4D5UA

Structure of ompf in i2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords OUTER MEMBRANE PROTEIN F
publication title Two Different Centered Monoclinic Crystals of the E. Coli Outer-Membrane Protein Ompf Originate from the Same Building Block.
pubmed doi rcsb
total genus 94
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d5uA00
3UU2A 2XE1A 5JDPA 2FGRA 5FVNA 3T0SA 1OSMA 3POQA 1MPFA 3JTYA 4FSPA 5DL8A 3WI5A 2J4UP 1PRNA 2XE3A 3PORA 5DL7A 3HWBA 4LSIA 2K4TA 4LSFA 2QTKA 3VZUX 5DL6A 4RJXA 1BT9A 3T24A 2Y0KA 1E54A 2PORA 4FOZA 3UPGA 4FRTA 1GFOA 3K19A 2O4VA 4GCPA 1HXUA 5PRNA 4FT6A 4D64A 7PRNA 3POXA 6PRNA 4RJWA 3EMNX 2ODJA 4LSHA 3VZTX 3SYSA 3VZWX 1GFPA 3O0EA 3WI4A 8PRNA 2PRNA 3VY8X 4AUIA 2ZLDA 4FMSA 3HW9A 3T20A 2Y0LA 1GFMA 1HXXA 3SY7A 3SZVA 3NSGA 4C69X 3A2SX 4FSOA 2ZFGA 4D65A 2Y0HA 1H6S1 4KR4A 1PHOA 2XE5A 3SY9A 3PRNA 4JFBA 1GFNA 2J1NA 4KR8A 2OMFA 2XE2A 2XG6A 1OPFA 3FYXA 4FRXA 5DL5A 4GCSA 4GCQA 3SZDA 4KRAA 3VY9X 4BUMX 2FGQX 3SYBA 1HXTA 4D5UA 1GFQA 3POUA 2Y2XA 4LSEA 1BH3A
chains in the Genus database with same CATH superfamily
3BRZA 2JQYA 1ZHZA 3UU2A 2XE1A 5JDPA 3LK3B 4QQ1A 2FGRA 5FVNA 3T0SA 5TISO 1OSMA 1MM4A 3POQA 5IYUA 4FZNA 1MPFA 3JTYA 4FSPA 1QJ9A 5DL8A 3WI5A 4AKRB 1PRNA 2XE3A 3PORA 2YPVA 4FQEA 4RL9A 2LHFA 3HWBA 4LSIA 2F1VA 2K4TA 4GF4A 4LSFA 4JCHA 2QTKA 3LK42 5KAFO 2WJRA 3VZUX 5DL6A 2X9KA 1YS5A 1T16A 4RJXA 5B66O 2WVPA 3GP6A 4G75A 3PQUA 1BT9A 1S5LO 3T24A 3TZGA 2Y0KA 3UAQA 3G7GA 4IL6O 4AFKA 1E54A 1P4TA 2PORA 3A0HO 3C5OA 4FOZA 5D5DA 5GTHO 3UPGA 4AYMC 4FRTA 3LK2A 3PGSA 3RBHA 4AYID 4O3YA 1GFOA 1T1LA 2IWVA 4O4UA 3LK2B 3DA4A 4RLBA 3WU2O 3AAAB 2W81C 3K19A 5E79O 5ADXK 2O4VA 4GCPA 5AFUL 3VE2A 2WJQA 3DWOX 4B61A 1HXUA 2Y7SA 5PRNA 2IWWA 1QJ8A 4FT6A 4D64A 2MNHA 2KZ7A 3PGRA 7PRNA 3POXA 6PRNA 2KZ7B 2W80C 2F1CX 4AYNA 2XTRA 4RJWA 3EMNX 2ODJA 4LSHA 3VZTX 5T5FA 2N2MA 5GTIO 3SYSA 3V8UA 3VZWX 1GFPA 5G26A 3LK41 5B5EO 3O0EA 4FZMA 4C4VA 1Q9FA 5G38A 1ZHTA 4PUXA 2R4NA 3PF1A 3WI4A 3PGUA 2XMXA 3AA7A 3QRCA 1QJPA 2N2LA 8PRNA 3QRAA 3AA6A 2R89A 3PQSA 3DWNA 5EE2A 2PRNA 3DA3A 2JMMA 2KDYA 3AA6B 3HOLA 3VY8X 4AUIA 4FZLA 2ZLDA 3BS0A 4FMSA 4GHBA 4C4VB 5ADXL 3HW9A 3T20A 2LFUA 1Q9GA 2Y0LA 2AXTO 1GFMA 