2MNHA

Refined structure of outer membrane protein x in nanodisc by measuring residual dipolar couplings
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
TSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein X
publication title Measuring membrane protein bond orientations in nanodiscs via residual dipolar couplings.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mnhA00
2M06A 2MNHA 1MM4A 1G90A 1QJ8A 2M07A 4PUXA 1QJPA 2GE4A 3GP6A 2N2LA 4RLCA 1QJ9A 2K0LA 3QRCA 1ORMA 1P4TA 2F1TA 1Q9GA 2MHLA 2X27X 3QRAA 1THQA 2ERVA 2LHFA 1BXWA 1MM5A 3C5OA 2F1VA 2JMMA 3G7GA 2N2MA 1Q9FA
chains in the Genus database with same CATH superfamily
2M06A 2R4LA 1GFOA 4K3CA 4LSFA 1MM4A 4PR7A 4D65A 3DWOX 3T20A 3PGSA 3HW9A 2XE2A 3DWNA 4FZNA 4C00A 4FMSA 2N2LA 2XTQA 2O4VA 1OSMA 2KZ7A 2Y0LA 2ZFGA 3PQSA 3PF1A 2F1CX 2XTRA 3NJTA 3VY9X 1GFPA 4RJWA 2KXPB 3NSGA 1QJ9A 4KR4A 2K0LA 5PRNA 4U9CA 5B66O 3AAEB 5H2FO 3UPGA 2R88A 2XE5A 3AA1B 2KDYA 4JCHA 4G75A 5B5EO 1HXUA 2R8AA 3HOLA 3QRAA 5G26A 2ERVA 1E54A 3AA6B 3SYSA 3VZTX 4AYMC 3O0EA 4FSOA 5IYUA 3AAAA 3LK3B 3PGRA 4FOZA 5DL5A 2JMMA 4AYDC 3G7GA 2N2MA 4D64A 4O3YA 2XE3A 1T16A 2MNHA 3VZWX 3UAQA 4AUIA 2Y0HA 3SY7A 1G90A 1QJ8A 4LSHA 2R4PA 4K3BA 4N58A 4PUXA 4AYID 2GE4A 2KC0A 2IWWA 4RL9A 5JDPA 2WVPA 3KZIO 4LSIA 2LFUA 3HOEA 2R89A 1ZHTA 3KVDD 5G38A 3RBHA 5ADXK 3A2SX 2JQYA 3SY9A 3PORA 3SZDA 1YS5A 1ZHYA 4F4BA 2Y0KA 5DL7A 5G3AA 3T0SA 3T24A 3PGUA 3LK2B 4Z3TA 4FESA 2F1TA 1Q9GA 4GCQA 2J1NA 4O3XB 4E1SA 2K4TA 4BUMX 2Y7SA 4FZMA 1IZNA 1PRNA 2ZLDA 1BXWA 4FRXA 3POUA 4FUVA 4N59A 4AKRA 2R4OA 5GTIO 1HXXA 2XG6A 3LK42 3JTYA 1Q9FA 1PHOA 4O3ZA 4AYNA 3POQA 4RJXA 4AKMA 2KZ7B 2FGQX 3DZMA 4FZLA 4C4VA 2YPVA 3SZVA 3AA7A 4E1TA 2J4UP 4AYEC 3V8UA 2M07A 4O3WA 8PRNA 4FT6A 4KRAA 5EE2A 3GP6A 4UB8O 4C69X 5KAIO 1S5LO 3WI5A 4LSEA 4RLCA 2IWVA 2R4NA 1T1LA 5ADXL 4JFBA 4IL6O 5AFUK 3VE2A 2Y2XA 4GCSA 1ZHXA 3DA4A 3SYBA 2FGRA 3K19A 4N75A 4QQ1A 3VE1A 3PQUA 1ZHWA 3AAAB 3VZUX 3PRNA 5GV0A 3A0HO 4O4XA 