3PGUA

Phe3glu mutant of ecfadl
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
425
structure length
408
Chain Sequence
AGEQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGRAFNNYGLQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 129
structure length 408
sequence length 425
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pguA00
1T16A 3DWOX 2R4LA 2R89A 3BRZA 3DWNA 3PF1A 3PGUA 3BS0A 1T1LA 2R4OA 3PGRA 3PGSA 2R88A 3BRYA 2R8AA 2R4NA 2R4PA
chains in the Genus database with same CATH superfamily
1GFOA 2KC0A 4N74A 5PRNA 2N2LA 3HOEA 2MHLA 3POUA 3PGRA 4FRTA 2IWVA 3LK3B 2Y0HA 3VE1A 4C00A 2R8AA 1YS5A 3AAAB 1Q9GA 2F1VA 3AA6A 1BXWA 3AAEB 2Y0KA 2W81C 4QQ1A 4RL9A 4AZLA 4D64A 7PRNA 3HWBA 3VZWX 4UB8O 4D65A 3VZUX 3AA6B 4D5UA 1BH3A 3AA7B 1HXTA 3PORA 1GFMA 3QRAA 4E1SA 4E1TA 5GTHO 3AAEA 3A2SX 2QTKA 2WJRA 2XG6A 3JCUO 4FT6A 4GCSA 2Y7SA 1E54A 6PRNA 2KZ7B 3WU2O 1GFPA 4LSHA 3LK2B 1IZNB 5H2FO 5B5EO 1HXUA 5D5DA 3LK2A 4AUIA 1HXXA 5DL7A 1MM4A 1MPFA 4G76A 3GP6A 2W80C 4FUVA 4C4VA 2FGRA 2ODJA 1OPFA 4JFBA 3VY9X 3PGSA 4U9CA 5AFUK 3PQSA 3TZGA 3VZTX 4FOZA 4PR7A 3LK42 3EMNX 2O4VA 4C69X 1ZHTA 1GFNA 4FZMA 4GHBA 5DL5A 3WI5A 1S5LO 4UB6O 1MM5A 2PRNA 2X27X 4N58A 2AXTO 2K0LA 3DWOX 3RBHA 4FRXA 3DZMA 3V8UA 3SZDA 3LK3A 1PHOA 2KXPB 2R4LA 3PGUA 3POXA 3PQUA 1ZHXA 4K3BA 5AFUL 4AYDC 4LSEA 3G7GA 4GCQA 3KZIO 4CTDA 5T5FA 4K3CA 1ORMA 2WVPA 2YNKA 3JTYA 1H6S1 2LHFA 3BS0A 2N2MA 2XE3A 2XTRA 3BRYA 2YPVA 2M07A 4AYMC 5IYUA 3POQA 3DA4A 4AKMA 2JMMA 3SY7A 2J1NA 5E79O 4KR8A 3AA1A 2ERVA 4RJXA 5EE2A 5KAFO 3AA0B 4KRAA 4AKRB 1QJ8A 1GFQA 2MNHA 3NSGA 4O4UA 2R89A 3NJTA 4BUMX 3O0EA 2ZFGA 3LK41 3UU2A 4RJWA 4Z3TA 1PRNA 3VY8X 5G3AA 4FZLA 4G75A 2R4NA 3KVDD 1P4TA 4FMSA 4KR4A 1T16A 5DL8A 5FVNA 3AA1B 3DWNA 3C5OA 3HW9A 4O3YA 4AYID 2Y2XA 4PUXA 2Y0LA 2R4OA 4F4BA 4LSIA 2F1TA 3A0BO 1BT9A 3HOLA 4FSOA 4FZNA 3SZVA 4AYEC 2XE2A 3DA3A 4N75A 2WJQA 1Q9FA 3SY9A 2JQYA 3VE2A 4AFKA 4RLBA 1OSMA 1IZNA 3UAQA 2KDYA 4B61A 4N59A 5GV0A 2KZ7A 3WI4A 4PJ0O 4FQEA 4LSFA 2KXPA 4IL6O 