4O49A 1HXXA 4AZLA 1ZHYA 4XNLA 2MHLA 2ERVA 4RLCA 4G76A 1IZNA 5KAIO 3SY7A 3AAEA 3SZVA 1ZHWA 3A0BO 5GV0A 2K0LA 3NSGA 4FESA 2XTQA 3AAEB 4C69X 4N75A 3A2SX 4N59A 4FSOA 5G39A 2ZFGA 4D65A 5G3AA 2R4LA 4N74A 2Y0HA 5DL7A 4E1TA 1H6S1 2GE4A 1ZHXA 2R4OA 4KR4A 3JCUO 4PJ0O 1PHOA 2XE5A 1MM5A 1BXWA 5H2FO 2KC0A 3AA7B 3SY9A 2YNKA 3PRNA 4XNKA 5AFUK 4JFBA 3LK3A 3KVDD 2F1TA 1GFNA 4AYEC 2J1NA 4U9CA 4FUVA 4KR8A 4CTDA 2R4PA 2OMFA 2XE2A 4O3WA 4AKRA 2XG6A 4UB8O 2J4UP 1OPFA 4Z3TA 3FYXA 4FRXA 5DL5A 4GCSA 4GCQA 3SZDA 4KRAA 3AA1A 3BRYA 1IZNB 3AA1B 3VY9X 4E1SA 4AKMA 3VE1A 4BUMX 2M07A 3NJTA 4O3XB 2FGQX 4UB6O 3HOEA 4AYDC 1THQA 2R88A 4O4XA 3DZMA 2M06A 4PR7A 4N58A 3SYBA 2KXPA 4F4BA 1HXTA 4C00A 3KZIO 2X27X 4K3CA 4D5UA 2KXPB 1GFQA 1ORMA 3POUA 2R8AA 3AAAA 1G90A 2Y2XA 4LSEA 3AA0A 4O3ZA 4K3BA 1BH3A 3AA0B
chains in the Genus database with same CATH topology
3UU2A 1ZHZA 2XE1A 5JDPA 3LK3B 4QQ1A 2FGRA 5FVNA 3T0SA 1OSMA 1MM4A 3POQA 5IYUA 4FZNA 1MPFA 3JTYA 4FSPA 1QJ9A 5DL8A 3WI5A 4AKRB 1PRNA 2XE3A 3PORA 2YPVA 4RL9A 5DL7A 2LHFA 3HWBA 4LSIA 2F1VA 2K4TA 4GF4A 4LSFA 4JCHA 2QTKA 3LK42 3VZUX 5DL6A 1YS5A 4RJXA 3GP6A 4G75A 3PQUA 1BT9A 3T24A 3TZGA 2Y0KA 3UAQA 3G7GA 4AFKA 1E54A 1P4TA 2PORA 3C5OA 5D5DA 4FOZA 3UPGA 4AYMC 4FRTA 3LK2A 3RBHA 4AYID 4O3YA 1GFOA 4O4UA 4RLBA 3LK2B 3DA4A 5ADXK 3AAAB 2W81C 3K19A 2O4VA 4GCPA 5AFUL 3VE2A 4B61A 1HXUA 2Y7SA 5PRNA 1QJ8A 4FT6A 4D64A 2MNHA 2KZ7A 7PRNA 3POXA 6PRNA 2KZ7B 2W80C 4AYNA 2XTRA 4RJWA 3EMNX 2ODJA 4LSHA 3VZTX 5T5FA 2N2MA 3SYSA 3V8UA 3VZWX 1GFPA 5G26A 3LK41 3O0EA 4FZMA 1Q9FA 1ZHTA 4PUXA 3WI4A 2XMXA 3AA7A 3QRCA 1QJPA 2N2LA 8PRNA 3QRAA 3AA6A 3PQSA 5EE2A 2PRNA 3DA3A 2JMMA 2KDYA 3AA6B 3HOLA 3VY8X 4AUIA 4FZLA 2ZLDA 4FMSA 4GHBA 5ADXL 3HW9A 3T20A 2LFUA 1Q9GA 2Y0LA 1GFMA 4O49A 1HXXA 4AZLA 1ZHYA 4XNLA 2MHLA 2ERVA 4RLCA 4G76A 1IZNA 3SY7A 3SZVA 3AAEA 1ZHWA 5GV0A 2K0LA 3NSGA 4FESA 2XTQA 3AAEB 4C69X 3A2SX 4N59A 4FSOA 2ZFGA 4D65A 2Y0HA 4E1TA 1H6S1 2GE4A 1ZHXA 4KR4A 1PHOA 2XE5A 1MM5A 1BXWA 2KC0A 3AA7B 3SY9A 2YNKA 3PRNA 4XNKA 5AFUK 4JFBA 3LK3A 3KVDD 2F1TA 1GFNA 4AYEC 2J1NA 4U9CA 4FUVA 4KR8A 2OMFA 2XE2A 4O3WA 4AKRA 2XG6A 2J4UP 1OPFA 4Z3TA 3FYXA 4FRXA 5DL5A 4GCSA 4GCQA 3SZDA 4KRAA 3AA1A 1IZNB 3AA1B 