2MNHA

Refined structure of outer membrane protein x in nanodisc by measuring residual dipolar couplings
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
TSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Measuring membrane protein bond orientations in nanodiscs via residual dipolar couplings.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mnhA00
1MM5A 2MHLA 1QJPA 3GP6A 1BXWA 2K0LA 3G7GA 4RLCA 1ORMA 1QJ9A 2M07A 2JMMA 1MM4A 2N2LA 2X27X 2GE4A 1Q9FA 1QJ8A 1Q9GA 2F1VA 2LHFA 3QRAA 1G90A 1THQA 2N2MA 2ERVA 2MNHA 4PUXA 3C5OA 1P4TA 2F1TA 3QRCA 2M06A
chains in the Genus database with same CATH superfamily
4JCHA 2MHLA 4AKRA 2IWVA 2R89A 4O4UA 3VY8X 4AYNA 3PGRA 3JCUO 4FMSA 3RBHA 3SYSA 1T1LA 3NSGA 2XMXA 3HOLA 4GCSA 5B5EO 2FGQX 1GFNA 3AA6B 4GHBA 4AYMC 5TISO 2YNKA 3DWNA 5DL5A 1MM4A 2X27X 2W80C 2Y0KA 3LK2B 1PHOA 4D64A 2R4NA 2J4UP 3DWOX 1HXXA 4G76A 2OMFA 3V8UA 4UB6O 4O4XA 4LSEA 3FYXA 4KR4A 1GFPA 3AA6A 2ERVA 4AZLA 3BRYA 1P4TA 3AA7B 1HXUA 1GFQA 6PRNA 4D65A 2ODJA 2F1TA 3JTYA 4AYID 4AFKA 3POXA 2XE5A 3POQA 4F4BA 1YS5A 4N59A 4N74A 4FESA 5DL7A 5JDPA 1IZNB 4FZLA 3KZIO 4AKMA 4FSOA 2K0LA 2Y2XA 3PQUA 3AA1B 3K19A 4FRXA 1OPFA 3PGUA 3AA7A 4N75A 4RLCA 5IYUA 4FZNA 2M07A 5G26A 3AA0B 4O3ZA 1OSMA 2JMMA 2F1CX 4RJWA 1E54A 4GF4A 3WI4A 3DA4A 4RJXA 2GE4A 1IZNA 4XNLA 3SZDA 4RL9A 3SY9A 1QJ8A 1Q9GA 4G75A 3VE1A 4C69X 2K4TA 2LHFA 3QRAA 3EMNX 1THQA 2N2MA 4LSIA 5DL6A 3AAAB 3T24A 4Z3TA 1ZHXA 3PF1A 4RLBA 4AYEC 3LK3B 5KAFO 2Y7SA 4FSPA 3AAEB 3O0EA 5FVNA 5GV0A 3AA0A 3A2SX 3QRCA 3VZWX 3POUA 3UAQA 2FGRA 1GFOA 5AFUK 5ADXK 2KZ7B 5EE2A 4E1TA 4K3BA 2QTKA 2AXTO 3BRZA 3LK2A 4GCQA 2IWWA 4O3XB 5T5FA 2W81C 4QQ1A 3WI5A 4GCPA 3GP6A 3AAAA 4LSFA 3UU2A 2LFUA 3HWBA 3G7GA 4CTDA 5B66O 8PRNA 4O49A 2KDYA 2KXPB 2WVPA 3LK3A 4N58A 5D5DA 5E79O 5DL8A 4FUVA 4FQEA 4FOZA 2XTRA 2ZFGA 3VZTX 2WJQA 2R4OA 2ZLDA 3T0SA 1Q9FA 4AYDC 5KAIO 2XTQA 3VE2A 5H2FO 4FZMA 4XNKA 4E1SA 1ZHWA 1ZHYA 2KXPA 5GTHO 3A0HO 3HW9A 2MNHA 3AA1A 2Y0LA 