4D5UA

Structure of ompf in i2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Two Different Centered Monoclinic Crystals of the E. Coli Outer-Membrane Protein Ompf Originate from the Same Building Block.
pubmed doi rcsb
molecule tags Structural protein
total genus 94
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d5uA00
3EMNX 1HXTA 2FGRA 1GFOA 4KRAA 4RJWA 4LSEA 5PRNA 7PRNA 2ZLDA 1OPFA 3UPGA 2XG6A 2ZFGA 3FYXA 4D5UA 2QTKA 2PORA 3SYBA 4GCSA 6PRNA 1OSMA 4LSIA 3T0SA 4FRXA 5DL5A 4GCQA 2Y0LA 3T24A 3POUA 4JFBA 3POXA 3SY7A 1E54A 1MPFA 2XE5A 1HXUA 5JDPA 3SYSA 3PORA 3A2SX 3PRNA 4D65A 2J4UP 5DL8A 4LSFA 2OMFA 2Y0HA 3VZTX 3NSGA 3T20A 2ODJA 4D64A 4KR8A 1HXXA 5FVNA 3VY8X 4GCPA 5DL7A 3O0EA 3POQA 1BH3A 4FRTA 4FSPA 3WI5A 3JTYA 1GFMA 2XE1A 2K4TA 8PRNA 2Y0KA 4FMSA 4FSOA 3WI4A 2Y2XA 3VZUX 1PRNA 2J1NA 4FOZA 4BUMX 1GFQA 1PHOA 4LSHA 3UU2A 3HW9A 4RJXA 4FT6A 4AUIA 3SY9A 1GFNA 1H6S1 2XE2A 4C69X 2O4VA 2PRNA 3HWBA 5DL6A 3K19A 3VY9X 3VZWX 1GFPA 2XE3A 1BT9A 3SZDA 3SZVA 2FGQX 4KR4A
chains in the Genus database with same CATH superfamily
4Z3TA 4E1SA 1ORMA 3EMNX 1HXTA 3LK3B 3QRCA 2FGRA 1GFOA 4KRAA 4RJWA 4KR4A 4LSEA 4AZLA 5AFUL 5PRNA 7PRNA 2X9KA 2XTRA 4O3ZA 2ZLDA 4AYEC 1OPFA 3UPGA 4K3BA 2MNHA 3JCUO 4N74A 2R4NA 2XG6A 2ZFGA 3FYXA 1ZHZA 3DWNA 3LK42 4D5UA 2QTKA 4U9CA 2PORA 4O3YA 5T5FA 4JCHA 2R4PA 3SYBA 4O4UA 4GCSA 3BS0A 4QQ1A 3PQUA 4GF4A 6PRNA 1OSMA 3AA6B 1MM5A 3PGRA 4LSIA 3T0SA 3AA7B 4FRXA 3LK41 5DL5A 2M06A 2R4OA 2XTQA 4FZMA 4GCQA 3AA7A 2N2LA 2Y0LA 3T24A 1T1LA 4O3XB 5GV0A 3POUA 4JFBA 3POXA 4AYDC 3SY7A 1E54A 1QJ8A 2M07A 4AYID 1MPFA 4FUVA 2XE5A 4CTDA 1Q9FA 4XNKA 4O3WA 5G38A 2R8AA 3AA1A 3DA4A 3PGSA 1HXUA 2N2MA 5JDPA 3SYSA 2F1VA 2F1CX 2MHLA 2IWVA 3LK2A 3PORA 5G39A 2XMXA 2WJRA 1QJ9A 3A2SX 3PGUA 3PRNA 4D65A 2R4LA 2J4UP 1ZHXA 3AAEA 2KXPB 3DA3A 5G26A 3V8UA 5KAFO 2KXPA 3KZIO 4O4XA 5DL8A 4LSFA 5ADXK 2OMFA 2Y0HA 3VZTX 2KZ7A 3VE1A 3NSGA 1IZNA 2R88A 3A0HO 3T20A 2ODJA 1ZHYA 4GHBA 4D64A 3A0BO 4KR8A 1HXXA 2WVPA 5FVNA 5TISO 3DZMA 2LHFA 4E1TA 3VY8X 5B66O 3HOEA 3QRAA 4GCPA 3O0EA 5DL7A 4RLCA 4UB8O 4PJ0O 4N75A 3DWOX 1BH3A 1Q9GA 3POQA 4FRTA 4FSPA 2R89A 4IL6O 3WI5A 2KC0A 2JMMA 3JTYA 4PR7A 3PF1A 4FZLA 2WJQA 3AA1B 