3VY9X 4E1SA 4AKMA 3VE1A 4BUMX 2M07A 4AYDC 4O3XB 2FGQX 3HOEA 1THQA 4O4XA 2M06A 4N58A 3SYBA 2KXPA 4F4BA 1HXTA 2X27X 4D5UA 2KXPB 1GFQA 1ORMA 3POUA 3AAAA 1G90A 2Y2XA 4LSEA 3AA0A 4O3ZA 1BH3A 3AA0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU2 A;  2XE1 A;  5JDP A;  2FGR A;  5FVN A;  3T0S A;  1OSM A;  3POQ A;  1MPF A;  3JTY A;  4FSP A;  5DL8 A;  3WI5 A;  2J4U P;  1PRN A;  2XE3 A;  3POR A;  5DL7 A;  3HWB A;  4LSI A;  2K4T A;  4LSF A;  2QTK A;  3VZU X;  5DL6 A;  4RJX A;  1BT9 A;  3T24 A;  2Y0K A;  1E54 A;  2POR A;  4FOZ A;  3UPG A;  4FRT A;  1GFO A;  3K19 A;  2O4V A;  4GCP A;  1HXU A;  5PRN A;  4FT6 A;  4D64 A;  7PRN A;  3POX A;  6PRN A;  4RJW A;  3EMN X;  2ODJ A;  4LSH A;  3VZT X;  3SYS A;  3VZW X;  1GFP A;  3O0E A;  3WI4 A;  8PRN A;  2PRN A;  3VY8 X;  4AUI A;  2ZLD A;  4FMS A;  3HW9 A;  3T20 A;  2Y0L A;  1GFM A;  1HXX A;  3SY7 A;  3SZV A;  3NSG A;  4C69 X;  3A2S X;  4FSO A;  2ZFG A;  4D65 A;  2Y0H A;  1H6S 1;  4KR4 A;  1PHO A;  2XE5 A;  3SY9 A;  3PRN A;  4JFB A;  1GFN A;  2J1N A;  4KR8 A;  2OMF A;  2XE2 A;  2XG6 A;  1OPF A;  3FYX A;  4FRX A;  5DL5 A;  4GCS A;  4GCQ A;  3SZD A;  4KRA A;  3VY9 X;  4BUM X;  2FGQ X;  3SYB A;  1HXT A;  4D5U A;  1GFQ A;  3POU A;  2Y2X A;  4LSE A;  1BH3 A; 
#chains in the Genus database with same CATH topology
 3BRZ A;  2JQY A;  1ZHZ A;  3UU2 A;  2XE1 A;  5JDP A;  3LK3 B;  4QQ1 A;  2FGR A;  5FVN A;  3T0S A;  5TIS O;  1OSM A;  1MM4 A;  3POQ A;  5IYU A;  4FZN A;  1MPF A;  3JTY A;  4FSP A;  1QJ9 A;  5DL8 A;  3WI5 A;  4AKR B;  1PRN A;  2XE3 A;  3POR A;  2YPV A;  4FQE A;  4RL9 A;  2LHF A;  3HWB A;  4LSI A;  2F1V A;  2K4T A;  4GF4 A;  4LSF A;  4JCH A;  2QTK A;  3LK4 2;  5KAF O;  2WJR A;  3VZU X;  5DL6 A;  2X9K A;  1YS5 A;  1T16 A;  4RJX A;  5B66 O;  2WVP A;  3GP6 A;  4G75 A;  3PQU A;  1BT9 A;  1S5L O;  3T24 A;  3TZG A;  2Y0K A;  3UAQ A;  3G7G A;  4IL6 O;  4AFK A;  1E54 A;  1P4T A;  2POR A;  3A0H O;  3C5O A;  4FOZ A;  5D5D A;  5GTH O;  3UPG A;  4AYM C;  4FRT A;  3LK2 A;  3PGS A;  3RBH A;  4AYI D;  4O3Y A;  1GFO A;  1T1L A;  2IWV A;  4O4U A;  3LK2 B;  3DA4 A;  4RLB A;  3WU2 O;  3AAA B;  2W81 C;  3K19 A;  5E79 O;  5ADX K;  2O4V A;  4GCP A;  5AFU L;  