;  2MNH A;  3UPG A;  4XNK A;  4N74 A;  1GFM A;  1ZHZ A;  1OSM A;  3LK2 A;  3UAQ A;  5DL8 A;  5PRN A;  5G26 A;  3K19 A;  3PQS A;  2Y0K A;  4K3B A;  4AZL A;  4AYM C;  4E1T A;  3AA0 B;  3HOE A;  2WJR A;  3DA3 A;  4RL9 A;  4PUX A;  3POQ A;  4Z3T A;  2QTK A;  3VY8 X;  1BH3 A;  3HW9 A;  4QQ1 A;  1ZHX A;  4GF4 A;  4N75 A;  1GFN A;  4AKR A;  1OPF A;  4AYE C;  6PRN A;  3VZW X;  2XE3 A;  3VZU X;  2PRN A;  3SY9 A;  3AAA B;  3NJT A;  2ODJ A;  4D64 A;  2Y7S A;  4RLB A;  5DL5 A;  3A0B O;  5JDP A;  4B61 A;  2ZFG A;  2IWW A;  3VE2 A;  1PRN A;  1Q9G A;  4F4B A;  2KXP B;  1IZN A;  2OMF A;  4G75 A;  2R8A A;  2XE1 A;  4LSE A;  3WI4 A;  1P4T A;  3G7G A;  3JCU O;  2J1N A;  4C4V B;  2M07 A;  3AA1 B;  4UB8 O;  3SZD A;  3AA6 B;  1YS5 A;  4C00 A;  4AYD C;  2FGQ X;  2WVP A;  4KR8 A;  4O4X A;  2KC0 A;  2N2L A;  2N2M A;  2Y2X A;  3C5O A;  3FYX A;  3BRZ A;  2Y0H A;  4FZM A;  3SY7 A;  4FSO A;  3LK3 B;  4FQE A;  4FZN A;  4GCP A;  4IL6 O;  5G38 A;  4LSF A;  3DZM A;  1QJ8 A;  4RLC A;  2KZ7 A;  3PRN A;  2KXP A;  4UB6 O;  3AAE A;  5GTI O;  3BRY A;  1MM5 A;  3LK4 2;  2F1V A;  3PGU A;  3VY9 X;  4C69 X;  2K0L A;  2F1C X;  2XTQ A;  3A2S X;  2K4T A;  3GP6 A;  3POR A;  3PQU A;  4FMS A;  5G39 A;  4FZL A;  2YPV A;  3LK4 1;  4FSP A;  2LHF A;  3VE1 A;  1S5L O;  3AA7 B;  1ORM A;  2JQY A;  3AA6 A;  4K3C A;  4AKM A;  1HXU A;  4BUM X;  3POX A;  3T0S A;  5B66 O;  5T5F A;  4AUI A;  3PF1 A;  3LK3 A;  4FRX A;  3AA0 A;  1HXX A;  4D5U A;  1BT9 A;  5DL7 A;  1ZHY A;  5DL6 A;  3SYS A;  3KZI O;  4AYN A;  3T20 A;  1ZHW A;  1QJ9 A;  3HWB A;  2IWV A;  3QRA A;  2X27 X;  3RBH A;  5IYU A;  1GFQ A;  2ZLD A;  5FVN A;  3AAA A;  1H6S 1;  1T1L A;  3SZV A;  1E54 A;  2XE5 A;  8PRN A;  2XMX A;  1G90 A;  4RJX A;  2X9K A;  2FGR A;  3O0E A;  4FOZ A;  2YNK A;  2JMM A;  4O3Y A;  2R4P A;  2R89 A;  2F1T A;  3DA4 A;  3SYB A;  3BS0 A;  3EMN X;  4AYI D;  5B5E O;  3KVD D;  3LK2 B;  3HOL A;  4E1S A;  4LSI A;  5KAF O;  2W80 C;  2ERV A;  4G76 A;  2XE2 A;  4N58 A;  5KAI O;  4C4V A;  3AA1 A;  2MHL A;  2KDY A;  1GFO A;  4GHB A;  4PJ0 O;  4PR7 A;  4LSH A;  5H2F O;  4FT6 A;  3VZT X;  2LFU A;  2POR A;  5D5D A;  4AKR B;  5E79 O;  5TIS O;  1THQ A;  3NSG A;  5ADX K;  1Q9F A;  4N59 A; 
#chains in the Genus database with same CATH homology
