2MNHA

Refined structure of outer membrane protein x in nanodisc by measuring residual dipolar couplings
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
TSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measuring membrane protein bond orientations in nanodiscs via residual dipolar couplings.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2014-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2mnhA00
2GE4A 1MM4A 2ERVA 1QJPA 1BXWA 2N2MA 2F1VA 1Q9FA 2MNHA 2F1TA 4PUXA 2M06A 3C5OA 1ORMA 3QRCA 2K0LA 1QJ9A 3QRAA 1P4TA 2JMMA 1Q9GA 1THQA 3G7GA 2X27X 1QJ8A 1G90A 1MM5A 2M07A 2N2LA 3GP6A 4RLCA 2LHFA 2MHLA
chains in the Genus database with same CATH superfamily
2OMFA 2ZLDA 1IZNB 1OPFA 3POUA 3UU2A 4LSIA 4D64A 4E1SA 3NJTA 3K19A 4RJXA 2N2MA 3VZWX 3WI5A 4IL6O 4AYMC 1E54A 3AAAA 4FSOA 2XTQA 2MNHA 3POXA 2R89A 3WU2O 4LSHA 4N75A 3AA6A 1HXTA 2O4VA 3HOLA 4AYNA 4CTDA 4LSEA 4KR4A 3O0EA 3DWOX 3PQUA 5KAIO 4O3XB 2F1CX 4O49A 5PRNA 5G38A 3LK3B 3PRNA 3SY7A 1QJ9A 3SY9A 2XE3A 4LSFA 4K3BA 1GFPA 2JMMA 5GV0A 3VZTX 4PJ0O 1GFNA 4XNLA 5G39A 4FOZA 2Y7SA 3KZIO 2X27X 4AUIA 1MPFA 1ZHYA 2XE2A 3AA7B 1ZHZA 3LK3A 3PGUA 3AAAB 4FMSA 3A0BO 4RLCA 3AA1B 4RLBA 5G3AA 2IWVA 2R8AA 3LK42 5IYUA 4RJWA 5EE2A 1HXUA 3VE2A 4PR7A 5D5DA 5FVNA 5AFUK 4UB6O 3JTYA 1QJPA 2R4LA 3UAQA 3PQSA 4Z3TA 5DL5A 5KAFO 4AYDC 3AA0B 3PGRA 5DL7A 5AFUL 4PUXA 3V8UA 1IZNA 1GFOA 3SYBA 2X9KA 3JCUO 1ZHTA 4GCSA 5B66O 1ORMA 2AXTO 4N58A 3UPGA 3AAEB 2PRNA 3POQA 3BRYA 3A2SX 3VZUX 3LK2B 4AFKA 1BH3A 3WI4A 3EMNX 2QTKA 3BRZA 2R4OA 2ZFGA 1PHOA 2XG6A 3G7GA 3PGSA 1QJ8A 4K3CA 2KDYA 4FZNA 4AKMA 4C00A 2M07A 3GP6A 4O4XA 3T0SA 3NSGA 5ADXK 2MHLA 2XE5A 2KXPA 3FYXA 4FZLA 5DL8A 4FQEA 3PORA 1MM4A 2ERVA 1OSMA 2R4NA 3SZVA 4C4VA 3AA6B 4O3WA 2R4PA 3AA7A 2W80C 1S5LO 2XMXA 3HWBA 1BXWA 1GFMA 2ODJA 3A0HO 1ZHWA 2F1VA 4FESA 4GF4A 4C4VB 2FGRA 4GCPA 2WVPA 2F1TA 2KC0A 3DA4A 4F4BA 2XTRA 2M06A 2Y0HA 2JQYA 2IWWA 2WJRA 5GTIO 2Y0LA 1BT9A 1ZHXA 4U9CA 2FGQX 3VY9X 3QRCA 4RL9A 1P4TA 3SZDA 1Q9GA 2YNKA 4O3YA 1THQA 4G75A 3HW9A 