3NJTA 3C5OA 5GTIO 3SY7A 3SYBA 3SZVA 3PORA 2PORA 3KVDD 3UPGA 3PQSA 4PR7A 1GFMA 2XE1A 2XG6A 5AFUL 2YPVA 2JQYA 1MM5A 4K3CA 5G39A 1QJPA 1BXWA 1T16A 3BS0A 2PRNA 4JFBA 2R8AA 3T20A 4KRAA 1HXTA 4C00A 1BH3A 1BT9A 1ZHZA 2J1NA 3LK42 4FT6A 1ORMA 1QJ9A 4C4VB 3DZMA 3HOEA 4O3YA 4B61A 3AAEA 1MPFA 3DA3A 4PJ0O 3A0BO 2Y0HA 2R4LA 2O4VA 5PRNA 2N2LA 1PRNA 2KC0A 5G38A 1S5LO 2KZ7A 5G3AA 2R4PA 3PRNA 5ADXL 4IL6O 4BUMX 4D5UA 4AKRB 2XE3A 2F1VA 4UB8O 2R88A 1G90A 3LK41 4AUIA 2WJRA 2XE2A 3VY9X 4PUXA 3PGSA 4C4VA 1ZHTA 4O3WA 1H6S1 3VZUX 3TZGA 2X9KA 4LSHA 4KR8A 3WU2O 7PRNA 4U9CA 4FRTA 2M06A
chains in the Genus database with same CATH topology
4JCHA 2MHLA 4AKRA 4O4UA 3VY8X 4AYNA 4FMSA 3RBHA 3SYSA 3NSGA 2XMXA 3HOLA 4GCSA 2FGQX 1GFNA 3AA6B 4GHBA 4AYMC 2YNKA 5DL5A 1MM4A 2X27X 2W80C 2Y0KA 3LK2B 1PHOA 4D64A 2J4UP 1HXXA 4G76A 2OMFA 3V8UA 4O4XA 4LSEA 3FYXA 4KR4A 1GFPA 3AA6A 2ERVA 4AZLA 1P4TA 3AA7B 1HXUA 1GFQA 6PRNA 4D65A 2ODJA 2F1TA 3JTYA 4AYID 4AFKA 3POXA 2XE5A 3POQA 4F4BA 1YS5A 4N59A 5DL7A 4FESA 5JDPA 1IZNB 4FZLA 4AKMA 4FSOA 2K0LA 2Y2XA 3PQUA 3AA1B 3K19A 4FRXA 1OPFA 3AA7A 4RLCA 4FZNA 2M07A 5G26A 3AA0B 4O3ZA 1OSMA 2JMMA 4RJWA 1E54A 4GF4A 3WI4A 3DA4A 4RJXA 2GE4A 1IZNA 4XNLA 3SZDA 4RL9A 3SY9A 1QJ8A 1Q9GA 4G75A 3VE1A 4C69X 2K4TA 2LHFA 3QRAA 3EMNX 1THQA 2N2MA 4LSIA 5DL6A 3AAAB 3T24A 4Z3TA 1ZHXA 4RLBA 4AYEC 3LK3B 2Y7SA 4FSPA 3AAEB 3O0EA 5FVNA 5GV0A 3AA0A 3A2SX 3QRCA 3VZWX 3POUA 3UAQA 2FGRA 1GFOA 5AFUK 5ADXK 2KZ7B 5EE2A 4E1TA 2QTKA 3LK2A 4GCQA 4O3XB 5T5FA 2W81C 4QQ1A 3WI5A 4GCPA 3GP6A 3AAAA 4LSFA 3UU2A 2LFUA 3HWBA 3G7GA 8PRNA 4O49A 2KDYA 2KXPB 4N58A 3LK3A 5D5DA 5DL8A 4FUVA 4FOZA 2XTRA 2ZFGA 3VZTX 2ZLDA 3T0SA 1Q9FA 4AYDC 3VE2A 2XTQA 4FZMA 4XNKA 4E1SA 1ZHWA 1ZHYA 2KXPA 3HW9A 3SYBA 2MNHA 3AA1A 2Y0LA 3C5OA 3SY7A 3SZVA 3PORA 2PORA 3KVDD 3UPGA 3PQSA 1GFMA 2XE1A 2XG6A 2YPVA 1MM5A 1QJPA 1BXWA 2PRNA 4JFBA 3T20A 4KRAA 1HXTA 5AFUL 1BH3A 1BT9A 1ZHZA 2J1NA 3LK42 4FT6A 1ORMA 1QJ9A 5ADXL 4B61A 3HOEA 4O3YA 