3PGUA

Phe3glu mutant of ecfadl
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
425
structure length
408
Chain Sequence
b'AGEQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGRAFNNYGLQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
total genus 129
structure length 408
sequence length 425
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pguA00
2R4OA 3DWOX 2R4PA 2R8AA 2R4LA 3PGUA 3BRZA 3PGSA 1T1LA 1T16A 3PF1A 3PGRA 3BS0A 3DWNA 2R89A 2R88A 2R4NA 3BRYA
chains in the Genus database with same CATH superfamily
2K4TA 4E1TA 4D65A 4AYEC 5GTIO 2W81C 4PJ0O 2N2LA 4FZNA 3RBHA 4C4VB 3PORA 4GCPA 2XTQA 2FGRA 3HOLA 2ODJA 3C5OA 2Y2XA 4FRXA 4PR7A 3FYXA 3PQSA 2XMXA 1GFOA 1T16A 1T1LA 3PGRA 3HW9A 5G26A 4E1SA 3DWNA 3VZWX 4FUVA 4XNKA 4FRTA 2WJRA 3T24A 2JMMA 4N75A 5IYUA 1QJ8A 1BT9A 2R4LA 2LHFA 1THQA 3LK2B 1IZNB 2MNHA 1ZHTA 2PRNA 1Q9FA 2WJQA 2XE2A 4FMSA 2XG6A 4RLBA 3T0SA 4LSFA 5B5EO 1OSMA 3PQUA 5G39A 3G7GA 4O49A 2FGQX 2Y0KA 3A0HO 3AA1A 3PGUA 3AA7B 3UU2A 4N74A 1GFNA 5G3AA 3SZDA 3LK3A 3PRNA 3EMNX 4LSIA 4RLCA 3DWOX 3VZTX 4BUMX 1ZHWA 1PRNA 4LSEA 4C4VA 1HXTA 1P4TA 4FESA 4FSPA 5FVNA 4O4UA 4RL9A 2Y0HA 3LK41 3SZVA 5JDPA 2KZ7A 4N59A 5DL8A 2F1CX 3AAEB 2QTKA 3AA6A 3VZUX 4AFKA 2ERVA 2N2MA 2ZLDA 5TISO 4UB8O 1GFQA 2JQYA 4N58A 5B66O 8PRNA 5H2FO 1H6S1 4AKRA 2KXPA 3UPGA 4GCSA 3LK2A 3AA0A 7PRNA 2YPVA 3AAAA 1E54A 1HXXA 3HWBA 3SYSA 4C69X 5GV0A 2R4OA 2W80C 1HXUA 2Y0LA 4O3XB 5DL5A 3SYBA 2F1TA 5EE2A 4C00A 5T5FA 2XTRA 4KR4A 1BH3A 3V8UA 4GCQA 2PORA 1ZHZA 3UAQA 2LFUA 3T20A 4RJWA 2O4VA 4KR8A 4PUXA 4FZMA 1YS5A 3SY9A 5DL7A 1PHOA 2OMFA 3DA3A 4XNLA 1Q9GA 4KRAA 3VY8X 2ZFGA 4K3CA 2X9KA 5AFUL 4O3YA 3PGSA 2Y7SA 1GFMA 3POQA 5ADXL 3A2SX 3BS0A 3WI4A 4FQEA 2XE5A 5KAIO 1ORMA 3BRYA 1BXWA 3NJTA 4AYDC 2R8AA 5AFUK 2X27X 3POXA 2MHLA 3NSGA 1IZNA 5ADXK 2IWWA 4IL6O 4O4XA 2M06A 2J1NA 1OPFA 3A0BO 3O0EA 1QJ9A 4O3WA 1GFPA 5G38A 3WU2O 4AYMC 3AA1B 3AA7A 3KVDD 2KC0A 4B61A 4F4BA 3VE2A 2J4UP 3WI5A 4AYNA 3LK3B 4K3BA 2R89A 4U9CA 5GTHO 3VE1A 4JFBA 4O3ZA 2K0LA 