4D5UA

Structure of ompf in i2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Centered Monoclinic Crystals of the E. Coli Outer-Membrane Protein Ompf Originate from the Same Building Block.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords OUTER MEMBRANE PROTEIN F
total genus 94
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4d5uA00
4RJXA 1OSMA 2FGQX 1GFNA 3T0SA 1H6S1 3SZVA 3NSGA 5DL6A 3PRNA 2ZLDA 3SYSA 4D64A 2Y0HA 3SZDA 4KR4A 2J1NA 2PORA 4BUMX 4JFBA 4LSFA 3PORA 3VZWX 3VZTX 4AUIA 3SY7A 1PRNA 4FRTA 7PRNA 4D65A 2OMFA 3K19A 2Y0LA 4KR8A 5FVNA 1OPFA 3FYXA 1GFMA 1GFOA 3T20A 3SY9A 2FGRA 4FSPA 3JTYA 2XE2A 2K4TA 1GFPA 4RJWA 2QTKA 1HXTA 3O0EA 4D5UA 3POQA 3POXA 1GFQA 4GCQA 3VY8X 2PRNA 2J4UP 3HWBA 4FRXA 3T24A 4FOZA 2XE3A 2O4VA 3EMNX 8PRNA 1HXUA 3SYBA 1MPFA 4GCSA 5DL5A 4FMSA 4GCPA 3POUA 5DL8A 5JDPA 4LSEA 1HXXA 2ZFGA 2ODJA 1E54A 3A2SX 2XE5A 3WI5A 2XE1A 3UPGA 1BH3A 3HW9A 5PRNA 2Y0KA 3UU2A 4C69X 1BT9A 2Y2XA 4KRAA 1PHOA 5DL7A 6PRNA 3VY9X 4LSIA 4FSOA 4LSHA 4FT6A 3WI4A 2XG6A 3VZUX
chains in the Genus database with same CATH superfamily
4RJXA 1OSMA 4N75A 2FGQX 1GFNA 2R4LA 1QJ9A 3T0SA 5KAIO 1H6S1 2M07A 3KZIO 4E1TA 3PF1A 5E79O 3SZVA 3NSGA 2ERVA 3AA6A 5DL6A 3PRNA 2ZLDA 4IL6O 4N74A 4XNLA 3SYSA 4D64A 4FQEA 2Y0HA 3DA3A 1IZNA 3SZDA 3JCUO 3PGUA 4KR4A 2J1NA 4G75A 1S5LO 4RLCA 4AKMA 3BRZA 4PJ0O 5B66O 2F1CX 2LFUA 3TZGA 2PORA 1T1LA 4FUVA 3AA6B 5GTIO 3VE2A 1ORMA 4BUMX 4JFBA 4LSFA 5B5EO 2Y7SA 2KDYA 3PORA 3NJTA 5AFUK 3VZWX 3VZTX 2F1TA 3HOEA 4O49A 2W81C 3LK41 3HOLA 3LK2B 3PQSA 4K3CA 3PQUA 2KZ7B 4AKRB 4E1SA 4AUIA 2R88A 2N2MA 4UB6O 4C4VB 3WU2O 2N2LA 5G3AA 5TISO 3SY7A 4AYID 2JMMA 1PRNA 4FRTA 4G76A 7PRNA 4QQ1A 2K0LA 4D65A 4AFKA 3VE1A 1Q9GA 1BXWA 2OMFA 3K19A 5AFUL 4UB8O 3QRAA 4C00A 2WJQA 4O4XA 4AYNA 2Y0LA 4KR8A 5FVNA 1QJPA 1OPFA 3FYXA 1GFMA 2GE4A 1GFOA 2M06A 3T20A 4FZNA 4AYDC 2YNKA 3AA0A 1MM4A 3SY9A 2FGRA 3DZMA 4FSPA 2R4PA 2MNHA 3JTYA 2XE2A 3DWOX 3V8UA 5G38A 2K4TA 1GFPA 4N59A 3LK42 4RJWA 3AA1B 2QTKA 3QRCA 4O3YA 5ADXK 2WJRA 4O3XB 3LK3A 1HXTA 3O0EA 4AYEC 4O3WA 4D5UA 2IWWA 3POQA 3POXA 1GFQA 3AAEA 4GCQA 4O3ZA 3VY8X 2PRNA 2J4UP 4F4BA 2KXPA 3HWBA 2IWVA 4FRXA 5H2FO 3A0HO 2F1VA 3T24A 4B61A 5GTHO 4FOZA 2XE3A 2O4VA 1Q9FA 3EMNX 3A0BO 8PRNA 4RL9A 4N58A 1ZHTA 1HXUA 4RLBA 3SYBA 4AYMC 1IZNB 2R4OA 1MPFA 2JQYA 2R8AA 1T16A 3GP6A 3PGRA 2WVPA 4GCSA 5DL5A 4FMSA 4GCPA 4CTDA 2R4NA 4JCHA 3POUA 4K3BA 5G39A 5GV0A 1YS5A 3BS0A 1ZHYA 2KXPB 4U9CA 4O4UA 2XMXA 3BRYA 3PGSA 5DL8A 1P4TA 3AAEB 2LHFA 4Z3TA 5JDPA 1ZHZA 3C5OA 1HXXA 3AA1A 3G7GA 4LSEA 5D5DA 4FZLA 2ZFGA 5IYUA 3RBHA 2ODJA 1E54A 3A2SX 4GF4A 2XE5A 2KC0A 3LK3B 3WI5A 2XTRA 2XE1A 1MM5A 3AA7A 3AA0B 3DWNA 2R89A 2XTQA 3AAAA 3UPGA 4GHBA 2X27X 1BH3A 1THQA 2X9KA 3AAAB 3HW9A 5EE2A 5G26A 1QJ8A 5PRNA 4XNKA 3AA7B 2Y0KA 2MHLA 2AXTO 5KAFO 1BT9A 2Y2XA 3DA4A 3KVDD 4KRAA 3UU2A 1PHOA 4C69X 5DL7A 6PRNA 1ZHWA 3VY9X 5ADXL 4C4VA 1ZHXA 4LSIA 4FSOA 4PUXA 5T5FA 2YPVA 2KZ7A 4AKRA 4LSHA 3UAQA 4AZLA 2W80C 3LK2A 1G90A 4FESA 4FT6A 4PR7A 4FZMA 3WI4A 2XG6A 3VZUX
chains in the Genus database with same CATH topology
4RJXA 1OSMA 2FGQX 1GFNA 1QJ9A 3T0SA 1H6S1 2M07A 4E1TA 3SZVA 3NSGA 2ERVA 3AA6A 5DL6A 3PRNA 2ZLDA 3SYSA 4D64A 4XNLA 2Y0HA 3DA3A 1IZNA 3SZDA 4KR4A 2J1NA 4G75A 4RLCA 4AKMA 2LFUA 3TZGA 2PORA 4FUVA 3VE2A 3AA6B 4BUMX 1ORMA 4JFBA 4LSFA 2Y7SA 2KDYA 3PORA 5AFUK 3VZWX 3VZTX 2F1TA 3HOEA 4O49A 2W81C 3LK41 3HOLA 3LK2B 3PQSA 3PQUA 2KZ7B 4AKRB 4E1SA 4AUIA 2N2MA 2N2LA 3SY7A 4AYID 2JMMA 1PRNA 4FRTA 4G76A 7PRNA 4QQ1A 2K0LA 4D65A 4AFKA 3VE1A 1Q9GA 1BXWA 2OMFA 3K19A 5AFUL 3QRAA 4O4XA 4AYNA 2Y0LA 4KR8A 5FVNA 1QJPA 1OPFA 3FYXA 1GFMA 2GE4A 1GFOA 2M06A 3T20A 4FZNA 4AYDC 2YNKA 3AA0A 1MM4A 3SY9A 2FGRA 4FSPA 2MNHA 3JTYA 2XE2A 3V8UA 2K4TA 1GFPA 4N59A 3LK42 4RJWA 3AA1B 2QTKA 3QRCA 4O3YA 5ADXK 4O3XB 3LK3A 1HXTA 3O0EA 4AYEC 4O3WA 4D5UA 3POQA 3POXA 1GFQA 3AAEA 4GCQA 4O3ZA 3VY8X 2PRNA 2J4UP 4F4BA 2KXPA 3HWBA 4FRXA 2F1VA 3T24A 4B61A 4FOZA 2XE3A 2O4VA 1Q9FA 3EMNX 8PRNA 4RL9A 4N58A 1ZHTA 1HXUA 4RLBA 3SYBA 4AYMC 1IZNB 1MPFA 3GP6A 4GCSA 5DL5A 4FMSA 4GCPA 4JCHA 3POUA 5GV0A 1YS5A 4U9CA 1ZHYA 2KXPB 4O4UA 2XMXA 5DL8A 1P4TA 3AAEB 2LHFA 4Z3TA 5JDPA 1ZHZA 3C5OA 1HXXA 3AA1A 3G7GA 4LSEA 5D5DA 4FZLA 2ZFGA 5IYUA 3RBHA 2ODJA 1E54A 3A2SX 4GF4A 2XE5A 2KC0A 3LK3B 3WI5A 2XTRA 2XE1A 1MM5A 3AA7A 3AA0B 2XTQA 3AAAA 3UPGA 4GHBA 2X27X 1BH3A 1THQA 3HW9A 3AAAB 5EE2A 5G26A 1QJ8A 5PRNA 4XNKA 3AA7B 2Y0KA 2MHLA 3UU2A 