4FRTA 4XNKA 4B61A 2PORA 2KXPA 1MPFA 2ODJA 1THQA 2OMFA 2W80C 4FSPA 4G76A 3C5OA 5GTHO 3AAEA 2F1VA 3AA1A 1ZHZA 2WJQA 3FYXA 3QRCA 5KAFO 4D5UA 1H6S1 3AA0A 2PRNA 3AA6A 3WI4A 3BS0A 2W81C 1QJPA 3LK3A 2AXTO 3JCUO 3UU2A 1GFNA 5DL8A 3TZGA 4AFKA 3EMNX 1GFQA 2XMXA 5TISO 4CTDA 1HXTA 5D5DA 2QTKA 3DA3A 4N74A 3POXA 4O49A 4O4UA 3VY8X 5AFUL 4PJ0O 1IZNB 4RLBA 2XE1A 2X9KA 6PRNA 1ORMA 3LK41 4GCPA 4GHBA 3A0BO 4KR8A 5FVNA 4AKRB 4XNLA 1P4TA 1BT9A 3AA0B 3BRZA 5E79O 3HWBA 3BRYA 2MHLA 1OPFA 3WU2O 2X27X 4GF4A 4C4VB 2YNKA 4UB6O 7PRNA 2LHFA 3AA7B 5DL6A 1MM5A 1GFMA 1BH3A 4AZLA 3LK2A 2WJRA 5G39A 5T5FA 4FQEA
chains in the Genus database with same CATH topology
2M06A 1GFOA 4LSFA 1MM4A 3T20A 3HW9A 2XE2A 4FZNA 4FMSA 2N2LA 2XTQA 2O4VA 1OSMA 2KZ7A 2Y0LA 2ZFGA 3PQSA 2XTRA 3VY9X 1GFPA 4RJWA 2KXPB 3NSGA 1QJ9A 4KR4A 2K0LA 5PRNA 4U9CA 3AAEB 3UPGA 2XE5A 3AA1B 2KDYA 4JCHA 4G75A 1HXUA 3HOLA 3QRAA 5G26A 2ERVA 1E54A 3AA6B 3SYSA 3VZTX 4AYMC 3O0EA 4FSOA 5IYUA 3AAAA 3LK3B 4FOZA 5DL5A 2JMMA 4AYDC 3G7GA 2N2MA 4D64A 4O3YA 2XE3A 2MNHA 4AUIA 3VZWX 3UAQA 2Y0HA 3SY7A 1G90A 1QJ8A 4LSHA 4N58A 4PUXA 4AYID 2GE4A 2KC0A 4RL9A 5JDPA 4LSIA 2LFUA 3HOEA 3KVDD 1ZHTA 3RBHA 5ADXK 3A2SX 3SY9A 3PORA 3SZDA 1YS5A 1ZHYA 4F4BA 2Y0KA 5DL7A 3T0SA 3T24A 4Z3TA 3LK2B 4FESA 2F1TA 1Q9GA 4GCQA 2J1NA 4O3XB 4E1SA 2K4TA 4BUMX 2Y7SA 4FZMA 1IZNA 1PRNA 2ZLDA 1BXWA 4FRXA 3POUA 4FUVA 4N59A 4AKRA 1HXXA 2XG6A 3LK42 3JTYA 1Q9FA 1PHOA 4O3ZA 4AYNA 3POQA 4RJXA 4AKMA 2KZ7B 2FGQX 4FZLA 4D65A 4E1TA 2YPVA 3SZVA 3AA7A 2J4UP 4AYEC 3V8UA 2M07A 4O3WA 8PRNA 4FT6A 4KRAA 5EE2A 3GP6A 4C69X 3WI5A 4LSEA 4RLCA 5ADXL 4JFBA 5AFUK 3VE2A 2Y2XA 4GCSA 1ZHXA 3DA4A 3SYBA 2FGRA 4QQ1A 3VE1A 3PQUA 1ZHWA 3AAAB 3VZUX 3PRNA 5GV0A 4O4XA 4FRTA 4XNKA 4B61A 2PORA 2KXPA 1MPFA 2ODJA 1THQA 2OMFA 2W80C 4FSPA 4G76A 3C5OA 3AAEA 2F1VA 3AA1A 1ZHZA 3FYXA 3QRCA 4D5UA 1H6S1 3AA0A 2PRNA 3AA6A 3WI4A 2W81C 1QJPA 3LK3A 3UU2A 1GFNA 5DL8A 3TZGA 4AFKA 3EMNX 1GFQA 2XMXA 1HXTA 5D5DA 2QTKA 3DA3A 3POXA 