3BRZA 1MM5A 3JCUO 3DA4A 3GP6A 4QQ1A 4AKMA 1MM4A 4G75A 4FOZA 3HOEA 4FSOA 2KZ7B 3AAEA 3KZIO 3LK42 4G76A 4RJXA 4FT6A 3QRCA 3AA6B 3SY7A 3POUA 2F1VA 3TZGA 4AUIA 3JTYA 2KDYA 3DZMA 2XE1A 4Z3TA 2GE4A 4AYID 4AKRB 2YNKA 2IWVA 2R4NA 2XE3A 5DL6A 1S5LO 2KXPB 4UB6O 5PRNA 4D64A 1G90A 1MPFA 2AXTO 1QJPA 3AA0B 4AZLA 4JCHA 3AAAB 1ZHYA 3K19A 2R88A 5KAFO 4LSHA 4D5UA 4GF4A 6PRNA 2M07A 2R4PA 4FZLA 4CTDA 1ZHXA 2WVPA 3PF1A 5D5DA 3VY9X 3QRAA 4GHBA 5E79O
chains in the Genus database with same CATH topology
2R4OA 3DWOX 2R4PA 2R8AA 2R4LA 3PGUA 3BRZA 3PGSA 1T1LA 1T16A 3PF1A 3PGRA 3BS0A 3DWNA 2R89A 2R88A 2R4NA 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4O A;  3DWO X;  2R4P A;  2R8A A;  2R4L A;  3PGU A;  3BRZ A;  3PGS A;  1T1L A;  1T16 A;  3PF1 A;  3PGR A;  3BS0 A;  3DWN A;  2R89 A;  2R88 A;  2R4N A;  3BRY A; 
#chains in the Genus database with same CATH topology
 2K4T A;  4E1T A;  4D65 A;  4AYE C;  5GTI O;  2W81 C;  4PJ0 O;  2N2L A;  4FZN A;  3RBH A;  4C4V B;  3POR A;  4GCP A;  2XTQ A;  2FGR A;  3HOL A;  2ODJ A;  3C5O A;  2Y2X A;  4FRX A;  4PR7 A;  3FYX A;  3PQS A;  2XMX A;  1GFO A;  1T16 A;  1T1L A;  3PGR A;  3HW9 A;  5G26 A;  4E1S A;  3DWN A;  3VZW X;  4FUV A;  4XNK A;  4FRT A;  2WJR A;  3T24 A;  2JMM A;  4N75 A;  5IYU A;  1QJ8 A;  1BT9 A;  2R4L A;  2LHF A;  1THQ A;  3LK2 B;  1IZN B;  2MNH A;  1ZHT A;  2PRN A;  1Q9F A;  2WJQ A;  2XE2 A;  4FMS A;  2XG6 A;  4RLB A;  3T0S A;  4LSF A;  5B5E O;  1OSM A;  3PQU A;  5G39 A;  3G7G A;  4O49 A;  2FGQ X;  2Y0K A;  3A0H O;  3AA1 A;  3PGU A;  3AA7 B;  3UU2 A;  4N74 A;  1GFN A;  5G3A A;  3SZD A;  3LK3 A;  3PRN A;  3EMN X;  4LSI A;  4RLC A;  3DWO X;  3VZT X;  4BUM X;  1ZHW A;  1PRN A;  4LSE A;  4C4V A;  1HXT A;  1P4T A;  4FES A;  4FSP A;  5FVN A;  4O4U A;  4RL9 A;  2Y0H A;  3LK4 1;  3SZV A;  5JDP A;  2KZ7 A;  4N59 A;  5DL8 A;  2F1C X;  3AAE B;  2QTK A;  3AA6 A;  3VZU X;  4AFK A;  2ERV A;  2N2M A;  2ZLD A;  5TIS O;  4UB8 O;  1GFQ A;  2JQY A;  4N58 A;  5B66 O;  8PRN A;  5H2F O;  1H6S 