3VE2 A;  2WJQ A;  3DWO X;  4B61 A;  1HXU A;  2Y7S A;  5PRN A;  2IWW A;  1QJ8 A;  4FT6 A;  4D64 A;  2MNH A;  2KZ7 A;  3PGR A;  7PRN A;  3POX A;  6PRN A;  2KZ7 B;  2W80 C;  2F1C X;  4AYN A;  2XTR A;  4RJW A;  3EMN X;  2ODJ A;  4LSH A;  3VZT X;  5T5F A;  2N2M A;  5GTI O;  3SYS A;  3V8U A;  3VZW X;  1GFP A;  5G26 A;  3LK4 1;  5B5E O;  3O0E A;  4FZM A;  4C4V A;  1Q9F A;  5G38 A;  1ZHT A;  4PUX A;  2R4N A;  3PF1 A;  3WI4 A;  3PGU A;  2XMX A;  3AA7 A;  3QRC A;  1QJP A;  2N2L A;  8PRN A;  3QRA A;  3AA6 A;  2R89 A;  3PQS A;  3DWN A;  5EE2 A;  2PRN A;  3DA3 A;  2JMM A;  2KDY A;  3AA6 B;  3HOL A;  3VY8 X;  4AUI A;  4FZL A;  2ZLD A;  3BS0 A;  4FMS A;  4GHB A;  4C4V B;  5ADX L;  3HW9 A;  3T20 A;  2LFU A;  1Q9G A;  2Y0L A;  2AXT O;  1GFM A;  4O49 A;  1HXX A;  4AZL A;  1ZHY A;  4XNL A;  2MHL A;  2ERV A;  4RLC A;  4G76 A;  1IZN A;  5KAI O;  3SY7 A;  3AAE A;  3SZV A;  1ZHW A;  3A0B O;  5GV0 A;  2K0L A;  3NSG A;  4FES A;  2XTQ A;  3AAE B;  4C69 X;  4N75 A;  3A2S X;  4N59 A;  4FSO A;  5G39 A;  2ZFG A;  4D65 A;  5G3A A;  2R4L A;  4N74 A;  2Y0H A;  5DL7 A;  4E1T A;  1H6S 1;  2GE4 A;  1ZHX A;  2R4O A;  4KR4 A;  3JCU O;  4PJ0 O;  1PHO A;  2XE5 A;  1MM5 A;  1BXW A;  5H2F O;  2KC0 A;  3AA7 B;  3SY9 A;  2YNK A;  3PRN A;  4XNK A;  5AFU K;  4JFB A;  3LK3 A;  3KVD D;  2F1T A;  1GFN A;  4AYE C;  2J1N A;  4U9C A;  4FUV A;  4KR8 A;  4CTD A;  2R4P A;  2OMF A;  2XE2 A;  4O3W A;  4AKR A;  2XG6 A;  4UB8 O;  2J4U P;  1OPF A;  4Z3T A;  3FYX A;  4FRX A;  5DL5 A;  4GCS A;  4GCQ A;  3SZD A;  4KRA A;  3AA1 A;  3BRY A;  1IZN B;  3AA1 B;  3VY9 X;  4E1S A;  4AKM A;  3VE1 A;  4BUM X;  2M07 A;  3NJT A;  4O3X B;  2FGQ X;  4UB6 O;  3HOE A;  4AYD C;  1THQ A;  2R88 A;  4O4X A;  3DZM A;  2M06 A;  4PR7 A;  4N58 A;  3SYB A;  2KXP A;  4F4B A;  1HXT A;  4C00 A;  3KZI O;  2X27 X;  4K3C A;  4D5U A;  2KXP B;  1GFQ A;  1ORM A;  3POU A;  2R8A A;  3AAA A;  1G90 A;  2Y2X A;  4LSE A;  3AA0 A;  4O3Z A;  4K3B A;  1BH3 A;  3AA0 B; 
#chains in the Genus database with same CATH homology
