3PGUA

Phe3glu mutant of ecfadl
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
425
structure length
408
Chain Sequence
AGEQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGRAFNNYGLQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 129
structure length 408
sequence length 425
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pguA00
2R8AA 2R4OA 2R89A 3BRZA 3BRYA 3PF1A 1T16A 2R88A 1T1LA 3PGUA 3PGRA 2R4PA 3PGSA 2R4LA 2R4NA 3DWOX 3DWNA 3BS0A
chains in the Genus database with same CATH superfamily
3WI4A 4O4XA 2PORA 4C69X 4O4UA 2GE4A 2N2MA 5DL5A 1GFQA 3T0SA 5H2FO 4QQ1A 4C4VA 3PQUA 1GFMA 4PJ0O 3BRYA 4UB8O 1OSMA 1QJPA 2O4VA 4FOZA 3DA4A 1ORMA 4RJWA 3SYBA 3SZDA 3T24A 3UU2A 1THQA 1ZHZA 2LHFA 2XE1A 2K4TA 5D5DA 1HXUA 4PUXA 4XNLA 3VY8X 5AFUK 2R8AA 3UPGA 2K0LA 3AAAB 5KAIO 4F4BA 4JFBA 4GCSA 4K3BA 2M07A 3WI5A 1YS5A 4E1TA 4KRAA 3HOLA 4GCQA 4O3ZA 2F1CX 2Y0HA 4RLBA 3KVDD 2R4OA 3PORA 1IZNB 3K19A 4FZNA 4B61A 2IWWA 1Q9FA 4UB6O 4E1SA 2Y2XA 3DA3A 4RJXA 1QJ9A 2KXPA 3DWOX 2W80C 2KXPB 3VE1A 3LK42 3O0EA 3A0BO 3PRNA 4C00A 4FZMA 1H6S1 4D64A 2KZ7A 5G26A 1ZHYA 2XE3A 3NSGA 3PGRA 4FUVA 3UAQA 2YPVA 1GFOA 2MNHA 1E54A 3SY7A 3POQA 3TZGA 4FRTA 4LSHA 4AKRB 4LSFA 3PGUA 3QRCA 3VZWX 3AA0B 1S5LO 2J1NA 4K3CA 4FRXA 5DL7A 2JQYA 4AZLA 4D65A 3NJTA 5G3AA 4FMSA 1BH3A 5GTIO 4AYMC 1T1LA 4N74A 2MHLA 5GV0A 2X27X 1BT9A 4LSIA 2WJRA 3PGSA 2F1TA 4C4VB 2M06A 3BS0A 4FSPA 4GCPA 3HW9A 3JCUO 3POUA 4FZLA 4AFKA 3AA0A 1IZNA 4G76A 4RLCA 5AFUL 3VZTX 1HXXA 2AXTO 3POXA 3VE2A 2R89A 3DZMA 3LK2A 1ZHTA 4N59A 4RL9A 4AYNA 2F1VA 2XMXA 2R88A 5IYUA 2XTQA 3LK2B 1G90A 3JTYA 2WJQA 2KDYA 5G39A 3AA7A 3QRAA 4FT6A 3LK41 4AYEC 2XE5A 3GP6A 3AA7B 3A2SX 3SY9A 1T16A 3VY9X 2ERVA 1HXTA 1P4TA 2WVPA 4FESA 3AA6A 2KC0A 3LK3A 1ZHWA 2FGRA 2R4LA 3VZUX 3AA6B 3WU2O 8PRNA 2QTKA 1BXWA 2Y0KA 1GFNA 5DL6A 3A0HO 4LSEA 4O3XB 5JDPA 2KZ7B 2ZFGA 4IL6O 2R4PA 5KAFO 6PRNA 5B66O 3V8UA 4CTDA 7PRNA 4AYID 2Y0LA 4PR7A 2Y7SA 4GHBA 2XE2A 2XTRA 4Z3TA 3AAEA 3PQSA 1PRNA 2XG6A 3DWNA 5EE2A 3FYXA 1MM5A 