2MNHA

Refined structure of outer membrane protein x in nanodisc by measuring residual dipolar couplings
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
b'TSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Measuring membrane protein bond orientations in nanodiscs via residual dipolar couplings.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mnhA00
1MM5A 2GE4A 2F1VA 1Q9FA 1Q9GA 3QRAA 4RLCA 2X27X 3GP6A 1QJ8A 2K0LA 2M07A 1P4TA 2M06A 2MHLA 2JMMA 4PUXA 2N2MA 1MM4A 2N2LA 3G7GA 1ORMA 2MNHA 2F1TA 1QJPA 2ERVA 2LHFA 3C5OA 3QRCA 1QJ9A 1THQA 1G90A 1BXWA
chains in the Genus database with same CATH superfamily
2Y0KA 4U9CA 1MM5A 4FSPA 3VY8X 3LK2B 1IZNA 3PQSA 1Q9FA 3NJTA 3VY9X 3QRAA 3BRZA 4FOZA 5ADXK 4PJ0O 2X27X 2XTQA 1QJ8A 2K0LA 3LK3B 4IL6O 4O3WA 4AYMC 4O4XA 5KAIO 2WJRA 5G3AA 5DL6A 3SZDA 4AYEC 3SY7A 4LSIA 4FQEA 2XG6A 4O3YA 2Y7SA 5EE2A 1ORMA 2Y0LA 3DA4A 5E79O 3UPGA 3DZMA 2LFUA 3AA6B 4C69X 5AFUK 4E1SA 4F4BA 5DL7A 3JTYA 3LK41 5B66O 2WJQA 2XE3A 3AA1A 4FRXA 4JCHA 4KR4A 4UB6O 4K3CA 3VZTX 4O4UA 2F1CX 4AKMA 4N58A 5JDPA 3KVDD 5IYUA 4FMSA 4E1TA 3LK3A 5GTIO 1G90A 4GHBA 4KR8A 2KDYA 2F1VA 2YPVA 1Q9GA 2O4VA 4D5UA 6PRNA 2KXPB 2XTRA 2KC0A 3SZVA 3AAAB 2R8AA 3HOEA 4FZMA 2M07A 4JFBA 1MPFA 2YNKA 3HWBA 2Y2XA 3AA6A 2N2LA 3G7GA 3AAEA 3HOLA 1OSMA 4FSOA 3WU2O 3O0EA 5ADXL 4GCPA 3BRYA 2FGRA 3A2SX 5TISO 5G38A 1ZHZA 3A0HO 3PRNA 4AZLA 4AUIA 2R88A 2LHFA 4AYNA 2R4OA 3HW9A 3V8UA 3T20A 1ZHYA 1ZHWA 2IWVA 2R89A 3PQUA 4FESA 3LK2A 3PORA 5D5DA 2K4TA 5AFUL 3AAAA 2PRNA 4N74A 4C4VB 4B61A 3POUA 4FRTA 4AYDC 4LSEA 4D65A 3SYSA 1PHOA 2R4PA 4K3BA 1GFPA 5G39A 4N59A 4RLCA 3SY9A 4LSHA 5GTHO 5GV0A 4AFKA 1P4TA 3VZWX 3WI5A 4PR7A 5G26A 4O3ZA 4XNLA 2ZLDA 2JMMA 3LK42 2J4UP 1T16A 2N2MA 4GF4A 3AA7B 3T0SA 2XE5A 2R4LA 3UAQA 1BT9A 3RBHA 3DWNA 4G76A 5KAFO 5DL8A 2IWWA 3UU2A 3POQA 3K19A 3VE1A 4D64A 3AA0B 1BH3A 3DWOX 1GFQA 2ERVA 3PF1A 3C5OA 3QRCA 2J1NA 4N75A 4C00A 2OMFA 3POXA 3VZUX 1BXWA 3PGUA 5B5EO 4BUMX 1HXXA 