3AAEA 1MPFA 3DA3A 2Y0HA 2O4VA 5PRNA 2N2LA 1PRNA 2KC0A 5IYUA 2KZ7A 3PRNA 4BUMX 4D5UA 4AKRB 2XE3A 2F1VA 1G90A 3LK41 4AUIA 2XE2A 3VY9X 4PUXA 1ZHTA 4O3WA 1H6S1 3VZUX 3TZGA 4LSHA 4KR8A 7PRNA 4U9CA 4FRTA 2M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  2MHL A;  1QJP A;  3GP6 A;  1BXW A;  2K0L A;  3G7G A;  4RLC A;  1ORM A;  1QJ9 A;  2M07 A;  2JMM A;  1MM4 A;  2N2L A;  2X27 X;  2GE4 A;  1Q9F A;  1QJ8 A;  1Q9G A;  2F1V A;  2LHF A;  3QRA A;  1G90 A;  1THQ A;  2N2M A;  2ERV A;  2MNH A;  4PUX A;  3C5O A;  1P4T A;  2F1T A;  3QRC A;  2M06 A; 
#chains in the Genus database with same CATH topology
 4JCH A;  2MHL A;  4AKR A;  2IWV A;  2R89 A;  4O4U A;  3VY8 X;  4AYN A;  3PGR A;  3JCU O;  4FMS A;  3RBH A;  3SYS A;  1T1L A;  3NSG A;  2XMX A;  3HOL A;  4GCS A;  5B5E O;  2FGQ X;  1GFN A;  3AA6 B;  4GHB A;  4AYM C;  5TIS O;  2YNK A;  3DWN A;  5DL5 A;  1MM4 A;  2X27 X;  2W80 C;  2Y0K A;  3LK2 B;  1PHO A;  4D64 A;  2R4N A;  2J4U P;  3DWO X;  1HXX A;  4G76 A;  2OMF A;  3V8U A;  4UB6 O;  4O4X A;  4LSE A;  3FYX A;  4KR4 A;  1GFP A;  3AA6 A;  2ERV A;  4AZL A;  3BRY A;  1P4T A;  3AA7 B;  1HXU A;  1GFQ A;  6PRN A;  4D65 A;  2ODJ A;  2F1T A;  3JTY A;  4AYI D;  4AFK A;  3POX A;  2XE5 A;  3POQ A;  4F4B A;  1YS5 A;  4N59 A;  4N74 A;  4FES A;  5DL7 A;  5JDP A;  1IZN B;  4FZL A;  3KZI O;  4AKM A;  4FSO A;  2K0L A;  2Y2X A;  3PQU A;  3AA1 B;  3K19 A;  4FRX A;  1OPF A;  3PGU A;  3AA7 A;  4N75 A;  4RLC A;  5IYU A;  4FZN A;  2M07 A;  5G26 A;  3AA0 B;  4O3Z A;  1OSM A;  2JMM A;  2F1C X;  4RJW A;  1E54 A;  4GF4 A;  3WI4 A;  3DA4 A;  4RJX A;  2GE4 A;  1IZN A;  4XNL A;  3SZD A;  4RL9 A;  3SY9 A;  1QJ8 A;  1Q9G A;  4G75 A;  3VE1 A;  4C69 X;  2K4T A;  2LHF A;  3QRA A;  3EMN X;  1THQ A;  2N2M A;  4LSI A;  5DL6 A;  3AAA B;  3T24 A;  4Z3T A;  1ZHX A;  3PF1 A;  4RLB A;  4AYE C;  3LK3 B;  5KAF O;  2Y7S A;  4FSP A;  3AAE B;  3O0E A;  5FVN A;  5GV0 A;  3AA0 A;  3A2S X;  3QRC A;  3VZW X;  3POU