1GFMA 1T16A 5KAIO 2XE1A 3LK2B 2K4TA 5GTIO 5ADXL 8PRNA 2AXTO 2Y0KA 2F1TA 3GP6A 4K3CA 4XNLA 4FMSA 4FSOA 3AAEB 3WI4A 2Y2XA 2JQYA 3VZUX 3TZGA 1BXWA 1THQA 1PRNA 2YPVA 2KZ7B 1MM4A 2LFUA 4N58A 5E79O 2J1NA 1IZNB 1P4TA 5D5DA 2W81C 4FOZA 5B5EO 4BUMX 3AA0B 1GFQA 2ERVA 1QJPA 4PUXA 4AKRA 1ZHWA 3AA0A 2Y7SA 3WU2O 3BRZA 2YNKA 4G75A 4AKMA 3KVDD 4FESA 4AYNA 4G76A 1PHOA 3BRYA 3LK3A 5EE2A 4LSHA 4C00A 4O49A 4UB6O 4FQEA 4RLBA 3UU2A 3HW9A 3VE2A 2X27X 4RJXA 3RBHA 5GTHO 1G90A 3AAAB 4FT6A 3HOLA 4AUIA 4FZNA 3SY9A 2IWWA 4N59A 3AAAA 1GFNA 5AFUK 3NJTA 1H6S1 2XE2A 1ZHTA 1YS5A 4C69X 2O4VA 2PRNA 3HWBA 5DL6A 4B61A 5IYUA 4F4BA 2GE4A 3C5OA 2K0LA 3K19A 5G3AA 3UAQA 3VY9X 3VZWX 1GFPA 2KDYA 2W80C 2XE3A 4RL9A 3AA6A 1BT9A 3SZDA 4C4VA 5H2FO 3G7GA 3PQSA 4AKRB 4AYMC 4C4VB 3SZVA 2FGQX 4AFKA 1S5LO
chains in the Genus database with same CATH topology
4Z3TA 4E1SA 1ORMA 3EMNX 1HXTA 3LK3B 3QRCA 2FGRA 1GFOA 4KRAA 4RJWA 4AZLA 4LSEA 5AFUL 5PRNA 7PRNA 2XTRA 4O3ZA 2ZLDA 4AYEC 1OPFA 3UPGA 2MNHA 2XG6A 2ZFGA 3FYXA 1ZHZA 3LK42 4D5UA 2QTKA 4U9CA 2PORA 4O3YA 5T5FA 4JCHA 3SYBA 4O4UA 4GCSA 4QQ1A 3PQUA 4GF4A 6PRNA 1OSMA 3AA6B 1MM5A 4LSIA 3T0SA 3AA7B 4FRXA 3LK41 5DL5A 2M06A 2XTQA 4FZMA 4GCQA 3AA7A 2N2LA 2Y0LA 3T24A 4O3XB 5GV0A 3POUA 4JFBA 3POXA 4AYDC 3SY7A 1E54A 1QJ8A 2M07A 4AYID 1MPFA 4FUVA 2XE5A 1Q9FA 4XNKA 4O3WA 3DA4A 3AA1A 1HXUA 2N2MA 5JDPA 3SYSA 2F1VA 2MHLA 3LK2A 3PORA 2XMXA 1QJ9A 3A2SX 3PRNA 4D65A 2J4UP 1ZHXA 3AAEA 2KXPB 3DA3A 5G26A 3V8UA 2KXPA 4O4XA 5DL8A 5ADXK 4LSFA 2OMFA 2Y0HA 3VZTX 2KZ7A 3VE1A 3NSGA 1IZNA 3T20A 2ODJA 1ZHYA 4GHBA 4D64A 4KR8A 1HXXA 5FVNA 2LHFA 4E1TA 3VY8X 3HOEA 3QRAA 4GCPA 3O0EA 5DL7A 4RLCA 3POQA 1BH3A 1Q9GA 4FRTA 4FSPA 3WI5A 2KC0A 2JMMA 3JTYA 4FZLA 3AA1B 1GFMA 2XE1A 3LK2B 2K4TA 5ADXL 8PRNA 2Y0KA 2F1TA 3GP6A 4XNLA 4FMSA 4FSOA 3AAEB 3WI4A 2Y2XA 3VZUX 3TZGA 1BXWA 1THQA 1PRNA 2YPVA 2KZ7B 1MM4A 2LFUA 4N58A 2J1NA 1IZNB 1P4TA 5D5DA 2W81C 4FOZA 4BUMX 3AA0B 1GFQA 2ERVA 1QJPA 4PUXA 4AKRA 1ZHWA 3AA0A 2Y7SA 2YNKA 4G75A 4AKMA 3KVDD 4FESA 4AYNA 4G76A 1PHOA 3LK3A 5EE2A 4LSHA 4O49A 4RLBA 3UU2A 3HW9A 3VE2A 2X27X 4RJXA 3RBHA 1G90A 3AAAB 4FT6A 3HOLA 4AUIA 4FZNA 3SY9A 4N59A 3AAAA 1GFNA 5AFUK 1H6S1 2XE2A 1ZHTA 1YS5A 4C69X 