1HXUA 4FT6A 4RJWA 4RLBA 2JQYA 1E54A 3PGRA 4XNKA 3AA1B 3NSGA 2KXPA 4RL9A 4KRAA 3TZGA 8PRNA 3T24A 5H2FO 2R4NA 4GCSA 3WI4A 2GE4A 2QTKA 2KZ7B 4AKRB 2W80C 3KZIO 4UB8O 1GFNA 7PRNA 3GP6A 1T1LA 4O49A 3AA7A 3VE2A 2FGQX 2ZFGA 4AYID 1IZNB 2M06A 1YS5A 2MHLA 2XE1A 2AXTO 2W81C 2Y0HA 2WVPA 3PGSA 4O3XB 1GFMA 1ZHXA 1GFOA 1MM4A 1PRNA 3AA0A 4PUXA 3FYXA 3BS0A 2MNHA 4RJXA 4LSFA 2X9KA 4FZNA 1HXTA 1ZHTA 5FVNA 3AAEB 5T5FA 2F1TA 4Z3TA 2PORA 1QJPA 5PRNA 2XE2A 3SYBA 4CTDA 2XMXA 2ODJA 1S5LO 1QJ9A 3DA3A 4FZLA 1THQA 4QQ1A 5DL5A 2KZ7A 4AKRA 4C4VA 4FUVA 3JCUO 4GCQA 3A0BO 1H6S1 1OPFA 3EMNX 4G75A
chains in the Genus database with same CATH topology
2Y0KA 4U9CA 1MM5A 4FSPA 3VY8X 3LK2B 1IZNA 3PQSA 1Q9FA 3VY9X 5ADXK 3QRAA 4FOZA 2X27X 2XTQA 1QJ8A 2K0LA 3LK3B 4O3WA 4AYMC 4O4XA 5DL6A 3SZDA 3SY7A 4LSIA 2XG6A 4O3YA 2Y7SA 5EE2A 1ORMA 2Y0LA 3DA4A 3UPGA 2LFUA 3AA6B 4C69X 5AFUK 4E1SA 4F4BA 5DL7A 3JTYA 3LK41 2XE3A 3AA1A 4FRXA 4JCHA 4KR4A 3VZTX 4O4UA 4AKMA 4N58A 3KVDD 5IYUA 4FMSA 4E1TA 3LK3A 4GHBA 4KR8A 2KDYA 2F1VA 2YPVA 1Q9GA 2O4VA 4D5UA 6PRNA 2KXPB 2XTRA 2KC0A 3SZVA 3AAAB 3HOEA 4FZMA 2M07A 4JFBA 1MPFA 2YNKA 3HWBA 2Y2XA 3AA6A 2N2LA 3G7GA 3AAEA 3HOLA 1OSMA 4FSOA 5ADXL 3O0EA 4GCPA 2FGRA 3A2SX 1ZHZA 3PRNA 4AZLA 4AUIA 2LHFA 4AYNA 3HW9A 3V8UA 3T20A 1ZHYA 1ZHWA 3PQUA 4FESA 3LK2A 3PORA 5D5DA 2K4TA 5AFUL 3AAAA 2PRNA 4B61A 3POUA 4FRTA 4AYDC 4LSEA 4D65A 3SYSA 1PHOA 1GFPA 4N59A 4RLCA 3SY9A 4LSHA 5GV0A 4AFKA 1P4TA 3VZWX 3WI5A 5G26A 2J4UP 4O3ZA 4XNLA 2ZLDA 2JMMA 3LK42 2N2MA 3T0SA 4GF4A 3AA7B 2XE5A 3UAQA 1BT9A 3RBHA 4G76A 5DL8A 3UU2A 3POQA 3K19A 3VE1A 4D64A 3AA0B 1BH3A 1GFQA 2ERVA 3C5OA 3QRCA 2J1NA 2OMFA 3POXA 3VZUX 1BXWA 1G90A 1HXXA 1HXUA 4FT6A 4RJWA 4RLBA 4BUMX 1E54A 4XNKA 3AA1B 3NSGA 2KXPA 4RL9A 4KRAA 3TZGA 8PRNA 3T24A 4GCSA 3WI4A 2GE4A 2QTKA 2KZ7B 4AKRB 2W80C 7PRNA 5JDPA 1GFNA 3GP6A 4O49A 3VE2A 3AA7A 2FGQX 2ZFGA 4AYID 1IZNB 2M06A 1YS5A 2MHLA 2XE1A 4AYEC 2W81C 2Y0HA 4O3XB 1GFMA 1ZHXA 1GFOA 1MM4A 1PRNA 3AA0A 4PUXA 3FYXA 4RJXA 2MNHA 4LSFA 4FZNA 1HXTA 1ZHTA 5FVNA 3AAEB 5T5FA 2F1TA 4Z3TA 2PORA 1QJPA 5PRNA 2XE2A 3SYBA 2XMXA 2ODJA 4FZLA 1QJ9A 3DA3A 4QQ1A 1THQA 5DL5A 2KZ7A 4AKRA 4FUVA 4GCQA 1H6S1 1OPFA 3EMNX 4G75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  2GE4 A;  2F1V A;  1Q9F A;  1Q9G A;  3QRA A;  4RLC A;  2X27 X;  3GP6 A;  1QJ8 A;  2K0L A;  2M07 A;  1P4T A;  2M06 A;  2MHL A;  2JMM A;  4PUX A;  2N2M A;  1MM4 A;  2N2L A;  3G7G A;  1ORM A;  2MNH A;  2F1T A;  1QJP A;  2ERV A;  2LHF A;  3C5O A;  3QRC A;  1QJ9 A;  1THQ A;  1G90 A;  1BXW A; 
#chains in the Genus database with same CATH topology
 2Y0K A;  4U9C A;  1MM5 A;  4FSP A;  3VY8 X;  3LK2 B;  1IZN A;  3PQS A;  1Q9F A;  3NJT A;  3VY9 X;  3QRA A;  3BRZ A;  4FOZ A;  5ADX K;  4PJ0 O;  2X27 X;  2XTQ A;  1QJ8 A;  2K0L A;  3LK3 B;  4IL6 O;  4O3W A;  4AYM C;  4O4X A;  5KAI O;  2WJR A;  5G3A A;  5DL6 A;  3SZD A;  4AYE C;  3SY7 A;  4LSI A;  4FQE A;  2XG6 A;  4O3Y A;  2Y7S A;  5EE2 A;  1ORM A;  2Y0L A;  3DA4 A;  5E79 O;  3UPG A;  3DZM A;  2LFU A;  3AA6 B;  4C69 X;  5AFU K;  4E1S A;  4F4B A;  5DL7 A;  3JTY A;  3LK4 1;  5B66 O;  2WJQ A;  2XE3 A;  3AA1 A;  4FRX A;  4JCH A;  4KR4 A;  4UB6 O;  4K3C A;  3VZT X;  4O4U A;  2F1C X;  4AKM A;  4N58 A;  5JDP A;  3KVD D;  5IYU A;  4FMS A;  4E1T A;  3LK3 A;  5GTI O;  1G90 A;  4GHB A;  4KR8 A;  2KDY A;  2F1V A;  2YPV A;  1Q9G A;  2O4V A;  4D5U A;  6PRN A;  2KXP B;  2XTR A;  2KC0 A;  3SZV A;  3AAA B;  2R8A A;  3HOE A;  4FZM A;  2M07 A;  4JFB A;  1MPF A;  2YNK A;  3HWB A;  2Y2X A;  3AA6 A;  2N2L A;  3G7G A;  3AAE A;  3HOL A;  1OSM A;  4FSO A;  3WU2 O;  3O0E A;  5ADX L;  4GCP A;  3BRY A;  2FGR A;  3A2S X;  5TIS O;  5G38 A;  1ZHZ A;  3A0H O;  3PRN A;  4AZL A;  4AUI A;  2R88 A;  2LHF A;  4AYN A;  2R4O A;  3HW9 A;  3V8U A;  3T20 A;  1ZHY A;  1ZHW A;  2IWV A;  2R89 A;  3PQU A;  4FES A;  3LK2 A;  3POR A;  5D5D A;  2K4T A;  5AFU L;  3AAA A;  2PRN A;  4N74 A;  4C4V B;  4B61 A;  3POU