4C69X 1BT9A 2Y2XA 3DA4A 3KVDD 4KRAA 1PHOA 5DL7A 6PRNA 1ZHWA 3VY9X 5ADXL 1ZHXA 4LSIA 4FSOA 4PUXA 5T5FA 2YPVA 2KZ7A 4AKRA 4LSHA 3UAQA 4AZLA 2W80C 3LK2A 1G90A 4FESA 4FT6A 4FZMA 3WI4A 2XG6A 3VZUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJX A;  1OSM A;  2FGQ X;  1GFN A;  3T0S A;  1H6S 1;  3SZV A;  3NSG A;  5DL6 A;  3PRN A;  2ZLD A;  3SYS A;  4D64 A;  2Y0H A;  3SZD A;  4KR4 A;  2J1N A;  2POR A;  4BUM X;  4JFB A;  4LSF A;  3POR A;  3VZW X;  3VZT X;  4AUI A;  3SY7 A;  1PRN A;  4FRT A;  7PRN A;  4D65 A;  2OMF A;  3K19 A;  2Y0L A;  4KR8 A;  5FVN A;  1OPF A;  3FYX A;  1GFM A;  1GFO A;  3T20 A;  3SY9 A;  2FGR A;  4FSP A;  3JTY A;  2XE2 A;  2K4T A;  1GFP A;  4RJW A;  2QTK A;  1HXT A;  3O0E A;  4D5U A;  3POQ A;  3POX A;  1GFQ A;  4GCQ A;  3VY8 X;  2PRN A;  2J4U P;  3HWB A;  4FRX A;  3T24 A;  4FOZ A;  2XE3 A;  2O4V A;  3EMN X;  8PRN A;  1HXU A;  3SYB A;  1MPF A;  4GCS A;  5DL5 A;  4FMS A;  4GCP A;  3POU A;  5DL8 A;  5JDP A;  4LSE A;  1HXX A;  2ZFG A;  2ODJ A;  1E54 A;  3A2S X;  2XE5 A;  3WI5 A;  2XE1 A;  3UPG A;  1BH3 A;  3HW9 A;  5PRN A;  2Y0K A;  3UU2 A;  4C69 X;  1BT9 A;  2Y2X A;  4KRA A;  1PHO A;  5DL7 A;  6PRN A;  3VY9 X;  4LSI A;  4FSO A;  4LSH A;  4FT6 A;  3WI4 A;  2XG6 A;  3VZU X; 
#chains in the Genus database with same CATH topology
 4RJX A;  1OSM A;  4N75 A;  2FGQ X;  1GFN A;  2R4L A;  1QJ9 A;  3T0S A;  5KAI O;  1H6S 1;  2M07 A;  3KZI O;  4E1T A;  3PF1 A;  5E79 O;  3SZV A;  3NSG A;  2ERV A;  3AA6 A;  5DL6 A;  3PRN A;  2ZLD A;  4IL6 O;  4N74 A;  4XNL A;  3SYS A;  4D64 A;  4FQE A;  2Y0H A;  3DA3 A;  1IZN A;  3SZD A;  3JCU O;  3PGU A;  4KR4 A;  2J1N A;  4G75 A;  1S5L O;  4RLC A;  4AKM A;  3BRZ A;  4PJ0 O;  5B66 O;  2F1C X;  2LFU A;  3TZG A;  2POR A;  1T1L A;  4FUV A;  3AA6 B;  5GTI O;  3VE2 A;  1ORM A;  4BUM X;  4JFB A;  4LSF A;  5B5E O;  2Y7S A;  2KDY A;  3POR A;  3NJT A;  5AFU K;  3VZW X;  3VZT X;  2F1T A;  3HOE A;  4O49 A;  2W81 C;  3LK4 1;  3HOL A;  3LK2 B;  3PQS A;  4K3C A;  3PQU A;  2KZ7 B;  4AKR B;  4E1S A;  4AUI A;  2R88 A;  2N2M A;  4UB6 O;  4C4V B;  3WU2 O;  2N2L A;  5G3A A;  5TIS O;  3SY7 A;  4AYI D;  2JMM A;  1PRN A;  4FRT A;  4G76 A;  7PRN A;  4QQ1 