A;  3UAQ A;  2FGR A;  1GFO A;  5AFU K;  5ADX K;  2KZ7 B;  5EE2 A;  4E1T A;  4K3B A;  2QTK A;  2AXT O;  3BRZ A;  3LK2 A;  4GCQ A;  2IWW A;  4O3X B;  5T5F A;  2W81 C;  4QQ1 A;  3WI5 A;  4GCP A;  3GP6 A;  3AAA A;  4LSF A;  3UU2 A;  2LFU A;  3HWB A;  3G7G A;  4CTD A;  5B66 O;  8PRN A;  4O49 A;  2KDY A;  2KXP B;  2WVP A;  3LK3 A;  4N58 A;  5D5D A;  5E79 O;  5DL8 A;  4FUV A;  4FQE A;  4FOZ A;  2XTR A;  2ZFG A;  3VZT X;  2WJQ A;  2R4O A;  2ZLD A;  3T0S A;  1Q9F A;  4AYD C;  5KAI O;  2XTQ A;  3VE2 A;  5H2F O;  4FZM A;  4XNK A;  4E1S A;  1ZHW A;  1ZHY A;  2KXP A;  5GTH O;  3A0H O;  3HW9 A;  2MNH A;  3AA1 A;  2Y0L A;  3NJT A;  3C5O A;  5GTI O;  3SY7 A;  3SYB A;  3SZV A;  3POR A;  2POR A;  3KVD D;  3UPG A;  3PQS A;  4PR7 A;  1GFM A;  2XE1 A;  2XG6 A;  5AFU L;  2YPV A;  2JQY A;  1MM5 A;  4K3C A;  5G39 A;  1QJP A;  1BXW A;  1T16 A;  3BS0 A;  2PRN A;  4JFB A;  2R8A A;  3T20 A;  4KRA A;  1HXT A;  4C00 A;  1BH3 A;  1BT9 A;  1ZHZ A;  2J1N A;  3LK4 2;  4FT6 A;  1ORM A;  1QJ9 A;  4C4V B;  3DZM A;  3HOE A;  4O3Y A;  4B61 A;  3AAE A;  1MPF A;  3DA3 A;  4PJ0 O;  3A0B O;  2Y0H A;  2R4L A;  2O4V A;  5PRN A;  2N2L A;  1PRN A;  2KC0 A;  5G38 A;  1S5L O;  2KZ7 A;  5G3A A;  2R4P A;  3PRN A;  5ADX L;  4IL6 O;  4BUM X;  4D5U A;  4AKR B;  2XE3 A;  2F1V A;  4UB8 O;  2R88 A;  1G90 A;  3LK4 1;  4AUI A;  2WJR A;  2XE2 A;  3VY9 X;  4PUX A;  3PGS A;  4C4V A;  1ZHT A;  4O3W A;  1H6S 1;  3VZU X;  3TZG A;  2X9K A;  4LSH A;  4KR8 A;  3WU2 O;  7PRN A;  4U9C A;  4FRT A;  2M06 A; 
#chains in the Genus database with same CATH homology
 4JCH A;  2MHL A;  4AKR A;  4O4U A;  3VY8 X;  4AYN A;  4FMS A;  3RBH A;  3SYS A;  3NSG A;  2XMX A;  3HOL A;  4GCS A;  2FGQ X;  1GFN A;  3AA6 B;  4GHB A;  4AYM C;  2YNK A;  5DL5 A;  1MM4 A;  2X27 X;  2W80 C;  2Y0K A;  3LK2 B;  1PHO A;  4D64 A;  2J4U P;  1HXX A;  4G76 A;  2OMF A;  3V8U A;  4O4X A;  4LSE A;  3FYX A;  4KR4 A;  1GFP A;  3AA6 A;  2ERV A;  4AZL A;  1P4T