4D5UA

Structure of ompf in i2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Centered Monoclinic Crystals of the E. Coli Outer-Membrane Protein Ompf Originate from the Same Building Block.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords OUTER MEMBRANE PROTEIN F
total genus 94
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d5uA00
2PRNA 4JFBA 2XE1A 2J4UP 3T24A 4LSEA 3VY8X 4LSIA 2Y2XA 3POQA 2OMFA 3VY9X 3UPGA 1HXTA 4D64A 3NSGA 3WI4A 3VZWX 4FSPA 3VZUX 5DL5A 2Y0HA 1GFOA 3SZVA 4GCQA 2ZLDA 1GFMA 4FMSA 8PRNA 3T0SA 4C69X 4KRAA 2QTKA 1H6S1 5DL6A 1BT9A 5DL8A 3FYXA 3T20A 4GCPA 3A2SX 1HXUA 4AUIA 2Y0LA 1PRNA 4FRTA 1OSMA 5JDPA 3WI5A 2XE2A 2XG6A 3HW9A 2FGQX 5FVNA 3EMNX 1GFNA 2XE5A 4KR4A 1PHOA 4KR8A 4FSOA 3SZDA 3O0EA 4FRXA 3SYSA 3UU2A 3JTYA 2ODJA 4LSFA 2J1NA 3HWBA 1OPFA 6PRNA 2ZFGA 2O4VA 4D5UA 3SY7A 1GFQA 4FOZA 2K4TA 2XE3A 2PORA 3POXA 3SYBA 7PRNA 4RJXA 4RJWA 1E54A 1BH3A 1HXXA 1MPFA 2Y0KA 3POUA 4GCSA 3PORA 4FT6A 3VZTX 5DL7A 3SY9A 4BUMX 4LSHA 4D65A 3K19A 3PRNA 5PRNA 2FGRA 1GFPA
chains in the Genus database with same CATH superfamily
2PRNA 3LK3B 2R4LA 1T1LA 4JFBA 5ADXK 2XE1A 4GF4A 2KC0A 2XTRA 2F1TA 3VE2A 3T24A 3KZIO 1ZHWA 2J4UP 4LSEA 3VY8X 4LSIA 4PJ0O 4RLCA 2Y2XA 2JQYA 3POQA 2R4OA 4AKRA 5H2FO 2OMFA 3C5OA 3VY9X 4O3YA 4O3ZA 4RLBA 5G39A 4GHBA 1HXTA 4JCHA 3NSGA 4D64A 5GTHO 5B66O 3UPGA 3WI4A 1ORMA 5JDPA 3PQUA 2XMXA 3QRAA 4C4VB 2R89A 3VZWX 4O3WA 5ADXL 4FSPA 3VE1A 3VZUX 4PR7A 1G90A 2WJQA 3GP6A 5DL5A 5TISO 3TZGA 2Y0HA 5GTIO 2LHFA 2WJRA 4O49A 2F1VA 1GFOA 2GE4A 4E1TA 3AAAB 2JMMA 4N59A 3SZVA 1ZHZA 4GCQA 3PQSA 5T5FA 5B5EO 3LK3A 3PF1A 2ZLDA 5AFUL 3AAAA 3PGRA 4FZMA 1GFMA 4FMSA 8PRNA 3T0SA 4C69X 4E1SA 1IZNB 1ZHYA 4O3XB 4KRAA 4C4VA 3AAEB 2QTKA 1H6S1 2MHLA 5DL6A 5G26A 4FZLA 1MM4A 4QQ1A 2YPVA 1MM5A 1BT9A 4IL6O 5DL8A 3FYXA 3T20A 4AFKA 3AA7B 3QRCA 4GCPA 3A2SX 1S5LO 1HXUA 3V8UA 3LK41 4AUIA 2KXPA 2Y0LA 4N58A 1PRNA 4FRTA 1OSMA 1ZHTA 3BS0A 3LK2A 4AKMA 3KVDD 4UB8O 4AYDC 3WI5A 1YS5A 3A0HO 4XNKA 4C00A 2KXPB 1Q9FA 2XE2A 1QJ8A 2XG6A 3G7GA 3HW9A 3NJTA 2FGQX 5FVNA 5GV0A 4CTDA 1GFNA 3EMNX 1BXWA 5AFUK 4N75A 3AA6B 2R88A 2XE5A 1P4TA 2IWVA 2MNHA 1PHOA 3AAEA 2M07A 4KR4A 1ZHXA 4AZLA 4FUVA 4KR8A 4AYID 