3PGUA

Phe3glu mutant of ecfadl
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
425
structure length
408
Chain Sequence
AGEQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGRAFNNYGLQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
total genus 129
structure length 408
sequence length 425
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pguA00
1T16A 2R4OA 2R89A 3BRZA 3DWOX 2R88A 3PGRA 3BS0A 3BRYA 3DWNA 2R8AA 3PGSA 2R4LA 1T1LA 2R4NA 3PGUA 2R4PA 3PF1A
chains in the Genus database with same CATH superfamily
3HOEA 2XE3A 2XE2A 2W81C 3AA0B 3T0SA 4AFKA 4Z3TA 3AA7B 4PUXA 4K3BA 5H2FO 5ADXL 5GTHO 4CTDA 2LFUA 3G7GA 1Q9FA 1BT9A 3A2SX 5KAFO 4AUIA 4GCQA 1OSMA 5GTIO 2R8AA 2YPVA 4KR8A 4LSFA 5DL5A 4FMSA 2GE4A 4O49A 4FQEA 5B66O 3AAEB 3A0BO 8PRNA 3AA1A 3T20A 3BS0A 5AFUK 1HXXA 4LSEA 2X9KA 4O4XA 4RLCA 4D64A 2ODJA 4FUVA 2FGQX 3LK2B 2QTKA 3QRAA 3V8UA 4FRTA 1ZHTA 3WI4A 2PRNA 5T5FA 2KXPB 2XE1A 2IWVA 2AXTO 4AYDC 2Y7SA 4D65A 2F1TA 4E1SA 4AZLA 5AFUL 2PORA 2XMXA 2K4TA 2Y0LA 2YNKA 4O3ZA 4O4UA 1H6S1 1PHOA 3AA6B 4GF4A 4PJ0O 3POXA 2R4LA 4FOZA 1QJ8A 1T1LA 3PGUA 4FSOA 2J4UP 5PRNA 3T24A 4AKMA 5KAIO 1E54A 3KVDD 4GCPA 4JCHA 5DL7A 4FESA 4C4VB 1GFPA 3C5OA 2M07A 4N58A 2ZLDA 4PR7A 3AAAA 1BXWA 1QJPA 2J1NA 4FT6A 1PRNA 1T16A 2R4OA 4UB8O 1GFNA 4GHBA 1GFQA 4KR4A 5G38A 3VE2A 2FGRA 1IZNA 4IL6O 3SY9A 4FZMA 4XNKA 3SZVA 4C00A 1BH3A 2KZ7A 3POQA 4FSPA 1ZHYA 3LK42 2MHLA 1ZHWA 3DA3A 3HWBA 3NSGA 5GV0A 4N74A 3UPGA 4AYMC 2X27X 6PRNA 3K19A 3NJTA 3VY9X 4O3YA 2MNHA 4G76A 1G90A 3POUA 2ERVA 2ZFGA 4RL9A 4AYNA 2N2MA 5E79O 1OPFA 3SZDA 2WJQA 3TZGA 1THQA 3PQSA 2W80C 1ZHXA 3LK3A 4LSIA 4QQ1A 4FZNA 4BUMX 3AA0A 3AA1B 3VZWX 1IZNB 2XTRA 4D5UA 3AA7A 3WI5A 3A0HO 4O3WA 3PGSA 1P4TA 1MPFA 4AYEC 3PF1A 3SYBA 2M06A 4FZLA 5DL8A 3DWOX 2R89A 1ZHZA 3LK41 4LSHA 5G39A 1YS5A 1S5LO 2WJRA 3HOLA 3PRNA 3VZUX 4B61A 3KZIO 2XTQA 5TISO 3HW9A 2IWWA 3SYSA 2K0LA 5FVNA 5EE2A 5B5EO 3QRCA 4RJWA 3AAEA 2Y0HA 3PGRA 3JCUO 1MM4A 3VE1A 3DWNA 3DA4A 2OMFA 3LK3B 5D5DA 2R4PA 2JQYA 4U9CA 5G3AA 