3PGUA

Phe3glu mutant of ecfadl
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
425
structure length
408
Chain Sequence
AGEQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGRAFNNYGLQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 129
structure length 408
sequence length 425
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pguA00
3PF1A 3DWNA 2R4PA 1T1LA 2R88A 3PGSA 3BRYA 2R89A 3BRZA 2R4OA 3PGRA 3DWOX 3BS0A 2R8AA 1T16A 3PGUA 2R4NA 2R4LA
chains in the Genus database with same CATH superfamily
3HOEA 1MM5A 3A0BO 4Z3TA 2R4OA 4FQEA 4E1SA 1ZHTA 4JCHA 5GV0A 1MM4A 3LK3B 4FZMA 4UB6O 4D65A 1IZNB 3PGRA 5B66O 2FGRA 2PORA 1MPFA 4KR8A 1BH3A 4AUIA 8PRNA 5IYUA 2XE3A 3LK3A 2X27X 1HXTA 1IZNA 1ZHXA 4K3CA 2GE4A 4XNLA 3VE1A 4FZLA 4E1TA 4IL6O 2K0LA 3AA1B 2Y0HA 2ERVA 4LSHA 4BUMX 4FSOA 3SY7A 4CTDA 2W81C 2O4VA 3AA1A 4KRAA 4AYDC 5PRNA 1HXXA 5ADXK 3A0HO 1S5LO 2LHFA 3AAEB 2YPVA 4GHBA 2W80C 3POUA 4FSPA 3NSGA 3HWBA 1T1LA 2K4TA 3AAEA 3DA3A 4PJ0O 4C00A 3T0SA 2KZ7B 3NJTA 3AAAB 5DL5A 4K3BA 1T16A 3C5OA 2KZ7A 3PRNA 4C4VB 5H2FO 3GP6A 5G3AA 2MNHA 4JFBA 3UU2A 4C4VA 2M06A 2JQYA 3KZIO 4GCSA 2J1NA 2QTKA 3O0EA 4O49A 4RJWA 5AFUL 1OPFA 2WJQA 1OSMA 4GCPA 5KAFO 1THQA 5GTHO 1PRNA 3BRZA 5D5DA 3VE2A 3RBHA 4O4XA 2WVPA 3PQUA 2KC0A 2OMFA 5GTIO 1ZHZA 2FGQX 3AA0B 1BXWA 2Y0KA 4LSEA 4O3YA 3POQA 4G75A 5DL6A 1ZHYA 5E79O 4C69X 5KAIO 1Q9FA 4N74A 2ZFGA 2Y7SA 2N2MA 3SY9A 3PF1A 3TZGA 2XE2A 3DZMA 1ZHWA 4FESA 6PRNA 3PORA 2XG6A 5FVNA 4G76A 5EE2A 3QRCA 3HW9A 3VZUX 3DWOX 3T20A 3UPGA 1BT9A 3QRAA 4O3WA 3DWNA 4O3ZA 1H6S1 2R4PA 2R88A 3SZVA 3AAAA 4N58A 5T5FA 3VY9X 4AKRB 5G26A 4KR4A 4RJXA 3WI4A 4AKRA 3LK41 3AA6B 4AYNA 3VZTX 1E54A 5TISO 2XTRA 4QQ1A 4PUXA 1HXUA 4AKMA 3AA6A 1QJPA 4RLBA 4AFKA 4FT6A 4D5UA 4FUVA 3AA7B 3SZDA 4F4BA 3HOLA 3PQSA 5AFUK 4AYEC 5B5EO 3AA7A 3G7GA 3T24A 4FRTA 2IWWA 3AA0A 2XE1A 3POXA 5G38A 3BRYA 2X9KA 4N75A 2MHLA 1Q9GA 1YS5A 3LK2B 2R89A 1G90A 2LFUA 3LK42 4AZLA 1ORMA 3LK2A 3WU2O 3SYSA 4RL9A 2F1VA 4LSIA 5G39A 2PRNA 1GFMA 3JTYA 2F1CX 