4FSOA 2R8AA 3A0BO 3AA1A 3AA6A 3JCUO 4N74A 3RBHA 3O0EA 3SZDA 4F4BA 4FRXA 3SY7A 3SYSA 3UU2A 3JTYA 2ODJA 4LSFA 3DA4A 2N2LA 2J1NA 3LK2B 3DA3A 2K0LA 3AA0B 3HWBA 2R4NA 4RL9A 2KZ7B 2X27X 1OPFA 6PRNA 2X9KA 2ZFGA 2O4VA 2WVPA 4PUXA 5E79O 4D5UA 4U9CA 1GFQA 3DZMA 4FZNA 2LFUA 2K4TA 2XE3A 4FOZA 3BRYA 3DWOX 4Z3TA 2PORA 3HOLA 2W81C 4FQEA 3POXA 3SYBA 1IZNA 3PGUA 7PRNA 4G75A 4RJXA 4RJWA 1Q9GA 4K3CA 3UAQA 4AKRB 2KDYA 5G3AA 2KZ7A 1E54A 3AA0A 1BH3A 3HOEA 4FESA 4UB6O 4XNLA 1HXXA 5G38A 1MPFA 2Y0KA 4K3BA 4B61A 5D5DA 2AXTO 2Y7SA 3POUA 4GCSA 5KAFO 3PORA 4FT6A 5KAIO 3VZTX 2M06A 4O4UA 4AYMC 4AYNA 5IYUA 5DL7A 4O4XA 3AA7A 2XTQA 2R4PA 3SY9A 4BUMX 3AA1B 2W80C 1T16A 1THQA 3PGSA 2YNKA 4LSHA 3BRZA 4D65A 3K19A 2N2MA 2F1CX 3PRNA 3WU2O 3LK42 1QJ9A 4AYEC 2IWWA 1QJPA 5EE2A 4G76A 2ERVA 3DWNA 5PRNA 2FGRA 1GFPA
chains in the Genus database with same CATH topology
2PRNA 3LK3B 4JFBA 5ADXK 2XE1A 4GF4A 2KC0A 2XTRA 2F1TA 3VE2A 3T24A 2J4UP 1ZHWA 4LSEA 3VY8X 4LSIA 4RLCA 2Y2XA 3POQA 4AKRA 2OMFA 3C5OA 3VY9X 4O3YA 4O3ZA 4RLBA 3UPGA 4GHBA 1HXTA 4JCHA 3NSGA 4D64A 3WI4A 1ORMA 3PQUA 2XMXA 3QRAA 3VZWX 4O3WA 5ADXL 4FSPA 3VE1A 3VZUX 1G90A 3GP6A 5DL5A 3TZGA 2Y0HA 2LHFA 4O49A 2F1VA 1GFOA 2GE4A 4E1TA 3AAAB 2JMMA 4N59A 3SZVA 1ZHZA 4GCQA 3PQSA 5T5FA 3LK3A 5AFUL 2ZLDA 3AAAA 4FZMA 1GFMA 4FMSA 8PRNA 3T0SA 4C69X 4E1SA 1IZNB 1ZHYA 4O3XB 4KRAA 3AAEB 2QTKA 1H6S1 2MHLA 5DL6A 5G26A 4FZLA 1MM4A 4QQ1A 2YPVA 1MM5A 1BT9A 5DL8A 3FYXA 3T20A 4AFKA 3AA7B 3QRCA 4GCPA 3A2SX 3V8UA 1HXUA 3LK41 4AUIA 2Y0LA 2KXPA 4N58A 1PRNA 4FRTA 1OSMA 1ZHTA 3LK2A 4AKMA 4AYDC 3KVDD 5JDPA 3WI5A 1YS5A 4XNKA 2KXPB 2XG6A 2XE2A 1Q9FA 1QJ8A 3G7GA 3HW9A 2FGQX 5FVNA 5GV0A 1GFNA 3EMNX 1BXWA 5AFUK 3AA6B 2XE5A 1P4TA 2MNHA 3AAEA 1PHOA 4KR4A 2M07A 4AZLA 1ZHXA 4FUVA 4KR8A 4AYID 4FSOA 3AA1A 4F4BA 3AA6A 3SZDA 3RBHA 3O0EA 4FRXA 3SYSA 3UU2A 3JTYA 2ODJA 4LSFA 3DA4A 2N2LA 2J1NA 3LK2B 3DA3A 2K0LA 3AA0B 3HWBA 4RL9A 2KZ7B 2X27X 1OPFA 6PRNA 2ZFGA 2O4VA 4PUXA 4D5UA 4U9CA 1GFQA 4FZNA 3SY7A 2LFUA 2K4TA 2XE3A 4FOZA 4Z3TA 2PORA 3HOLA 2W81C 3POXA 3SYBA 1IZNA 7PRNA 4G75A 4RJXA 4RJWA 1Q9GA 3UAQA 4AKRB 2KDYA 2KZ7A 1E54A 3AA0A 1BH3A 3HOEA 4FESA 4XNLA 1HXXA 1MPFA 2Y0KA 4B61A 5D5DA 2Y7SA 3POUA 4GCSA 3PORA 