3GP6A 3O0EA 1QJ9A 3LK2A 3DZMA 1GFOA 5IYUA 1Q9GA 3VZTX 2KXPA 4GCSA 4FRXA 2R4NA 3AAAB 3VY8X 4AKRA 2KC0A 1ORMA 3BRZA 4JFBA 3SY7A 1HXUA 3AA6A 3PORA 4KRAA 4RLBA 2JMMA 3RBHA 1MM5A 3FYXA 2O4VA 2KZ7B 2WVPA 4F4BA 4G75A 2R88A 1GFMA 1HXTA 7PRNA 2XG6A 2XE5A 3BRYA 4UB6O 4AYID 4N75A 4O3XB 3UAQA 3WU2O 4C4VA 2LHFA 2N2LA 4RJXA 2Y0KA 2KDYA 2Y2XA 2F1CX 2F1VA 4C69X 4E1TA 5ADXK 3PQUA 5JDPA 3UU2A 4K3CA 3JTYA 3EMNX 4AKRB 4N59A 5G26A 5DL6A 4XNLA
chains in the Genus database with same CATH topology
1T16A 2R4OA 2R89A 3BRZA 3DWOX 2R88A 3PGRA 3BS0A 3BRYA 3DWNA 2R8AA 3PGSA 2R4LA 1T1LA 2R4NA 3PGUA 2R4PA 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T16 A;  2R4O A;  2R89 A;  3BRZ A;  3DWO X;  2R88 A;  3PGR A;  3BS0 A;  3BRY A;  3DWN A;  2R8A A;  3PGS A;  2R4L A;  1T1L A;  2R4N A;  3PGU A;  2R4P A;  3PF1 A; 
#chains in the Genus database with same CATH topology
 3HOE A;  2XE3 A;  2XE2 A;  2W81 C;  3AA0 B;  3T0S A;  4AFK A;  4Z3T A;  3AA7 B;  4PUX A;  4K3B A;  5H2F O;  5ADX L;  5GTH O;  4CTD A;  2LFU A;  3G7G A;  1Q9F A;  1BT9 A;  3A2S X;  5KAF O;  4AUI A;  4GCQ A;  1OSM A;  5GTI O;  2R8A A;  2YPV A;  4KR8 A;  4LSF A;  5DL5 A;  4FMS A;  2GE4 A;  4O49 A;  4FQE A;  5B66 O;  3AAE B;  3A0B O;  8PRN A;  3AA1 A;  3T20 A;  3BS0 A;  5AFU K;  1HXX A;  4LSE A;  2X9K A;  4O4X A;  4RLC A;  4D64 A;  2ODJ A;  4FUV A;  2FGQ X;  3LK2 B;  2QTK A;  3QRA A;  3V8U A;  4FRT A;  1ZHT A;  3WI4 A;  2PRN A;  5T5F A;  2KXP B;  2XE1 A;  2IWV A;  2AXT O;  4AYD C;  2Y7S A;  4D65 A;  2F1T A;  4E1S A;  4AZL A;  5AFU L;  2POR A;  2XMX A;  2K4T A;  2Y0L A;  2YNK A;  4O3Z A;  4O4U A;  1H6S 1;  1PHO A;  3AA6 B;  4GF4 A;  4PJ0 O;  3POX A;  2R4L A;  4FOZ A;  1QJ8 A;  1T1L A;  3PGU A;  4FSO A;  2J4U P;  5PRN A;  3T24 A;  4AKM A;  5KAI O;  1E54 A;  3KVD D;  4GCP A;  4JCH A;  5DL7 A;  4FES A;  4C4V B;  1GFP A;  3C5O A;  2M07 A;  4N58 A;  2ZLD A;  4PR7 A;  3AAA A;  1BXW A;  1QJP A;  2J1N A;  4FT6 A;  1PRN A;  1T16 A;  2R4O A;  4UB8 O;  1GFN A;  4GHB A;  1GFQ A;  4KR4 A;  5G38 A;  3VE2 A;  2FGR A;  1IZN A;  4IL6 O;  3SY9 A;  4FZM A;  4XNK A;  3SZV A;  4C00 A;  1BH3 A;  2KZ7 A;  3POQ A;  4FSP A;  1ZHY A;  3LK4 2;  2MHL A;  1ZHW A;  3DA3 A;  3HWB A;  3NSG A;  5GV0 A;  4N74 A;  3UPG A;  4AYM C;  2X27 X;  6PRN A;  3K19 A;  3NJT A;  3VY9 X;  4O3Y A;  2MNH A;  4G76 A;  1G90 A;  3POU A;  2ERV A;  2ZFG A;  4RL9 A;  4AYN A;  2N2M A;  5E79 O;  1OPF A;  3SZD A;  2WJQ A;  3TZG A;  1THQ A;  3PQS A;  2W80 C;  1ZHX A;  3LK3 A;  4LSI A;  4QQ1 A;  4FZN A;  4BUM X;  3AA0 A;  3AA1 B;  3VZW X;  1IZN B;  2XTR A;  4D5U A;  3AA7 A;  3WI5 A;  3A0H O;  4O3W A;  3PGS A;  1P4T A;  1MPF A;  4AYE C;  3PF1 A;  3SYB A;  2M06 A;  4FZL A;  5DL8 A;  3DWO X;  2R89 A;  1ZHZ A;  3LK4 1;  4LSH A;  5G39 A;  1YS5 A;  1S5L O;  2WJR A;  3HOL A;  3PRN A;  3VZU X;  4B61 A;  3KZI O;  2XTQ A;  5TIS O;  3HW9 A;  2IWW A;  3SYS A;  2K0L A;  5FVN A;  5EE2 A;  5B5E O;  3QRC A;  4RJW A;  3AAE A;  2Y0H A;  3PGR A;  3JCU O;  1MM4 A;  3VE1 A;  3DWN A;  3DA4 A;  2OMF A;  3LK3 B;  5D5D A;  2R4P A;  2JQY A;  4U9C A;  5G3A A;  3GP6 A;  3O0E A;  1QJ9 A;  3LK2 A;  3DZM A;  1GFO A;  5IYU A;  1Q9G A;  3VZT X;  2KXP A;  4GCS A;  4FRX A;  2R4N A;  3AAA B;  3VY8 X;  4AKR A;  2KC0 A;  1ORM A;  3BRZ A;  4JFB A;  3SY7 A;  1HXU A;  3AA6 A;  3POR A;  4KRA A;  4RLB A;  2JMM A;  3RBH A;  1MM5 A;  3FYX A;  2O4V A;  2KZ7 B;  2WVP A;  4F4B A;  4G75 A;  2R88 A;  1GFM A;  1HXT A;  7PRN A;  2XG6 A;  2XE5 A;  3BRY A;  4UB6 O;  4AYI D;  4N75 A;  4O3X B;  3UAQ A;  3WU2 O;  4C4V A;  2LHF A;  2N2L A;  4RJX A;  2Y0K A;  2KDY A;  2Y2X A;  2F1C X;  2F1V A;  4C69 X;  4E1T A;  5ADX K;  3PQU A;  5JDP A;  3UU2 A;  4K3C A;  3JTY A;  3EMN X;  4AKR B;  4N59 A;  5G26 A;  5DL6 A;  4XNL A; 
#chains in the Genus database with same CATH homology
 1T16 A;  2R4O A;  2R89 A;  3BRZ A;  3DWO X;  2R88 A;  3PGR A;  3BS0 A;  3BRY A;  3DWN A;  2R8A A;  3PGS A;  2R4L A;  1T1L A;  2R4N A;  3PGU A;  2R4P A;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...