2Y0LA 3PGSA 4XNKA 4FZNA 3VZWX 2JMMA 2WJRA 2KDYA 3UAQA 2AXTO 3BS0A 1GFPA 2KXPB 2J4UP 2XTQA 3K19A 2XMXA 3JCUO 3KVDD 2KXPA 4LSFA 1QJ9A 4PR7A 3EMNX 5ADXL 4GCQA 3SYBA 4B61A 4FMSA 2N2LA 2Y2XA 3A2SX 1GFOA 3PGUA 1QJ8A 2R4NA 3WI5A 2ZLDA 4N59A 1P4TA 4AYMC 4UB8O 4U9CA 5DL8A 4FOZA 1GFQA 4O4UA 5JDPA 1GFNA 3V8UA 7PRNA 4RLCA 4D64A 4FRXA 4GF4A 3VY8X 3DA4A 2ODJA 3FYXA 2F1TA 5DL7A 2IWVA 2XE5A 2M07A 1PHOA 4AYID 2YNKA 2R8AA 4O3XB 2R4LA
chains in the Genus database with same CATH topology
3PF1A 3DWNA 2R4PA 1T1LA 2R88A 3PGSA 3BRYA 2R89A 3BRZA 2R4OA 3PGRA 3DWOX 3BS0A 2R8AA 1T16A 3PGUA 2R4NA 2R4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PF1 A;  3DWN A;  2R4P A;  1T1L A;  2R88 A;  3PGS A;  3BRY A;  2R89 A;  3BRZ A;  2R4O A;  3PGR A;  3DWO X;  3BS0 A;  2R8A A;  1T16 A;  3PGU A;  2R4N A;  2R4L A; 
#chains in the Genus database with same CATH topology
 3HOE A;  1MM5 A;  3A0B O;  4Z3T A;  2R4O A;  4FQE A;  4E1S A;  1ZHT A;  4JCH A;  5GV0 A;  1MM4 A;  3LK3 B;  4FZM A;  4UB6 O;  4D65 A;  1IZN B;  3PGR A;  5B66 O;  2FGR A;  2POR A;  1MPF A;  4KR8 A;  1BH3 A;  4AUI A;  8PRN A;  5IYU A;  2XE3 A;  3LK3 A;  2X27 X;  1HXT A;  1IZN A;  1ZHX A;  4K3C A;  2GE4 A;  4XNL A;  3VE1 A;  4FZL A;  4E1T A;  4IL6 O;  2K0L A;  3AA1 B;  2Y0H A;  2ERV A;  4LSH A;  4BUM X;  4FSO A;  3SY7 A;  4CTD A;  2W81 C;  2O4V A;  3AA1 A;  4KRA A;  4AYD C;  5PRN A;  1HXX A;  5ADX K;  3A0H O;  1S5L O;  2LHF A;  3AAE B;  2YPV A;  4GHB A;  2W80 C;  3POU A;  4FSP A;  3NSG A;  3HWB A;  1T1L A;  2K4T A;  3AAE A;  3DA3 A;  4PJ0 O;  4C00 A;  3T0S A;  2KZ7 B;  3NJT A;  3AAA B;  5DL5 A;  4K3B A;  1T16 A;  3C5O A;  2KZ7 A;  3PRN A;  4C4V B;  5H2F O;  3GP6 A;  5G3A A;  2MNH A;  4JFB A;  3UU2 A;  4C4V A;  2M06 A;  2JQY A;  3KZI O;  4GCS A;  2J1N A;  2QTK A;  3O0E A;  4O49 A;  4RJW A;  5AFU L;  1OPF A;  2WJQ A;  1OSM A;  4GCP A;  5KAF O;  1THQ A;  5GTH O;  1PRN A;  3BRZ A;  5D5D A;  3VE2 A;  3RBH A;  4O4X A;  2WVP A;  3PQU A;  2KC0 A;  2OMF A;  5GTI O;  1ZHZ A;  2FGQ X;  3AA0 B;  1BXW A;  2Y0K A;  4LSE A;  4O3Y A;  3POQ A;  4G75 A;  5DL6 A;  1ZHY A;  5E79 O;  4C69 X;  5KAI O;  1Q9F A;  4N74 A;  2ZFG A;  2Y7S A;  2N2M A;  3SY9 A;  3PF1 A;  3TZG A;  2XE2 A;  3DZM A;  1ZHW A;  4FES A;  6PRN A;  3POR A;  2XG6 A;  5FVN A;  4G76 A;  5EE2 A;  3QRC A;  3HW9 A;  3VZU X;  3DWO X;  3T20 A;  3UPG A;  1BT9 A;  3QRA A;  4O3W A;  3DWN A;  4O3Z A;  1H6S 1;  2R4P A;  2R88 A;  3SZV A;  3AAA A;  4N58 A;  5T5F A;  3VY9 X;  4AKR B;  5G26 A;  4KR4 A;  4RJX A;  3WI4 A;  4AKR A;  3LK4 1;  3AA6 B;  4AYN A;  3VZT X;  1E54 A;  5TIS O;  2XTR A;  4QQ1 A;  4PUX A;  1HXU A;  4AKM A;  3AA6 A;  1QJP A;  4RLB A;  4AFK A;  4FT6 A;  4D5U A;  4FUV A;  3AA7 B;  3SZD A;  4F4B A;  3HOL A;  3PQS A;  5AFU K;  4AYE C;  5B5E O;  3AA7 A;  3G7G A;  3T24 A;  4FRT A;  2IWW A;  3AA0 A;  2XE1 A;  3POX A;  5G38 A;  3BRY A;  2X9K A;  4N75 A;  2MHL A;  1Q9G A;  1YS5 A;  3LK2 B;  2R89 A;  1G90 A;  2LFU A;  3LK4 2;  4AZL A;  1ORM A;  3LK2 A;  3WU2 O;  3SYS A;  4RL9 A;  2F1V A;  4LSI A;  5G39 A;  2PRN A;  1GFM A;  3JTY A;  2F1C X;  2Y0L A;  3PGS A;  4XNK A;  4FZN A;  3VZW X;  2JMM A;  2WJR A;  2KDY A;  3UAQ A;  2AXT O;  3BS0 A;  1GFP A;  2KXP B;  2J4U P;  2XTQ A;  3K19 A;  2XMX A;  3JCU O;  3KVD D;  2KXP A;  4LSF A;  1QJ9 A;  4PR7 A;  3EMN X;  5ADX L;  4GCQ A;  3SYB A;  4B61 A;  4FMS A;  2N2L A;  2Y2X A;  3A2S X;  1GFO A;  3PGU A;  1QJ8 A;  2R4N A;  3WI5 A;  2ZLD A;  4N59 A;  1P4T A;  4AYM C;  4UB8 O;  4U9C A;  5DL8 A;  4FOZ A;  1GFQ A;  4O4U A;  5JDP A;  1GFN A;  3V8U A;  7PRN A;  4RLC A;  4D64 A;  4FRX A;  4GF4 A;  3VY8 X;  3DA4 A;  2ODJ A;  3FYX A;  2F1T A;  5DL7 A;  2IWV A;  2XE5 A;  2M07 A;  1PHO A;  4AYI D;  2YNK A;  2R8A A;  4O3X B;  2R4L A; 
#chains in the Genus database with same CATH homology
 3PF1 A;  3DWN A;  2R4P A;  1T1L A;  2R88 A;  3PGS A;  3BRY A;  2R89 A;  3BRZ A;  2R4O A;  3PGR A;  3DWO X;  3BS0 A;  2R8A A;  1T16 A;  3PGU A;  2R4N A;  2R4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...