4FT6A 3VZTX 2M06A 4O4UA 4AYMC 4AYNA 5IYUA 5DL7A 4O4XA 3AA7A 2XTQA 3SY9A 4BUMX 3AA1B 2W80C 1THQA 2YNKA 4LSHA 4D65A 3K19A 2N2MA 3PRNA 4AYEC 3LK42 1QJ9A 1QJPA 5EE2A 4G76A 2ERVA 5PRNA 2FGRA 1GFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRN A;  4JFB A;  2XE1 A;  2J4U P;  3T24 A;  4LSE A;  3VY8 X;  4LSI A;  2Y2X A;  3POQ A;  2OMF A;  3VY9 X;  3UPG A;  1HXT A;  4D64 A;  3NSG A;  3WI4 A;  3VZW X;  4FSP A;  3VZU X;  5DL5 A;  2Y0H A;  1GFO A;  3SZV A;  4GCQ A;  2ZLD A;  1GFM A;  4FMS A;  8PRN A;  3T0S A;  4C69 X;  4KRA A;  2QTK A;  1H6S 1;  5DL6 A;  1BT9 A;  5DL8 A;  3FYX A;  3T20 A;  4GCP A;  3A2S X;  1HXU A;  4AUI A;  2Y0L A;  1PRN A;  4FRT A;  1OSM A;  5JDP A;  3WI5 A;  2XE2 A;  2XG6 A;  3HW9 A;  2FGQ X;  5FVN A;  3EMN X;  1GFN A;  2XE5 A;  4KR4 A;  1PHO A;  4KR8 A;  4FSO A;  3SZD A;  3O0E A;  4FRX A;  3SYS A;  3UU2 A;  3JTY A;  2ODJ A;  4LSF A;  2J1N A;  3HWB A;  1OPF A;  6PRN A;  2ZFG A;  2O4V A;  4D5U A;  3SY7 A;  1GFQ A;  4FOZ A;  2K4T A;  2XE3 A;  2POR A;  3POX A;  3SYB A;  7PRN A;  4RJX A;  4RJW A;  1E54 A;  1BH3 A;  1HXX A;  1MPF A;  2Y0K A;  3POU A;  4GCS A;  3POR A;  4FT6 A;  3VZT X;  5DL7 A;  3SY9 A;  4BUM X;  4LSH A;  4D65 A;  3K19 A;  3PRN A;  5PRN A;  2FGR A;  1GFP A; 
#chains in the Genus database with same CATH topology
 2PRN A;  3LK3 B;  2R4L A;  1T1L A;  4JFB A;  5ADX K;  2XE1 A;  4GF4 A;  2KC0 A;  2XTR A;  2F1T A;  3VE2 A;  3T24 A;  3KZI O;  1ZHW A;  2J4U P;  4LSE A;  3VY8 X;  4LSI A;  4PJ0 O;  4RLC A;  2Y2X A;  2JQY A;  3POQ A;  2R4O A;  4AKR A;  5H2F O;  2OMF A;  3C5O A;  3VY9 X;  4O3Y A;  4O3Z A;  4RLB A;  5G39 A;  4GHB A;  1HXT A;  4JCH A;  3NSG A;  4D64 A;  5GTH O;  5B66 O;  3UPG A;  3WI4 A;  1ORM A;  5JDP A;  3PQU A;  2XMX A;  3QRA A;  4C4V B;  2R89 A;  3VZW X;  4O3W A;  5ADX L;  4FSP A;  3VE1 A;  3VZU X;  4PR7 A;  1G90 A;  2WJQ A;  3GP6 A;  5DL5 A;  5TIS O;  3TZG A;  2Y0H A;  5GTI O;  2LHF A;  2WJR A;  4O49 A;  2F1V A;  1GFO A;  2GE4 A;  4E1T A;  3AAA B;  2JMM A;  4N59 A;  3SZV A;  1ZHZ A;  4GCQ A;  3PQS A;  5T5F A;  5B5E O;  3LK3 A;  3PF1 A;  2ZLD A;  5AFU L;  3AAA A;  3PGR A;  4FZM A;  1GFM A;  4FMS A;  8PRN A;  3T0S A;  4C69 X;  4E1S