3EMNX 4KR8A 3AAAA 4AKMA 4G75A 3T20A 4BUMX 4U9CA 3C5OA 4D5UA 4O3WA 5GTHO 1Q9GA 4XNKA 4KR4A 5FVNA 4FQEA 4O49A 5TISO 2N2LA 4AKRA 1QJ8A 4AYDC 4AUIA 1MM4A 4GF4A 4N58A 3HWBA 2W81C 2ZLDA 4FSOA 3RBHA 3AA1A 5ADXL 3G7GA 3LK3B 5PRNA 2ODJA 3AA1B 1MPFA 2PRNA 5DL8A 2J4UP 1GFPA 5E79O 5G38A 2OMFA 2R4NA 2X9KA 2JMMA 3PF1A 2FGQX 2YNKA 3BRZA 3KZIO 1OPFA 1ZHXA 4JCHA 3SZVA 2IWVA 5B5EO 5ADXK 3HOEA 5T5FA 4O3YA 3SYSA 4N75A 2LFUA 3AAEB 1PHOA
chains in the Genus database with same CATH topology
2R8AA 2R4OA 2R89A 3BRZA 3BRYA 3PF1A 1T16A 2R88A 1T1LA 3PGUA 3PGRA 2R4PA 3PGSA 2R4LA 2R4NA 3DWOX 3DWNA 3BS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8A A;  2R4O A;  2R89 A;  3BRZ A;  3BRY A;  3PF1 A;  1T16 A;  2R88 A;  1T1L A;  3PGU A;  3PGR A;  2R4P A;  3PGS A;  2R4L A;  2R4N A;  3DWO X;  3DWN A;  3BS0 A; 
#chains in the Genus database with same CATH topology
 3WI4 A;  4O4X A;  2POR A;  4C69 X;  4O4U A;  2GE4 A;  2N2M A;  5DL5 A;  1GFQ A;  3T0S A;  5H2F O;  4QQ1 A;  4C4V A;  3PQU A;  1GFM A;  4PJ0 O;  3BRY A;  4UB8 O;  1OSM A;  1QJP A;  2O4V A;  4FOZ A;  3DA4 A;  1ORM A;  4RJW A;  3SYB A;  3SZD A;  3T24 A;  3UU2 A;  1THQ A;  1ZHZ A;  2LHF A;  2XE1 A;  2K4T A;  5D5D A;  1HXU A;  4PUX A;  4XNL A;  3VY8 X;  5AFU K;  2R8A A;  3UPG A;  2K0L A;  3AAA B;  5KAI O;  4F4B A;  4JFB A;  4GCS A;  4K3B A;  2M07 A;  3WI5 A;  1YS5 A;  4E1T A;  4KRA A;  3HOL A;  4GCQ A;  4O3Z A;  2F1C X;  2Y0H A;  4RLB A;  3KVD D;  2R4O A;  3POR A;  1IZN B;  3K19 A;  4FZN A;  4B61 A;  2IWW A;  1Q9F A;  4UB6 O;  4E1S A;  2Y2X A;  3DA3 A;  4RJX A;  1QJ9 A;  2KXP A;  3DWO X;  2W80 C;  2KXP B;  3VE1 A;  3LK4 2;  3O0E A;  3A0B O;  3PRN A;  4C00 A;  4FZM A;  1H6S 1;  4D64 A;  2KZ7 A;  5G26 A;  1ZHY A;  2XE3 A;  3NSG A;  3PGR A;  4FUV A;  3UAQ A;  2YPV A;  1GFO A;  2MNH A;  1E54 A;  3SY7 A;  3POQ A;  3TZG A;  4FRT A;  4LSH A;  4AKR B;  4LSF A;  3PGU A;  3QRC A;  3VZW X;  3AA0 B;  1S5L O;  2J1N A;  4K3C A;  4FRX A;  5DL7 A;  2JQY A;  4AZL A;  4D65 A;  3NJT A;  5G3A