4XNLA 4O4XA 2LFUA 5B66O 2XE1A 1ZHWA 4O49A 5ADXL 2F1CX 2XTQA 3T20A 2M06A 3UPGA 1ZHYA 5TISO 3BRZA 3AA7A 1G90A 4JCHA 5G39A 1THQA 2J4UP 2GE4A 4O3XB 2X9KA 3SYBA 3T24A 4GCPA 5DL6A 5G26A 5G38A 2R4PA 1QJ9A 3AA0A 4AKRA 3AAAA 5ADXK 4FSPA 3PF1A 2IWWA 2OMFA 2PORA 3FYXA 3T0SA 5KAIO 4C4VB 2ZLDA 3SYSA 4GF4A 1ZHZA 2XMXA 4XNKA 2FGQX 4O3ZA 4O3WA 4AYNA 3A0HO 3PRNA 5GTIO 1QJPA 1T1LA 2K4TA 2XE5A 4FESA 2R88A 8PRNA 5JDPA 3K19A 3QRCA 4RLCA
chains in the Genus database with same CATH topology
1T16A 3DWOX 2R4LA 2R89A 3BRZA 3DWNA 3PF1A 3PGUA 3BS0A 1T1LA 2R4OA 3PGRA 3PGSA 2R88A 3BRYA 2R8AA 2R4NA 2R4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T16 A;  3DWO X;  2R4L A;  2R89 A;  3BRZ A;  3DWN A;  3PF1 A;  3PGU A;  3BS0 A;  1T1L A;  2R4O A;  3PGR A;  3PGS A;  2R88 A;  3BRY A;  2R8A A;  2R4N A;  2R4P A; 
#chains in the Genus database with same CATH topology
 1GFO A;  2KC0 A;  4N74 A;  5PRN A;  2N2L A;  3HOE A;  2MHL A;  3POU A;  3PGR A;  4FRT A;  2IWV A;  3LK3 B;  2Y0H A;  3VE1 A;  4C00 A;  2R8A A;  1YS5 A;  3AAA B;  1Q9G A;  2F1V A;  3AA6 A;  1BXW A;  3AAE B;  2Y0K A;  2W81 C;  4QQ1 A;  4RL9 A;  4AZL A;  4D64 A;  7PRN A;  3HWB A;  3VZW X;  4UB8 O;  4D65 A;  3VZU X;  3AA6 B;  4D5U A;  1BH3 A;  3AA7 B;  1HXT A;  3POR A;  1GFM A;  3QRA A;  4E1S A;  4E1T A;  5GTH O;  3AAE A;  3A2S X;  2QTK A;  2WJR A;  2XG6 A;  3JCU O;  4FT6 A;  4GCS A;  2Y7S A;  1E54 A;  6PRN A;  2KZ7 B;  3WU2 O;  1GFP A;  4LSH A;  3LK2 B;  1IZN B;  5H2F O;  5B5E O;  1HXU A;  5D5D A;  3LK2 A;  4AUI A;  1HXX A;  5DL7 A;  1MM4 A;  1MPF A;  4G76 A;  3GP6 A;  2W80 C;  4FUV A;  4C4V A;  2FGR A;  2ODJ A;  1OPF A;  4JFB A;  3VY9 X;  3PGS A;  4U9C A;  5AFU K;  3PQS A;  3TZG A;  3VZT X;  4FOZ A;  4PR7 A;  3LK4 2;  3EMN X;  2O4V A;  4C69 X;  1ZHT A;  1GFN A;  4FZM A;  4GHB A;  5DL5 A;  3WI5 A;  1S5L O;  4UB6 O;  1MM5 A;  2PRN A;  2X27 X;  4N58 A;  2AXT O;  2K0L A;  3DWO X;  3RBH A;  4FRX A;  3DZM A;  3V8U A;  3SZD A;  3LK3 A;  1PHO A;  2KXP B;  2R4L A;  3PGU A;  3POX