A;  1IZN B;  1ZHY A;  4O3X B;  4KRA A;  4C4V A;  3AAE B;  2QTK A;  1H6S 1;  2MHL A;  5DL6 A;  5G26 A;  4FZL A;  1MM4 A;  4QQ1 A;  2YPV A;  1MM5 A;  1BT9 A;  4IL6 O;  5DL8 A;  3FYX A;  3T20 A;  4AFK A;  3AA7 B;  3QRC A;  4GCP A;  3A2S X;  1S5L O;  1HXU A;  3V8U A;  3LK4 1;  4AUI A;  2KXP A;  2Y0L A;  4N58 A;  1PRN A;  4FRT A;  1OSM A;  1ZHT A;  3BS0 A;  3LK2 A;  4AKM A;  3KVD D;  4UB8 O;  4AYD C;  3WI5 A;  1YS5 A;  3A0H O;  4XNK A;  4C00 A;  2KXP B;  1Q9F A;  2XE2 A;  1QJ8 A;  2XG6 A;  3G7G A;  3HW9 A;  3NJT A;  2FGQ X;  5FVN A;  5GV0 A;  4CTD A;  1GFN A;  3EMN X;  1BXW A;  5AFU K;  4N75 A;  3AA6 B;  2R88 A;  2XE5 A;  1P4T A;  2IWV A;  2MNH A;  1PHO A;  3AAE A;  2M07 A;  4KR4 A;  1ZHX A;  4AZL A;  4FUV A;  4KR8 A;  4AYI D;  4FSO A;  2R8A A;  3A0B O;  3AA1 A;  3AA6 A;  3JCU O;  4N74 A;  3RBH A;  3O0E A;  3SZD A;  4F4B A;  4FRX A;  3SY7 A;  3SYS A;  3UU2 A;  3JTY A;  2ODJ A;  4LSF A;  3DA4 A;  2N2L A;  2J1N A;  3LK2 B;  3DA3 A;  2K0L A;  3AA0 B;  3HWB A;  2R4N A;  4RL9 A;  2KZ7 B;  2X27 X;  1OPF A;  6PRN A;  2X9K A;  2ZFG A;  2O4V A;  2WVP A;  4PUX A;  5E79 O;  4D5U A;  4U9C A;  1GFQ A;  3DZM A;  4FZN A;  2LFU A;  2K4T A;  2XE3 A;  4FOZ A;  3BRY A;  3DWO X;  4Z3T A;  2POR A;  3HOL A;  2W81 C;  4FQE A;  3POX A;  3SYB A;  1IZN A;  3PGU A;  7PRN A;  4G75 A;  4RJX A;  4RJW A;  1Q9G A;  4K3C A;  3UAQ A;  4AKR B;  2KDY A;  5G3A A;  2KZ7 A;  1E54 A;  3AA0 A;  1BH3 A;  3HOE A;  4FES A;  4UB6 O;  4XNL A;  1HXX A;  5G38 A;  1MPF A;  2Y0K A;  4K3B A;  4B61 A;  5D5D A;  2AXT O;  2Y7S A;  3POU A;  4GCS A;  5KAF O;  3POR A;  4FT6 A;  5KAI O;  3VZT X;  2M06 A;  4O4U A;  4AYM C;  4AYN A;  5IYU A;  5DL7 A;  4O4X A;  3AA7 A;  2XTQ A;  2R4P A;  3SY9 A;  4BUM X;  3AA1 B;  2W80 C;  1T16 A;  1THQ A;  3PGS A;  2YNK A;  4LSH A;  3BRZ A;  4D65 A;  3K19 A;  2N2M A;  2F1C X;  3PRN A;  3WU2 O;  3LK4 2;  1QJ9 A;  4AYE C;  2IWW A;  1QJP A;  5EE2 A;  4G76 A;  2ERV A;  3DWN A;  5PRN A;  2FGR A;  1GFP A; 
#chains in the Genus database with same CATH homology