4O49A 4O4UA 3VY8X 5AFUL 4RLBA 1IZNB 2XE1A 6PRNA 1ORMA 3LK41 4GCPA 4GHBA 4KR8A 4AKRB 5FVNA 4XNLA 1P4TA 1BT9A 3AA0B 3HWBA 2MHLA 1OPFA 2X27X 4GF4A 7PRNA 2YNKA 2LHFA 3AA7B 5DL6A 1MM5A 1GFMA 1BH3A 4AZLA 3LK2A 3K19A 5T5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M06 A;  2MNH A;  1MM4 A;  1G90 A;  1QJ8 A;  2M07 A;  4PUX A;  1QJP A;  2GE4 A;  3GP6 A;  2N2L A;  4RLC A;  1QJ9 A;  2K0L A;  3QRC A;  1ORM A;  1P4T A;  2F1T A;  1Q9G A;  2MHL A;  2X27 X;  3QRA A;  1THQ A;  2ERV A;  2LHF A;  1BXW A;  1MM5 A;  3C5O A;  2F1V A;  2JMM A;  3G7G A;  2N2M A;  1Q9F A; 
#chains in the Genus database with same CATH topology
 2M06 A;  2R4L A;  1GFO A;  4K3C A;  4LSF A;  1MM4 A;  4PR7 A;  4D65 A;  3DWO X;  3T20 A;  3PGS A;  3HW9 A;  2XE2 A;  3DWN A;  4FZN A;  4C00 A;  4FMS A;  2N2L A;  2XTQ A;  2O4V A;  1OSM A;  2KZ7 A;  2Y0L A;  2ZFG A;  3PQS A;  3PF1 A;  2F1C X;  2XTR A;  3NJT A;  3VY9 X;  1GFP A;  4RJW A;  2KXP B;  3NSG A;  1QJ9 A;  4KR4 A;  2K0L A;  5PRN A;  4U9C A;  5B66 O;  3AAE B;  5H2F O;  3UPG A;  2R88 A;  2XE5 A;  3AA1 B;  2KDY A;  4JCH A;  4G75 A;  5B5E O;  1HXU A;  2R8A A;  3HOL A;  3QRA A;  5G26 A;  2ERV A;  1E54 A;  3AA6 B;  3SYS A;  3VZT X;  4AYM C;  3O0E A;  4FSO A;  5IYU A;  3AAA A;  3LK3 B;  3PGR A;  4FOZ A;  5DL5 A;  2JMM A;  4AYD C;  3G7G A;  2N2M A;  4D64 A;  4O3Y A;  2XE3 A;  1T16 A;  2MNH A;  3VZW X;  3UAQ A;  4AUI A;  2Y0H A;  3SY7 A;  1G90 A;  1QJ8 A;  4LSH A;  2R4P A;  4K3B A;  4N58 A;  4PUX A;  4AYI D;  2GE4 A;  2KC0 A;  2IWW A;  4RL9 A;  5JDP A;  2WVP A;  3KZI O;  4LSI A;  2LFU A;  3HOE A;  2R89 A;  1ZHT A;  3KVD D;  5G38 A;  3RBH A;  5ADX K;  3A2S X;  2JQY A;  3SY9 A;  3POR A;  3SZD A;  1YS5 A;  1ZHY A;  4F4B A;  2Y0K A;  5DL7 A;  5G3A A;  3T0S A;  3T24 A;  3PGU A;  3LK2 B;  4Z3T A;  4FES A;  2F1T A;  1Q9G A;  4GCQ A;  2J1N A;  4O3X B;  4E1S A;  2K4T A;  4BUM X;  2Y7S A;  4FZM A;  1IZN A;  1PRN A;  2ZLD A;  1BXW A;  4FRX A;  3POU A;  4FUV A;  4N59 