A;  4FMS A;  1BH3 A;  5GTI O;  4AYM C;  1T1L A;  4N74 A;  2MHL A;  5GV0 A;  2X27 X;  1BT9 A;  4LSI A;  2WJR A;  3PGS A;  2F1T A;  4C4V B;  2M06 A;  3BS0 A;  4FSP A;  4GCP A;  3HW9 A;  3JCU O;  3POU A;  4FZL A;  4AFK A;  3AA0 A;  1IZN A;  4G76 A;  4RLC A;  5AFU L;  3VZT X;  1HXX A;  2AXT O;  3POX A;  3VE2 A;  2R89 A;  3DZM A;  3LK2 A;  1ZHT A;  4N59 A;  4RL9 A;  4AYN A;  2F1V A;  2XMX A;  2R88 A;  5IYU A;  2XTQ A;  3LK2 B;  1G90 A;  3JTY A;  2WJQ A;  2KDY A;  5G39 A;  3AA7 A;  3QRA A;  4FT6 A;  3LK4 1;  4AYE C;  2XE5 A;  3GP6 A;  3AA7 B;  3A2S X;  3SY9 A;  1T16 A;  3VY9 X;  2ERV A;  1HXT A;  1P4T A;  2WVP A;  4FES A;  3AA6 A;  2KC0 A;  3LK3 A;  1ZHW A;  2FGR A;  2R4L A;  3VZU X;  3AA6 B;  3WU2 O;  8PRN A;  2QTK A;  1BXW A;  2Y0K A;  1GFN A;  5DL6 A;  3A0H O;  4LSE A;  4O3X B;  5JDP A;  2KZ7 B;  2ZFG A;  4IL6 O;  2R4P A;  5KAF O;  6PRN A;  5B66 O;  3V8U A;  4CTD A;  7PRN A;  4AYI D;  2Y0L A;  4PR7 A;  2Y7S A;  4GHB A;  2XE2 A;  2XTR A;  4Z3T A;  3AAE A;  3PQS A;  1PRN A;  2XG6 A;  3DWN A;  5EE2 A;  3FYX A;  1MM5 A;  3EMN X;  4KR8 A;  3AAA A;  4AKM A;  4G75 A;  3T20 A;  4BUM X;  4U9C A;  3C5O A;  4D5U A;  4O3W A;  5GTH O;  1Q9G A;  4XNK A;  4KR4 A;  5FVN A;  4FQE A;  4O49 A;  5TIS O;  2N2L A;  4AKR A;  1QJ8 A;  4AYD C;  4AUI A;  1MM4 A;  4GF4 A;  4N58 A;  3HWB A;  2W81 C;  2ZLD A;  4FSO A;  3RBH A;  3AA1 A;  5ADX L;  3G7G A;  3LK3 B;  5PRN A;  2ODJ A;  3AA1 B;  1MPF A;  2PRN A;  5DL8 A;  2J4U P;  1GFP A;  5E79 O;  5G38 A;  2OMF A;  2R4N A;  2X9K A;  2JMM A;  3PF1 A;  2FGQ X;  2YNK A;  3BRZ A;  3KZI O;  1OPF A;  1ZHX A;  4JCH A;  3SZV A;  2IWV A;  5B5E O;  5ADX K;  3HOE A;  5T5F A;  4O3Y A;  3SYS A;  4N75 A;  2LFU A;  3AAE B;  1PHO A; 
#chains in the Genus database with same CATH homology
 2R8A A;  2R4O A;  2R89 A;  3BRZ A;  3BRY A;  3PF1 A;  1T16 A;  2R88 A;  1T1L A;  3PGU A;  3PGR A;  2R4P A;  3PGS A;  2R4L A;  2R4N A;  3DWO X;  3DWN A;  3BS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...