2O4VA 2PRNA 3HWBA 5DL6A 4B61A 5IYUA 4F4BA 2GE4A 3C5OA 2K0LA 3K19A 3VY9X 3UAQA 3VZWX 1GFPA 2XE3A 2W80C 2KDYA 4RL9A 3AA6A 1BT9A 3SZDA 3G7GA 3PQSA 4AKRB 4AYMC 3SZVA 2FGQX 4AFKA 4KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMN X;  1HXT A;  2FGR A;  1GFO A;  4KRA A;  4RJW A;  4LSE A;  5PRN A;  7PRN A;  2ZLD A;  1OPF A;  3UPG A;  2XG6 A;  2ZFG A;  3FYX A;  4D5U A;  2QTK A;  2POR A;  3SYB A;  4GCS A;  6PRN A;  1OSM A;  4LSI A;  3T0S A;  4FRX A;  5DL5 A;  4GCQ A;  2Y0L A;  3T24 A;  3POU A;  4JFB A;  3POX A;  3SY7 A;  1E54 A;  1MPF A;  2XE5 A;  1HXU A;  5JDP A;  3SYS A;  3POR A;  3A2S X;  3PRN A;  4D65 A;  2J4U P;  5DL8 A;  4LSF A;  2OMF A;  2Y0H A;  3VZT X;  3NSG A;  3T20 A;  2ODJ A;  4D64 A;  4KR8 A;  1HXX A;  5FVN A;  3VY8 X;  4GCP A;  5DL7 A;  3O0E A;  3POQ A;  1BH3 A;  4FRT A;  4FSP A;  3WI5 A;  3JTY A;  1GFM A;  2XE1 A;  2K4T A;  8PRN A;  2Y0K A;  4FMS A;  4FSO A;  3WI4 A;  2Y2X A;  3VZU X;  1PRN A;  2J1N A;  4FOZ A;  4BUM X;  1GFQ A;  1PHO A;  4LSH A;  3UU2 A;  3HW9 A;  4RJX A;  4FT6 A;  4AUI A;  3SY9 A;  1GFN A;  1H6S 1;  2XE2 A;  4C69 X;  2O4V A;  2PRN A;  3HWB A;  5DL6 A;  3K19 A;  3VY9 X;  3VZW X;  1GFP A;  2XE3 A;  1BT9 A;  3SZD A;  3SZV A;  2FGQ X;  4KR4 A; 
#chains in the Genus database with same CATH topology
 4Z3T A;  4E1S A;  1ORM A;  3EMN X;  1HXT A;  3LK3 B;  3QRC A;  2FGR A;  1GFO A;  4KRA A;  4RJW A;  4KR4 A;  4LSE A;  4AZL A;  5AFU L;  5PRN A;  7PRN A;  2X9K A;  2XTR A;  4O3Z A;  2ZLD A;  4AYE C;  1OPF A;  3UPG A;  4K3B A;  2MNH A;  3JCU O;  4N74 A;  2R4N A;  2XG6 A;  2ZFG A;  3FYX A;  1ZHZ A;  3DWN A;  3LK4 2;  4D5U A;  2QTK A;  4U9C A;  2POR A;  4O3Y A;  5T5F A;  4JCH A;  2R4P A;  3SYB A;  4O4U A;  4GCS A;  3BS0 A;  4QQ1 A;  3PQU A;  4GF4 A;  6PRN A;  1OSM A;  3AA6 B;  1MM5 A;  3PGR A;  4LSI A;  3T0S A;  3AA7 B;  4FRX A;  3LK4 1;  5DL5 A;  2M06 A;  2R4O A;  2XTQ A;  4FZM A;  4GCQ A;  3AA7 A;  2N2L A;  2Y0L A;  3T24 A;  1T1L A;  4O3X B;  5GV0 A;  3POU A;  4JFB A;  3POX A;  4AYD C;  3SY7 A;  1E54 A;  1QJ8 A;  2M07 A;  4AYI D;  1MPF A;  4FUV A;  2XE5 A;  4CTD A;  1Q9F A;  4XNK A;  4O3W A;  5G38 A;  2R8A A;  3AA1 A;  3DA4 A;  3PGS A;  1HXU