1;  4AKR A;  2KXP A;  3UPG A;  4GCS A;  3LK2 A;  3AA0 A;  7PRN A;  2YPV A;  3AAA A;  1E54 A;  1HXX A;  3HWB A;  3SYS A;  4C69 X;  5GV0 A;  2R4O A;  2W80 C;  1HXU A;  2Y0L A;  4O3X B;  5DL5 A;  3SYB A;  2F1T A;  5EE2 A;  4C00 A;  5T5F A;  2XTR A;  4KR4 A;  1BH3 A;  3V8U A;  4GCQ A;  2POR A;  1ZHZ A;  3UAQ A;  2LFU A;  3T20 A;  4RJW A;  2O4V A;  4KR8 A;  4PUX A;  4FZM A;  1YS5 A;  3SY9 A;  5DL7 A;  1PHO A;  2OMF A;  3DA3 A;  4XNL A;  1Q9G A;  4KRA A;  3VY8 X;  2ZFG A;  4K3C A;  2X9K A;  5AFU L;  4O3Y A;  3PGS A;  2Y7S A;  1GFM A;  3POQ A;  5ADX L;  3A2S X;  3BS0 A;  3WI4 A;  4FQE A;  2XE5 A;  5KAI O;  1ORM A;  3BRY A;  1BXW A;  3NJT A;  4AYD C;  2R8A A;  5AFU K;  2X27 X;  3POX A;  2MHL A;  3NSG A;  1IZN A;  5ADX K;  2IWW A;  4IL6 O;  4O4X A;  2M06 A;  2J1N A;  1OPF A;  3A0B O;  3O0E A;  1QJ9 A;  4O3W A;  1GFP A;  5G38 A;  3WU2 O;  4AYM C;  3AA1 B;  3AA7 A;  3KVD D;  2KC0 A;  4B61 A;  4F4B A;  3VE2 A;  2J4U P;  3WI5 A;  4AYN A;  3LK3 B;  4K3B A;  2R89 A;  4U9C A;  5GTH O;  3VE1 A;  4JFB A;  4O3Z A;  2K0L A;  3BRZ A;  1MM5 A;  3JCU O;  3DA4 A;  3GP6 A;  4QQ1 A;  4AKM A;  1MM4 A;  4G75 A;  4FOZ A;  3HOE A;  4FSO A;  2KZ7 B;  3AAE A;  3KZI O;  3LK4 2;  4G76 A;  4RJX A;  4FT6 A;  3QRC A;  3AA6 B;  3SY7 A;  3POU A;  2F1V A;  3TZG A;  4AUI A;  3JTY A;  2KDY A;  3DZM A;  2XE1 A;  4Z3T A;  2GE4 A;  4AYI D;  4AKR B;  2YNK A;  2IWV A;  2R4N A;  2XE3 A;  5DL6 A;  1S5L O;  2KXP B;  4UB6 O;  5PRN A;  4D64 A;  1G90 A;  1MPF A;  2AXT O;  1QJP A;  3AA0 B;  4AZL A;  4JCH A;  3AAA B;  1ZHY A;  3K19 A;  2R88 A;  5KAF O;  4LSH A;  4D5U A;  4GF4 A;  6PRN A;  2M07 A;  2R4P A;  4FZL A;  4CTD A;  1ZHX A;  2WVP A;  3PF1 A;  5D5D A;  3VY9 X;  3QRA A;  4GHB A;  5E79 O; 
#chains in the Genus database with same CATH homology
 2R4O A;  3DWO X;  2R4P A;  2R8A A;  2R4L A;  3PGU A;  3BRZ A;  3PGS A;  1T1L A;  1T16 A;  3PF1 A;  3PGR A;  3BS0 A;  3DWN A;  2R89 A;  2R88 A;  2R4N A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...