 2PRN A;  3LK3 B;  4JFB A;  5ADX K;  2XE1 A;  4GF4 A;  2KC0 A;  2XTR A;  2F1T A;  3VE2 A;  3T24 A;  2J4U P;  1ZHW A;  4LSE A;  3VY8 X;  4LSI A;  4RLC A;  2Y2X A;  3POQ A;  4AKR A;  2OMF A;  3C5O A;  3VY9 X;  4O3Y A;  4O3Z A;  4RLB A;  3UPG A;  4GHB A;  1HXT A;  4JCH A;  3NSG A;  4D64 A;  3WI4 A;  1ORM A;  3PQU A;  2XMX A;  3QRA A;  3VZW X;  4O3W A;  5ADX L;  4FSP A;  3VE1 A;  3VZU X;  1G90 A;  3GP6 A;  5DL5 A;  3TZG A;  2Y0H A;  2LHF A;  4O49 A;  2F1V A;  1GFO A;  2GE4 A;  4E1T A;  3AAA B;  2JMM A;  4N59 A;  3SZV A;  1ZHZ A;  4GCQ A;  3PQS A;  5T5F A;  3LK3 A;  5AFU L;  2ZLD A;  3AAA A;  4FZM A;  1GFM A;  4FMS A;  8PRN A;  3T0S A;  4C69 X;  4E1S A;  1IZN B;  1ZHY A;  4O3X B;  4KRA A;  3AAE B;  2QTK A;  1H6S 1;  2MHL A;  5DL6 A;  5G26 A;  4FZL A;  1MM4 A;  4QQ1 A;  2YPV A;  1MM5 A;  1BT9 A;  5DL8 A;  3FYX A;  3T20 A;  4AFK A;  3AA7 B;  3QRC A;  4GCP A;  3A2S X;  3V8U A;  1HXU A;  3LK4 1;  4AUI A;  2Y0L A;  2KXP A;  4N58 A;  1PRN A;  4FRT A;  1OSM A;  1ZHT A;  3LK2 A;  4AKM A;  4AYD C;  3KVD D;  5JDP A;  3WI5 A;  1YS5 A;  4XNK A;  2KXP B;  2XG6 A;  2XE2 A;  1Q9F A;  1QJ8 A;  3G7G A;  3HW9 A;  2FGQ X;  5FVN A;  5GV0 A;  1GFN A;  3EMN X;  1BXW A;  5AFU K;  3AA6 B;  2XE5 A;  1P4T A;  2MNH A;  3AAE A;  1PHO A;  4KR4 A;  2M07 A;  4AZL A;  1ZHX A;  4FUV A;  4KR8 A;  4AYI D;  4FSO A;  3AA1 A;  4F4B A;  3AA6 A;  3SZD A;  3RBH A;  3O0E A;  4FRX A;  3SYS A;  3UU2 A;  3JTY A;  2ODJ A;  4LSF A;  3DA4 A;  2N2L A;  2J1N A;  3LK2 B;  3DA3 A;  2K0L A;  3AA0 B;  3HWB A;  4RL9 A;  2KZ7 B;  2X27 X;  1OPF A;  6PRN A;  2ZFG A;  2O4V A;  4PUX A;  4D5U A;  4U9C A;  1GFQ A;  4FZN A;  3SY7 A;  2LFU A;  2K4T A;  2XE3 A;  4FOZ A;  4Z3T A;  2POR A;  3HOL A;  2W81 C;  3POX A;  3SYB A;  1IZN A;  7PRN A;  4G75 A;  4RJX A;  4RJW A;  1Q9G A;  3UAQ A;  4AKR B;  2KDY A;  2KZ7 A;  1E54 A;  3AA0 A;  1BH3 A;  3HOE A;  4FES A;  4XNL A;  1HXX A;  1MPF A;  2Y0K A;  4B61 A;  5D5D A;  2Y7S A;  3POU A;  4GCS A;  3POR A;  4FT6 A;  3VZT X;  2M06 A;  4O4U A;  4AYM C;  4AYN A;  5IYU A;  5DL7 A;  4O4X A;  3AA7 A;  2XTQ A;  3SY9 A;  4BUM X;  3AA1 B;  2W80 C;  1THQ A;  2YNK A;  4LSH A;  4D65 A;  3K19 A;  2N2M A;  3PRN A;  4AYE C;  3LK4 2;  1QJ9 A;  1QJP A;  5EE2 A;  4G76 A;  2ERV A;  5PRN A;  2FGR A;  1GFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...