A;  4FRT A;  4AYD C;  4LSE A;  4D65 A;  3SYS A;  1PHO A;  2R4P A;  4K3B A;  1GFP A;  5G39 A;  4N59 A;  4RLC A;  3SY9 A;  4LSH A;  5GTH O;  5GV0 A;  4AFK A;  1P4T A;  3VZW X;  3WI5 A;  4PR7 A;  5G26 A;  4O3Z A;  4XNL A;  2ZLD A;  2JMM A;  3LK4 2;  2J4U P;  1T16 A;  2N2M A;  4GF4 A;  3AA7 B;  3T0S A;  2XE5 A;  2R4L A;  3UAQ A;  1BT9 A;  3RBH A;  3DWN A;  4G76 A;  5KAF O;  5DL8 A;  2IWW A;  3UU2 A;  3POQ A;  3K19 A;  3VE1 A;  4D64 A;  3AA0 B;  1BH3 A;  3DWO X;  1GFQ A;  2ERV A;  3PF1 A;  3C5O A;  3QRC A;  2J1N A;  4N75 A;  4C00 A;  2OMF A;  3POX A;  3VZU X;  1BXW A;  3PGU A;  5B5E O;  4BUM X;  1HXX A;  1HXU A;  4FT6 A;  4RJW A;  4RLB A;  2JQY A;  1E54 A;  3PGR A;  4XNK A;  3AA1 B;  3NSG A;  2KXP A;  4RL9 A;  4KRA A;  3TZG A;  8PRN A;  3T24 A;  5H2F O;  2R4N A;  4GCS A;  3WI4 A;  2GE4 A;  2QTK A;  2KZ7 B;  4AKR B;  2W80 C;  3KZI O;  4UB8 O;  1GFN A;  7PRN A;  3GP6 A;  1T1L A;  4O49 A;  3AA7 A;  3VE2 A;  2FGQ X;  2ZFG A;  4AYI D;  1IZN B;  2M06 A;  1YS5 A;  2MHL A;  2XE1 A;  2AXT O;  2W81 C;  2Y0H A;  2WVP A;  3PGS A;  4O3X B;  1GFM A;  1ZHX A;  1GFO A;  1MM4 A;  1PRN A;  3AA0 A;  4PUX A;  3FYX A;  3BS0 A;  2MNH A;  4RJX A;  4LSF A;  2X9K A;  4FZN A;  1HXT A;  1ZHT A;  5FVN A;  3AAE B;  5T5F A;  2F1T A;  4Z3T A;  2POR A;  1QJP A;  5PRN A;  2XE2 A;  3SYB A;  4CTD A;  2XMX A;  2ODJ A;  1S5L O;  1QJ9 A;  3DA3 A;  4FZL A;  1THQ A;  4QQ1 A;  5DL5 A;  2KZ7 A;  4AKR A;  4C4V A;  4FUV A;  3JCU O;  4GCQ A;  3A0B O;  1H6S 1;  1OPF A;  3EMN X;  4G75 A; 
#chains in the Genus database with same CATH homology
 2Y0K A;  4U9C A;  1MM5 A;  4FSP A;  3VY8 X;  3LK2 B;  1IZN A;  3PQS A;  1Q9F A;  3VY9 X;  5ADX K;  3QRA A;  4FOZ A;  2X27 X;  2XTQ A;  1QJ8 A;  2K0L A;  3LK3 B;  4O3W A;  4AYM C;  4O4X A;  5DL6 A;  3SZD A;  3SY7 A;  4LSI A;  2XG6 A;  4O3Y A;  2Y7S A;  5EE2 A;  1ORM A;  2Y0L A;  3DA4 A;  3UPG A;  2LFU A;  3AA6 B;  4C69 X;  5AFU K;  4E1S A;  4F4B A;  5DL7 A;  3JTY