 3UU2 A;  1ZHZ A;  2XE1 A;  5JDP A;  3LK3 B;  4QQ1 A;  2FGR A;  5FVN A;  3T0S A;  1OSM A;  1MM4 A;  3POQ A;  5IYU A;  4FZN A;  1MPF A;  3JTY A;  4FSP A;  1QJ9 A;  5DL8 A;  3WI5 A;  4AKR B;  1PRN A;  2XE3 A;  3POR A;  2YPV A;  4RL9 A;  5DL7 A;  2LHF A;  3HWB A;  4LSI A;  2F1V A;  2K4T A;  4GF4 A;  4LSF A;  4JCH A;  2QTK A;  3LK4 2;  3VZU X;  5DL6 A;  1YS5 A;  4RJX A;  3GP6 A;  4G75 A;  3PQU A;  1BT9 A;  3T24 A;  3TZG A;  2Y0K A;  3UAQ A;  3G7G A;  4AFK A;  1E54 A;  1P4T A;  2POR A;  3C5O A;  5D5D A;  4FOZ A;  3UPG A;  4AYM C;  4FRT A;  3LK2 A;  3RBH A;  4AYI D;  4O3Y A;  1GFO A;  4O4U A;  4RLB A;  3LK2 B;  3DA4 A;  5ADX K;  3AAA B;  2W81 C;  3K19 A;  2O4V A;  4GCP A;  5AFU L;  3VE2 A;  4B61 A;  1HXU A;  2Y7S A;  5PRN A;  1QJ8 A;  4FT6 A;  4D64 A;  2MNH A;  2KZ7 A;  7PRN A;  3POX A;  6PRN A;  2KZ7 B;  2W80 C;  4AYN A;  2XTR A;  4RJW A;  3EMN X;  2ODJ A;  4LSH A;  3VZT X;  5T5F A;  2N2M A;  3SYS A;  3V8U A;  3VZW X;  1GFP A;  5G26 A;  3LK4 1;  3O0E A;  4FZM A;  1Q9F A;  1ZHT A;  4PUX A;  3WI4 A;  2XMX A;  3AA7 A;  3QRC A;  1QJP A;  2N2L A;  8PRN A;  3QRA A;  3AA6 A;  3PQS A;  5EE2 A;  2PRN A;  3DA3 A;  2JMM A;  2KDY A;  3AA6 B;  3HOL A;  3VY8 X;  4AUI A;  4FZL A;  2ZLD A;  4FMS A;  4GHB A;  5ADX L;  3HW9 A;  3T20 A;  2LFU A;  1Q9G A;  2Y0L A;  1GFM A;  4O49 A;  1HXX A;  4AZL A;  1ZHY A;  4XNL A;  2MHL A;  2ERV A;  4RLC A;  4G76 A;  1IZN A;  3SY7 A;  3SZV A;  3AAE A;  1ZHW A;  5GV0 A;  2K0L A;  3NSG A;  4FES A;  2XTQ A;  3AAE B;  4C69 X;  3A2S X;  4N59 A;  4FSO A;  2ZFG A;  4D65 A;  2Y0H A;  4E1T A;  1H6S 1;  2GE4 A;  1ZHX A;  4KR4 A;  1PHO A;  2XE5 A;  1MM5 A;  1BXW A;  2KC0 A;  3AA7 B;  3SY9 A;  2YNK A;  3PRN A;  4XNK A;  5AFU K;  4JFB A;  3LK3 A;  3KVD D;  2F1T A;  1GFN A;  4AYE C;  2J1N A;  4U9C A;  4FUV A;  4KR8 A;  2OMF A;  2XE2 A;  4O3W A;  4AKR A;  2XG6 A;  2J4U P;  1OPF A;  4Z3T A;  3FYX A;  4FRX A;  5DL5 A;  4GCS A;  4GCQ A;  3SZD A;  4KRA A;  3AA1 A;  1IZN B;  3AA1 B;  3VY9 X;  4E1S A;  4AKM A;  3VE1 A;  4BUM X;  2M07 A;  4AYD C;  4O3X B;  2FGQ X;  3HOE A;  1THQ A;  4O4X A;  2M06 A;  4N58 A;  3SYB A;  2KXP A;  4F4B A;  1HXT A;  2X27 X;  4D5U A;  2KXP B;  1GFQ A;  1ORM A;  3POU A;  3AAA A;  1G90 A;  2Y2X A;  4LSE A;  3AA0 A;  4O3Z A;  1BH3 A;  3AA0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...