A;  2K0L A;  4D65 A;  4AFK A;  3VE1 A;  1Q9G A;  1BXW A;  2OMF A;  3K19 A;  5AFU L;  4UB8 O;  3QRA A;  4C00 A;  2WJQ A;  4O4X A;  4AYN A;  2Y0L A;  4KR8 A;  5FVN A;  1QJP A;  1OPF A;  3FYX A;  1GFM A;  2GE4 A;  1GFO A;  2M06 A;  3T20 A;  4FZN A;  4AYD C;  2YNK A;  3AA0 A;  1MM4 A;  3SY9 A;  2FGR A;  3DZM A;  4FSP A;  2R4P A;  2MNH A;  3JTY A;  2XE2 A;  3DWO X;  3V8U A;  5G38 A;  2K4T A;  1GFP A;  4N59 A;  3LK4 2;  4RJW A;  3AA1 B;  2QTK A;  3QRC A;  4O3Y A;  5ADX K;  2WJR A;  4O3X B;  3LK3 A;  1HXT A;  3O0E A;  4AYE C;  4O3W A;  4D5U A;  2IWW A;  3POQ A;  3POX A;  1GFQ A;  3AAE A;  4GCQ A;  4O3Z A;  3VY8 X;  2PRN A;  2J4U P;  4F4B A;  2KXP A;  3HWB A;  2IWV A;  4FRX A;  5H2F O;  3A0H O;  2F1V A;  3T24 A;  4B61 A;  5GTH O;  4FOZ A;  2XE3 A;  2O4V A;  1Q9F A;  3EMN X;  3A0B O;  8PRN A;  4RL9 A;  4N58 A;  1ZHT A;  1HXU A;  4RLB A;  3SYB A;  4AYM C;  1IZN B;  2R4O A;  1MPF A;  2JQY A;  2R8A A;  1T16 A;  3GP6 A;  3PGR A;  2WVP A;  4GCS A;  5DL5 A;  4FMS A;  4GCP A;  4CTD A;  2R4N A;  4JCH A;  3POU A;  4K3B A;  5G39 A;  5GV0 A;  1YS5 A;  3BS0 A;  1ZHY A;  2KXP B;  4U9C A;  4O4U A;  2XMX A;  3BRY A;  3PGS A;  5DL8 A;  1P4T A;  3AAE B;  2LHF A;  4Z3T A;  5JDP A;  1ZHZ A;  3C5O A;  1HXX A;  3AA1 A;  3G7G A;  4LSE A;  5D5D A;  4FZL A;  2ZFG A;  5IYU A;  3RBH A;  2ODJ A;  1E54 A;  3A2S X;  4GF4 A;  2XE5 A;  2KC0 A;  3LK3 B;  3WI5 A;  2XTR A;  2XE1 A;  1MM5 A;  3AA7 A;  3AA0 B;  3DWN A;  2R89 A;  2XTQ A;  3AAA A;  3UPG A;  4GHB A;  2X27 X;  1BH3 A;  1THQ A;  2X9K A;  3AAA B;  3HW9 A;  5EE2 A;  5G26 A;  1QJ8 A;  5PRN A;  4XNK A;  3AA7 B;  2Y0K A;  2MHL A;  2AXT O;  5KAF O;  1BT9 A;  2Y2X A;  3DA4 A;  3KVD D;  4KRA A;  3UU2 A;  1PHO A;  4C69 X;  5DL7 A;  6PRN A;  1ZHW A;  3VY9 X;  5ADX L;  4C4V A;  1ZHX A;  4LSI A;  4FSO A;  4PUX A;  5T5F A;  2YPV A;  2KZ7 A;  4AKR A;  4LSH A;  3UAQ A;  4AZL A;  2W80 C;  3LK2 A;  1G90 A;  4FES A;  4FT6 A;  4PR7 A;  4FZM A;  3WI4 A;  2XG6 A;  3VZU X; 
#chains in the Genus database with same CATH homology