 4FES A;  4FRT A;  2O4V A;  3QRC A;  4KR4 A;  5ADX L;  3T24 A;  4D65 A;  1MM4 A;  2XTR A;  3TZG A;  7PRN A;  2GE4 A;  4AFK A;  2XG6 A;  1HXT A;  4O4U A;  3UU2 A;  5GV0 A;  1IZN B;  5EE2 A;  3AA7 A;  2J4U P;  1MPF A;  4JCH A;  1GFP A;  1QJP A;  2W81 C;  3JTY A;  2M06 A;  4GCS A;  4KRA A;  4XNL A;  3WI5 A;  4FUV A;  4O3Z A;  3POU A;  4U9C A;  3V8U A;  1BXW A;  2Y0L A;  4O49 A;  5AFU K;  2KZ7 B;  4RJW A;  3AAE B;  4O3W A;  4GCQ A;  4O3X B;  5AFU L;  1ZHT A;  1PHO A;  4JFB A;  2MNH A;  4XNK A;  3UAQ A;  1GFM A;  1ZHZ A;  1OSM A;  3LK2 A;  5DL8 A;  5PRN A;  5G26 A;  3K19 A;  3PQS A;  2Y0K A;  4AZL A;  4AYM C;  4E1T A;  3AA0 B;  3HOE A;  3DA3 A;  4RL9 A;  4PUX A;  3POQ A;  4Z3T A;  2QTK A;  3VY8 X;  1BH3 A;  3HW9 A;  4QQ1 A;  1ZHX A;  4GF4 A;  4AKR A;  1GFN A;  1OPF A;  4AYE C;  6PRN A;  3VZW X;  2XE3 A;  3VZU X;  2PRN A;  3SY9 A;  3AAA B;  2ODJ A;  4D64 A;  2Y7S A;  4RLB A;  5DL5 A;  5JDP A;  4B61 A;  2ZFG A;  3VE2 A;  1PRN A;  1Q9G A;  4F4B A;  2KXP B;  1IZN A;  2OMF A;  4G75 A;  3UPG A;  2XE1 A;  4LSE A;  3WI4 A;  1P4T A;  3G7G A;  2J1N A;  2M07 A;  3AA1 B;  3SZD A;  3AA6 B;  1YS5 A;  4AYD C;  2FGQ X;  4KR8 A;  4O4X A;  2KC0 A;  2N2L A;  2N2M A;  2Y2X A;  3C5O A;  3FYX A;  4FZM A;  2Y0H A;  3SY7 A;  4BUM X;  4FSO A;  3LK3 B;  4GCP A;  4FZN A;  4LSF A;  1QJ8 A;  4RLC A;  2KZ7 A;  3PRN A;  2KXP A;  3AAE A;  4C69 X;  3VY9 X;  1MM5 A;  3LK4 2;  2F1V A;  2K0L A;  2XTQ A;  3A2S X;  3GP6 A;  2K4T A;  3POR A;  3PQU A;  4FMS A;  4FZL A;  2YPV A;  3LK4 1;  4FSP A;  2LHF A;  3VE1 A;  3AA6 A;  3AA7 B;  1ORM A;  4AKM A;  1HXU A;  3POX A;  3T0S A;  5T5F A;  4AUI A;  3LK3 A;  4FRX A;  3AA0 A;  1HXX A;  4D5U A;  1BT9 A;  5DL7 A;  1ZHY A;  5DL6 A;  3SYS A;  3T20 A;  4AYN A;  1ZHW A;  1QJ9 A;  3HWB A;  3QRA A;  2X27 X;  3RBH A;  5IYU A;  1GFQ A;  2ZLD A;  5FVN A;  3AAA A;  1H6S 1;  3SZV A;  1E54 A;  2XE5 A;  1G90 A;  2XMX A;  4RJX A;  2FGR A;  3O0E A;  4FOZ A;  2YNK A;  2JMM A;  4O3Y A;  3DA4 A;  3SYB A;  2F1T A;  8PRN A;  3EMN X;  4AYI D;  3KVD D;  3LK2 B;  3HOL A;  4E1S A;  4LSI A;  2W80 C;  2ERV A;  4G76 A;  2XE2 A;  4N58 A;  3AA1 A;  2MHL A;  2KDY A;  1GFO A;  4GHB A;  4LSH A;  4FT6 A;  3VZT X;  2LFU A;  2POR A;  5D5D A;  4AKR B;  1THQ A;  3NSG A;  5ADX K;  1Q9F A;  4N59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...