A;  3LK4 1;  2XE3 A;  3AA1 A;  4FRX A;  4JCH A;  4KR4 A;  3VZT X;  4O4U A;  4AKM A;  4N58 A;  3KVD D;  5IYU A;  4FMS A;  4E1T A;  3LK3 A;  4GHB A;  4KR8 A;  2KDY A;  2F1V A;  2YPV A;  1Q9G A;  2O4V A;  4D5U A;  6PRN A;  2KXP B;  2XTR A;  2KC0 A;  3SZV A;  3AAA B;  3HOE A;  4FZM A;  2M07 A;  4JFB A;  1MPF A;  2YNK A;  3HWB A;  2Y2X A;  3AA6 A;  2N2L A;  3G7G A;  3AAE A;  3HOL A;  1OSM A;  4FSO A;  5ADX L;  3O0E A;  4GCP A;  2FGR A;  3A2S X;  1ZHZ A;  3PRN A;  4AZL A;  4AUI A;  2LHF A;  4AYN A;  3HW9 A;  3V8U A;  3T20 A;  1ZHY A;  1ZHW A;  3PQU A;  4FES A;  3LK2 A;  3POR A;  5D5D A;  2K4T A;  5AFU L;  3AAA A;  2PRN A;  4B61 A;  3POU A;  4FRT A;  4AYD C;  4LSE A;  4D65 A;  3SYS A;  1PHO A;  1GFP A;  4N59 A;  4RLC A;  3SY9 A;  4LSH A;  5GV0 A;  4AFK A;  1P4T A;  3VZW X;  3WI5 A;  5G26 A;  2J4U P;  4O3Z A;  4XNL A;  2ZLD A;  2JMM A;  3LK4 2;  2N2M A;  3T0S A;  4GF4 A;  3AA7 B;  2XE5 A;  3UAQ A;  1BT9 A;  3RBH A;  4G76 A;  5DL8 A;  3UU2 A;  3POQ A;  3K19 A;  3VE1 A;  4D64 A;  3AA0 B;  1BH3 A;  1GFQ A;  2ERV A;  3C5O A;  3QRC A;  2J1N A;  2OMF A;  3POX A;  3VZU X;  1BXW A;  1G90 A;  1HXX A;  1HXU A;  4FT6 A;  4RJW A;  4RLB A;  4BUM X;  1E54 A;  4XNK A;  3AA1 B;  3NSG A;  2KXP A;  4RL9 A;  4KRA A;  3TZG A;  8PRN A;  3T24 A;  4GCS A;  3WI4 A;  2GE4 A;  2QTK A;  2KZ7 B;  4AKR B;  2W80 C;  7PRN A;  5JDP A;  1GFN A;  3GP6 A;  4O49 A;  3VE2 A;  3AA7 A;  2FGQ X;  2ZFG A;  4AYI D;  1IZN B;  2M06 A;  1YS5 A;  2MHL A;  2XE1 A;  4AYE C;  2W81 C;  2Y0H A;  4O3X B;  1GFM A;  1ZHX A;  1GFO A;  1MM4 A;  1PRN A;  3AA0 A;  4PUX A;  3FYX A;  4RJX A;  2MNH A;  4LSF A;  4FZN A;  1HXT A;  1ZHT A;  5FVN A;  3AAE B;  5T5F A;  2F1T A;  4Z3T A;  2POR A;  1QJP A;  5PRN A;  2XE2 A;  3SYB A;  2XMX A;  2ODJ A;  4FZL A;  1QJ9 A;  3DA3 A;  4QQ1 A;  1THQ A;  5DL5 A;  2KZ7 A;  4AKR A;  4FUV A;  4GCQ A;  1H6S 1;  1OPF A;  3EMN X;  4G75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...