A;  2N2M A;  5JDP A;  3SYS A;  2F1V A;  2F1C X;  2MHL A;  2IWV A;  3LK2 A;  3POR A;  5G39 A;  2XMX A;  2WJR A;  1QJ9 A;  3A2S X;  3PGU A;  3PRN A;  4D65 A;  2R4L A;  2J4U P;  1ZHX A;  3AAE A;  2KXP B;  3DA3 A;  5G26 A;  3V8U A;  5KAF O;  2KXP A;  3KZI O;  4O4X A;  5DL8 A;  4LSF A;  5ADX K;  2OMF A;  2Y0H A;  3VZT X;  2KZ7 A;  3VE1 A;  3NSG A;  1IZN A;  2R88 A;  3A0H O;  3T20 A;  2ODJ A;  1ZHY A;  4GHB A;  4D64 A;  3A0B O;  4KR8 A;  1HXX A;  2WVP A;  5FVN A;  5TIS O;  3DZM A;  2LHF A;  4E1T A;  3VY8 X;  5B66 O;  3HOE A;  3QRA A;  4GCP A;  3O0E A;  5DL7 A;  4RLC A;  4UB8 O;  4PJ0 O;  4N75 A;  3DWO X;  1BH3 A;  1Q9G A;  3POQ A;  4FRT A;  4FSP A;  2R89 A;  4IL6 O;  3WI5 A;  2KC0 A;  2JMM A;  3JTY A;  4PR7 A;  3PF1 A;  4FZL A;  2WJQ A;  3AA1 B;  1GFM A;  1T16 A;  5KAI O;  2XE1 A;  3LK2 B;  2K4T A;  5GTI O;  5ADX L;  8PRN A;  2AXT O;  2Y0K A;  2F1T A;  3GP6 A;  4K3C A;  4XNL A;  4FMS A;  4FSO A;  3AAE B;  3WI4 A;  2Y2X A;  2JQY A;  3VZU X;  3TZG A;  1BXW A;  1THQ A;  1PRN A;  2YPV A;  2KZ7 B;  1MM4 A;  2LFU A;  4N58 A;  5E79 O;  2J1N A;  1IZN B;  1P4T A;  5D5D A;  2W81 C;  4FOZ A;  5B5E O;  4BUM X;  3AA0 B;  1GFQ A;  2ERV A;  1QJP A;  4PUX A;  4AKR A;  1ZHW A;  3AA0 A;  2Y7S A;  3WU2 O;  3BRZ A;  2YNK A;  4G75 A;  4AKM A;  3KVD D;  4FES A;  4AYN A;  4G76 A;  1PHO A;  3BRY A;  3LK3 A;  5EE2 A;  4LSH A;  4C00 A;  4O49 A;  4UB6 O;  4FQE A;  4RLB A;  3UU2 A;  3HW9 A;  3VE2 A;  2X27 X;  4RJX A;  3RBH A;  5GTH O;  1G90 A;  3AAA B;  4FT6 A;  3HOL A;  4AUI A;  4FZN A;  3SY9 A;  2IWW A;  4N59 A;  3AAA A;  1GFN A;  5AFU K;  3NJT A;  1H6S 1;  2XE2 A;  1ZHT A;  1YS5 A;  4C69 X;  2O4V A;  2PRN A;  3HWB A;  5DL6 A;  4B61 A;  5IYU A;  4F4B A;  2GE4 A;  3C5O A;  2K0L A;  3K19 A;  5G3A A;  3UAQ A;  3VY9 X;  3VZW X;  1GFP A;  2KDY A;  2W80 C;  2XE3 A;  4RL9 A;  3AA6 A;  1BT9 A;  3SZD A;  4C4V A;  5H2F O;  3G7G A;  3PQS A;  4AKR B;  4AYM C;  4C4V B;  3SZV A;  2FGQ X;  4AFK A;  1S5L O; 
#chains in the Genus database with same CATH homology