A;  4AKR A;  2R4O A;  5GTI O;  1HXX A;  2XG6 A;  3LK4 2;  3JTY A;  1Q9F A;  1PHO A;  4O3Z A;  4AYN A;  3POQ A;  4RJX A;  4AKM A;  2KZ7 B;  2FGQ X;  3DZM A;  4FZL A;  4C4V A;  2YPV A;  3SZV A;  3AA7 A;  4E1T A;  2J4U P;  4AYE C;  3V8U A;  2M07 A;  4O3W A;  8PRN A;  4FT6 A;  4KRA A;  5EE2 A;  3GP6 A;  4UB8 O;  4C69 X;  5KAI O;  1S5L O;  3WI5 A;  4LSE A;  4RLC A;  2IWV A;  2R4N A;  1T1L A;  5ADX L;  4JFB A;  4IL6 O;  5AFU K;  3VE2 A;  2Y2X A;  4GCS A;  1ZHX A;  3DA4 A;  3SYB A;  2FGR A;  3K19 A;  4N75 A;  4QQ1 A;  3VE1 A;  3PQU A;  1ZHW A;  3AAA B;  3VZU X;  3PRN A;  5GV0 A;  3A0H O;  4O4X A;  4FRT A;  4XNK A;  4B61 A;  2POR A;  2KXP A;  1MPF A;  2ODJ A;  1THQ A;  2OMF A;  2W80 C;  4FSP A;  4G76 A;  3C5O A;  5GTH O;  3AAE A;  2F1V A;  3AA1 A;  1ZHZ A;  2WJQ A;  3FYX A;  3QRC A;  5KAF O;  4D5U A;  1H6S 1;  3AA0 A;  2PRN A;  3AA6 A;  3WI4 A;  3BS0 A;  2W81 C;  1QJP A;  3LK3 A;  2AXT O;  3JCU O;  3UU2 A;  1GFN A;  5DL8 A;  3TZG A;  4AFK A;  3EMN X;  1GFQ A;  2XMX A;  5TIS O;  4CTD A;  1HXT A;  5D5D A;  2QTK A;  3DA3 A;  4N74 A;  3POX A;  4O49 A;  4O4U A;  3VY8 X;  5AFU L;  4PJ0 O;  1IZN B;  4RLB A;  2XE1 A;  2X9K A;  6PRN A;  1ORM A;  3LK4 1;  4GCP A;  4GHB A;  3A0B O;  4KR8 A;  5FVN A;  4AKR B;  4XNL A;  1P4T A;  1BT9 A;  3AA0 B;  3BRZ A;  5E79 O;  3HWB A;  3BRY A;  2MHL A;  1OPF A;  3WU2 O;  2X27 X;  4GF4 A;  4C4V B;  2YNK A;  4UB6 O;  7PRN A;  2LHF A;  3AA7 B;  5DL6 A;  1MM5 A;  1GFM A;  1BH3 A;  4AZL A;  3LK2 A;  2WJR A;  5G39 A;  5T5F A;  4FQE A; 
#chains in the Genus database with same CATH homology
 2M06 A;  1GFO A;  4LSF A;  1MM4 A;  3T20 A;  3HW9 A;  2XE2 A;  4FZN A;  4FMS A;  2N2L A;  2XTQ A;  2O4V A;  1OSM A;  2KZ7 A;  2Y0L A;  2ZFG A;  3PQS A;  2XTR A;  3VY9 X;  1GFP A;  4RJW A;  2KXP B;  3NSG A;  1QJ9 A;  4KR4 A;  2K0L A;  5PRN A;  4U9C A;  3AAE B;  3UPG A;  2XE5 A;  3AA1 B;  2KDY A;  4JCH A;  4G75 A;  1HXU A;  3HOL A;  3QRA A;  5G26 A;  2ERV A;  