 4RJX A;  1OSM A;  2FGQ X;  1GFN A;  1QJ9 A;  3T0S A;  1H6S 1;  2M07 A;  4E1T A;  3SZV A;  3NSG A;  2ERV A;  3AA6 A;  5DL6 A;  3PRN A;  2ZLD A;  3SYS A;  4D64 A;  4XNL A;  2Y0H A;  3DA3 A;  1IZN A;  3SZD A;  4KR4 A;  2J1N A;  4G75 A;  4RLC A;  4AKM A;  2LFU A;  3TZG A;  2POR A;  4FUV A;  3VE2 A;  3AA6 B;  4BUM X;  1ORM A;  4JFB A;  4LSF A;  2Y7S A;  2KDY A;  3POR A;  5AFU K;  3VZW X;  3VZT X;  2F1T A;  3HOE A;  4O49 A;  2W81 C;  3LK4 1;  3HOL A;  3LK2 B;  3PQS A;  3PQU A;  2KZ7 B;  4AKR B;  4E1S A;  4AUI A;  2N2M A;  2N2L A;  3SY7 A;  4AYI D;  2JMM A;  1PRN A;  4FRT A;  4G76 A;  7PRN A;  4QQ1 A;  2K0L A;  4D65 A;  4AFK A;  3VE1 A;  1Q9G A;  1BXW A;  2OMF A;  3K19 A;  5AFU L;  3QRA A;  4O4X A;  4AYN A;  2Y0L A;  4KR8 A;  5FVN A;  1QJP A;  1OPF A;  3FYX A;  1GFM A;  2GE4 A;  1GFO A;  2M06 A;  3T20 A;  4FZN A;  4AYD C;  2YNK A;  3AA0 A;  1MM4 A;  3SY9 A;  2FGR A;  4FSP A;  2MNH A;  3JTY A;  2XE2 A;  3V8U A;  2K4T A;  1GFP A;  4N59 A;  3LK4 2;  4RJW A;  3AA1 B;  2QTK A;  3QRC A;  4O3Y A;  5ADX K;  4O3X B;  3LK3 A;  1HXT A;  3O0E A;  4AYE C;  4O3W A;  4D5U A;  3POQ A;  3POX A;  1GFQ A;  3AAE A;  4GCQ A;  4O3Z A;  3VY8 X;  2PRN A;  2J4U P;  4F4B A;  2KXP A;  3HWB A;  4FRX A;  2F1V A;  3T24 A;  4B61 A;  4FOZ A;  2XE3 A;  2O4V A;  1Q9F A;  3EMN X;  8PRN A;  4RL9 A;  4N58 A;  1ZHT A;  1HXU A;  4RLB A;  3SYB A;  4AYM C;  1IZN B;  1MPF A;  3GP6 A;  4GCS A;  5DL5 A;  4FMS A;  4GCP A;  4JCH A;  3POU A;  5GV0 A;  1YS5 A;  4U9C A;  1ZHY A;  2KXP B;  4O4U A;  2XMX A;  5DL8 A;  1P4T A;  3AAE B;  2LHF A;  4Z3T A;  5JDP A;  1ZHZ A;  3C5O A;  1HXX A;  3AA1 A;  3G7G A;  4LSE A;  5D5D A;  4FZL A;  2ZFG A;  5IYU A;  3RBH A;  2ODJ A;  1E54 A;  3A2S X;  4GF4 A;  2XE5 A;  2KC0 A;  3LK3 B;  3WI5 A;  2XTR A;  2XE1 A;  1MM5 A;  3AA7 A;  3AA0 B;  2XTQ A;  3AAA A;  3UPG A;  4GHB A;  2X27 X;  1BH3 A;  1THQ A;  3HW9 A;  3AAA B;  5EE2 A;  5G26 A;  1QJ8 A;  5PRN A;  4XNK A;  3AA7 B;  2Y0K A;  2MHL A;  3UU2 A;  4C69 X;  1BT9 A;  2Y2X A;  3DA4 A;  3KVD D;  4KRA A;  1PHO A;  5DL7 A;  6PRN A;  1ZHW A;  3VY9 X;  5ADX L;  1ZHX A;  4LSI A;  4FSO A;  4PUX A;  5T5F A;  2YPV A;  2KZ7 A;  4AKR A;  4LSH A;  3UAQ A;  4AZL A;  2W80 C;  3LK2 A;  1G90 A;  4FES A;  4FT6 A;  4FZM A;  3WI4 A;  2XG6 A;  3VZU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...