 4Z3T A;  4E1S A;  1ORM A;  3EMN X;  1HXT A;  3LK3 B;  3QRC A;  2FGR A;  1GFO A;  4KRA A;  4RJW A;  4AZL A;  4LSE A;  5AFU L;  5PRN A;  7PRN A;  2XTR A;  4O3Z A;  2ZLD A;  4AYE C;  1OPF A;  3UPG A;  2MNH A;  2XG6 A;  2ZFG A;  3FYX A;  1ZHZ A;  3LK4 2;  4D5U A;  2QTK A;  4U9C A;  2POR A;  4O3Y A;  5T5F A;  4JCH A;  3SYB A;  4O4U A;  4GCS A;  4QQ1 A;  3PQU A;  4GF4 A;  6PRN A;  1OSM A;  3AA6 B;  1MM5 A;  4LSI A;  3T0S A;  3AA7 B;  4FRX A;  3LK4 1;  5DL5 A;  2M06 A;  2XTQ A;  4FZM A;  4GCQ A;  3AA7 A;  2N2L A;  2Y0L A;  3T24 A;  4O3X B;  5GV0 A;  3POU A;  4JFB A;  3POX A;  4AYD C;  3SY7 A;  1E54 A;  1QJ8 A;  2M07 A;  4AYI D;  1MPF A;  4FUV A;  2XE5 A;  1Q9F A;  4XNK A;  4O3W A;  3DA4 A;  3AA1 A;  1HXU A;  2N2M A;  5JDP A;  3SYS A;  2F1V A;  2MHL A;  3LK2 A;  3POR A;  2XMX A;  1QJ9 A;  3A2S X;  3PRN A;  4D65 A;  2J4U P;  1ZHX A;  3AAE A;  2KXP B;  3DA3 A;  5G26 A;  3V8U A;  2KXP A;  4O4X A;  5DL8 A;  5ADX K;  4LSF A;  2OMF A;  2Y0H A;  3VZT X;  2KZ7 A;  3VE1 A;  3NSG A;  1IZN A;  3T20 A;  2ODJ A;  1ZHY A;  4GHB A;  4D64 A;  4KR8 A;  1HXX A;  5FVN A;  2LHF A;  4E1T A;  3VY8 X;  3HOE A;  3QRA A;  4GCP A;  3O0E A;  5DL7 A;  4RLC A;  3POQ A;  1BH3 A;  1Q9G A;  4FRT A;  4FSP A;  3WI5 A;  2KC0 A;  2JMM A;  3JTY A;  4FZL A;  3AA1 B;  1GFM A;  2XE1 A;  3LK2 B;  2K4T A;  5ADX L;  8PRN A;  2Y0K A;  2F1T A;  3GP6 A;  4XNL A;  4FMS A;  4FSO A;  3AAE B;  3WI4 A;  2Y2X A;  3VZU X;  3TZG A;  1BXW A;  1THQ A;  1PRN A;  2YPV A;  2KZ7 B;  1MM4 A;  2LFU A;  4N58 A;  2J1N A;  1IZN B;  1P4T A;  5D5D A;  2W81 C;  4FOZ A;  4BUM X;  3AA0 B;  1GFQ A;  2ERV A;  1QJP A;  4PUX A;  4AKR A;  1ZHW A;  3AA0 A;  2Y7S A;  2YNK A;  4G75 A;  4AKM A;  3KVD D;  4FES A;  4AYN A;  4G76 A;  1PHO A;  3LK3 A;  5EE2 A;  4LSH A;  4O49 A;  4RLB A;  3UU2 A;  3HW9 A;  3VE2 A;  2X27 X;  4RJX A;  3RBH A;  1G90 A;  3AAA B;  4FT6 A;  3HOL A;  4AUI A;  4FZN A;  3SY9 A;  4N59 A;  3AAA A;  1GFN A;  5AFU K;  1H6S 1;  2XE2 A;  1ZHT A;  1YS5 A;  4C69 X;  2O4V A;  2PRN A;  3HWB A;  5DL6 A;  4B61 A;  5IYU A;  4F4B A;  2GE4 A;  3C5O A;  2K0L A;  3K19 A;  3VY9 X;  3UAQ A;  3VZW X;  1GFP A;  2XE3 A;  2W80 C;  2KDY A;  4RL9 A;  3AA6 A;  1BT9 A;  3SZD A;  3G7G A;  3PQS A;  4AKR B;  4AYM C;  3SZV A;  2FGQ X;  4AFK A;  4KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...