A;  3PQU A;  1ZHX A;  4K3B A;  5AFU L;  4AYD C;  4LSE A;  3G7G A;  4GCQ A;  3KZI O;  4CTD A;  5T5F A;  4K3C A;  1ORM A;  2WVP A;  2YNK A;  3JTY A;  1H6S 1;  2LHF A;  3BS0 A;  2N2M A;  2XE3 A;  2XTR A;  3BRY A;  2YPV A;  2M07 A;  4AYM C;  5IYU A;  3POQ A;  3DA4 A;  4AKM A;  2JMM A;  3SY7 A;  2J1N A;  5E79 O;  4KR8 A;  3AA1 A;  2ERV A;  4RJX A;  5EE2 A;  5KAF O;  3AA0 B;  4KRA A;  4AKR B;  1QJ8 A;  1GFQ A;  2MNH A;  3NSG A;  4O4U A;  2R89 A;  3NJT A;  4BUM X;  3O0E A;  2ZFG A;  3LK4 1;  3UU2 A;  4RJW A;  4Z3T A;  1PRN A;  3VY8 X;  5G3A A;  4FZL A;  4G75 A;  2R4N A;  3KVD D;  1P4T A;  4FMS A;  4KR4 A;  1T16 A;  5DL8 A;  5FVN A;  3AA1 B;  3DWN A;  3C5O A;  3HW9 A;  4O3Y A;  4AYI D;  2Y2X A;  4PUX A;  2Y0L A;  2R4O A;  4F4B A;  4LSI A;  2F1T A;  3A0B O;  1BT9 A;  3HOL A;  4FSO A;  4FZN A;  3SZV A;  4AYE C;  2XE2 A;  3DA3 A;  4N75 A;  2WJQ A;  1Q9F A;  3SY9 A;  2JQY A;  3VE2 A;  4AFK A;  4RLB A;  1OSM A;  1IZN A;  3UAQ A;  2KDY A;  4B61 A;  4N59 A;  5GV0 A;  2KZ7 A;  3WI4 A;  4PJ0 O;  4FQE A;  4LSF A;  2KXP A;  4IL6 O;  4XNL A;  4O4X A;  2LFU A;  5B66 O;  2XE1 A;  1ZHW A;  4O49 A;  5ADX L;  2F1C X;  2XTQ A;  3T20 A;  2M06 A;  3UPG A;  1ZHY A;  5TIS O;  3BRZ A;  3AA7 A;  1G90 A;  4JCH A;  5G39 A;  1THQ A;  2J4U P;  2GE4 A;  4O3X B;  2X9K A;  3SYB A;  3T24 A;  4GCP A;  5DL6 A;  5G26 A;  5G38 A;  2R4P A;  1QJ9 A;  3AA0 A;  4AKR A;  3AAA A;  5ADX K;  4FSP A;  3PF1 A;  2IWW A;  2OMF A;  2POR A;  3FYX A;  3T0S A;  5KAI O;  4C4V B;  2ZLD A;  3SYS A;  4GF4 A;  1ZHZ A;  2XMX A;  4XNK A;  2FGQ X;  4O3Z A;  4O3W A;  4AYN A;  3A0H O;  3PRN A;  5GTI O;  1QJP A;  1T1L A;  2K4T A;  2XE5 A;  4FES A;  2R88 A;  8PRN A;  5JDP A;  3K19 A;  3QRC A;  4RLC A; 
#chains in the Genus database with same CATH homology
 1T16 A;  3DWO X;  2R4L A;  2R89 A;  3BRZ A;  3DWN A;  3PF1 A;  3PGU A;  3BS0 A;  1T1L A;  2R4O A;  3PGR A;  3PGS A;  2R88 A;  3BRY A;  2R8A A;  2R4N A;  2R4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...