A;  3AA7 B;  1HXU A;  1GFQ A;  6PRN A;  4D65 A;  2ODJ A;  2F1T A;  3JTY A;  4AYI D;  4AFK A;  3POX A;  2XE5 A;  3POQ A;  4F4B A;  1YS5 A;  4N59 A;  5DL7 A;  4FES A;  5JDP A;  1IZN B;  4FZL A;  4AKM A;  4FSO A;  2K0L A;  2Y2X A;  3PQU A;  3AA1 B;  3K19 A;  4FRX A;  1OPF A;  3AA7 A;  4RLC A;  4FZN A;  2M07 A;  5G26 A;  3AA0 B;  4O3Z A;  1OSM A;  2JMM A;  4RJW A;  1E54 A;  4GF4 A;  3WI4 A;  3DA4 A;  4RJX A;  2GE4 A;  1IZN A;  4XNL A;  3SZD A;  4RL9 A;  3SY9 A;  1QJ8 A;  1Q9G A;  4G75 A;  3VE1 A;  4C69 X;  2K4T A;  2LHF A;  3QRA A;  3EMN X;  1THQ A;  2N2M A;  4LSI A;  5DL6 A;  3AAA B;  3T24 A;  4Z3T A;  1ZHX A;  4RLB A;  4AYE C;  3LK3 B;  2Y7S A;  4FSP A;  3AAE B;  3O0E A;  5FVN A;  5GV0 A;  3AA0 A;  3A2S X;  3QRC A;  3VZW X;  3POU A;  3UAQ A;  2FGR A;  1GFO A;  5AFU K;  5ADX K;  2KZ7 B;  5EE2 A;  4E1T A;  2QTK A;  3LK2 A;  4GCQ A;  4O3X B;  5T5F A;  2W81 C;  4QQ1 A;  3WI5 A;  4GCP A;  3GP6 A;  3AAA A;  4LSF A;  3UU2 A;  2LFU A;  3HWB A;  3G7G A;  8PRN A;  4O49 A;  2KDY A;  2KXP B;  4N58 A;  3LK3 A;  5D5D A;  5DL8 A;  4FUV A;  4FOZ A;  2XTR A;  2ZFG A;  3VZT X;  2ZLD A;  3T0S A;  1Q9F A;  4AYD C;  3VE2 A;  2XTQ A;  4FZM A;  4XNK A;  4E1S A;  1ZHW A;  1ZHY A;  2KXP A;  3HW9 A;  3SYB A;  2MNH A;  3AA1 A;  2Y0L A;  3C5O A;  3SY7 A;  3SZV A;  3POR A;  2POR A;  3KVD D;  3UPG A;  3PQS A;  1GFM A;  2XE1 A;  2XG6 A;  2YPV A;  1MM5 A;  1QJP A;  1BXW A;  2PRN A;  4JFB A;  3T20 A;  4KRA A;  1HXT A;  5AFU L;  1BH3 A;  1BT9 A;  1ZHZ A;  2J1N A;  3LK4 2;  4FT6 A;  1ORM A;  1QJ9 A;  5ADX L;  4B61 A;  3HOE A;  4O3Y A;  3AAE A;  1MPF A;  3DA3 A;  2Y0H A;  2O4V A;  5PRN A;  2N2L A;  1PRN A;  2KC0 A;  5IYU A;  2KZ7 A;  3PRN A;  4BUM X;  4D5U A;  4AKR B;  2XE3 A;  2F1V A;  1G90 A;  3LK4 1;  4AUI A;  2XE2 A;  3VY9 X;  4PUX A;  1ZHT A;  4O3W A;  1H6S 1;  3VZU X;  3TZG A;  4LSH A;  4KR8 A;  7PRN A;  4U9C A;  4FRT A;  2M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...