1E54 A;  3AA6 B;  3SYS A;  3VZT X;  4AYM C;  3O0E A;  4FSO A;  5IYU A;  3AAA A;  3LK3 B;  4FOZ A;  5DL5 A;  2JMM A;  4AYD C;  3G7G A;  2N2M A;  4D64 A;  4O3Y A;  2XE3 A;  2MNH A;  4AUI A;  3VZW X;  3UAQ A;  2Y0H A;  3SY7 A;  1G90 A;  1QJ8 A;  4LSH A;  4N58 A;  4PUX A;  4AYI D;  2GE4 A;  2KC0 A;  4RL9 A;  5JDP A;  4LSI A;  2LFU A;  3HOE A;  3KVD D;  1ZHT A;  3RBH A;  5ADX K;  3A2S X;  3SY9 A;  3POR A;  3SZD A;  1YS5 A;  1ZHY A;  4F4B A;  2Y0K A;  5DL7 A;  3T0S A;  3T24 A;  4Z3T A;  3LK2 B;  4FES A;  2F1T A;  1Q9G A;  4GCQ A;  2J1N A;  4O3X B;  4E1S A;  2K4T A;  4BUM X;  2Y7S A;  4FZM A;  1IZN A;  1PRN A;  2ZLD A;  1BXW A;  4FRX A;  3POU A;  4FUV A;  4N59 A;  4AKR A;  1HXX A;  2XG6 A;  3LK4 2;  3JTY A;  1Q9F A;  1PHO A;  4O3Z A;  4AYN A;  3POQ A;  4RJX A;  4AKM A;  2KZ7 B;  2FGQ X;  4FZL A;  4D65 A;  4E1T A;  2YPV A;  3SZV A;  3AA7 A;  2J4U P;  4AYE C;  3V8U A;  2M07 A;  4O3W A;  8PRN A;  4FT6 A;  4KRA A;  5EE2 A;  3GP6 A;  4C69 X;  3WI5 A;  4LSE A;  4RLC A;  5ADX L;  4JFB A;  5AFU K;  3VE2 A;  2Y2X A;  4GCS A;  1ZHX A;  3DA4 A;  3SYB A;  2FGR A;  4QQ1 A;  3VE1 A;  3PQU A;  1ZHW A;  3AAA B;  3VZU X;  3PRN A;  5GV0 A;  4O4X A;  4FRT A;  4XNK A;  4B61 A;  2POR A;  2KXP A;  1MPF A;  2ODJ A;  1THQ A;  2OMF A;  2W80 C;  4FSP A;  4G76 A;  3C5O A;  3AAE A;  2F1V A;  3AA1 A;  1ZHZ A;  3FYX A;  3QRC A;  4D5U A;  1H6S 1;  3AA0 A;  2PRN A;  3AA6 A;  3WI4 A;  2W81 C;  1QJP A;  3LK3 A;  3UU2 A;  1GFN A;  5DL8 A;  3TZG A;  4AFK A;  3EMN X;  1GFQ A;  2XMX A;  1HXT A;  5D5D A;  2QTK A;  3DA3 A;  3POX A;  4O49 A;  4O4U A;  3VY8 X;  5AFU L;  4RLB A;  1IZN B;  2XE1 A;  6PRN A;  1ORM A;  3LK4 1;  4GCP A;  4GHB A;  4KR8 A;  4AKR B;  5FVN A;  4XNL A;  1P4T A;  1BT9 A;  3AA0 B;  3HWB A;  2MHL A;  1OPF A;  2X27 X;  4GF4 A;  7PRN A;  2YNK A;  2LHF A;  3AA7 B;  5DL6 A;  1MM5 A;  1GFM A;  1BH3 A;  4AZL A;  3LK2 A;  3K19 A;  5T5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...