5DL6A 3VE1A 4AZLA 2J1NA 4XNKA 4C69X 8PRNA 3T20A 1H6S1 1MM5A 2LFUA 3AA1A 1T16A 3KVDD 4FT6A 3VY8X 4GHBA 4AYEC 3AA0A 2Y0KA 1GFQA 1YS5A 4FSPA 2GE4A 4O3ZA 4N59A 4B61A 5B5EO 4D65A 6PRNA 2K4TA 3T24A 1T1LA 2KXPB 1HXXA 2YPVA 2W81C 4N74A 3BS0A 1Q9FA 2J4UP 5T5FA 2PORA 5G26A 3LK2A 4O4UA 4BUMX 2XE1A 3LK41 4JFBA 3C5OA 3DA3A 3PF1A 4FRXA 2Y2XA 2KZ7A 5H2FO 4KRAA 3RBHA 2R88A 4D5UA 4FUVA 2K0LA 5ADXL 3QRAA 4JCHA 2KZ7B 4FRTA 4AKRB 5TISO 4KR8A 1PRNA 4GCQA 3TZGA 4FZMA 5E79O 2WJQA 4E1TA 3DZMA 3DWNA 3AAEA 4UB8O 1G90A 3HOEA 2N2LA 4AKRA 5JDPA 2LHFA 5GTHO 3SYSA 7PRNA 4G76A 4AYID 4QQ1A
chains in the Genus database with same CATH topology
2OMFA 2ZLDA 1IZNB 1OPFA 3POUA 3UU2A 4LSIA 4D64A 4E1SA 3K19A 4RJXA 2N2MA 3VZWX 3WI5A 4AYMC 1E54A 3AAAA 4FSOA 2XTQA 2MNHA 3POXA 4LSHA 3AA6A 1HXTA 2O4VA 3HOLA 4AYNA 4LSEA 4KR4A 3O0EA 3PQUA 4O3XB 4O49A 5PRNA 3LK3B 3PRNA 3SY7A 1QJ9A 3SY9A 2XE3A 4LSFA 1GFPA 2JMMA 5GV0A 3VZTX 1GFNA 4XNLA 4AUIA 4FOZA 2Y7SA 2X27X 1MPFA 1ZHYA 2XE2A 3AA7B 1ZHZA 3LK3A 3AAAB 4FMSA 4RLCA 3AA1B 4RLBA 3LK42 5IYUA 4RJWA 5EE2A 1HXUA 3VE2A 5FVNA 5D5DA 5AFUK 3JTYA 1QJPA 3UAQA 3PQSA 4Z3TA 5DL5A 4AYDC 3AA0B 5AFUL 5DL7A 4PUXA 3V8UA 1IZNA 1GFOA 3SYBA 1ZHTA 4GCSA 1ORMA 4N58A 3UPGA 3AAEB 2PRNA 3POQA 3A2SX 3VZUX 3LK2B 4AFKA 1BH3A 3WI4A 3EMNX 2QTKA 2ZFGA 1PHOA 2XG6A 3G7GA 1QJ8A 2KDYA 4FZNA 4AKMA 2M07A 3GP6A 4O4XA 3T0SA 3NSGA 5ADXK 2MHLA 2XE5A 2KXPA 3FYXA 4FZLA 5DL8A 3PORA 1MM4A 2ERVA 1OSMA 3SZVA 3AA6B 4O3WA 3AA7A 2W80C 2XMXA 3HWBA 1BXWA 1GFMA 2ODJA 1ZHWA 2F1VA 4FESA 4GF4A 2FGRA 4GCPA 2F1TA 2KC0A 3DA4A 4F4BA 2XTRA 2M06A 2Y0HA 2Y0LA 1BT9A 1ZHXA 4U9CA 2FGQX 3VY9X 3QRCA 4RL9A 1P4TA 3SZDA 1Q9GA 2YNKA 4O3YA 1THQA 4G75A 3HW9A 5DL6A 3VE1A 4AZLA 2J1NA 4XNKA 4C69X 8PRNA 3T20A 1H6S1 1MM5A 2LFUA 3AA1A 3KVDD 4FT6A 3VY8X 4GHBA 4AYEC 3AA0A 2Y0KA 1GFQA 1YS5A 4FSPA 2GE4A 4O3ZA 4N59A 4B61A 6PRNA 4D65A 2K4TA 3T24A 2YPVA 2KXPB 1HXXA 2W81C 1Q9FA 2J4UP 5T5FA 2PORA 5G26A 3LK2A 4O4UA 4BUMX 2XE1A 3LK41 4JFBA 3C5OA 3DA3A 4FRXA 2Y2XA 2KZ7A 4KRAA 3RBHA 4D5UA 5ADXL 4FUVA 2K0LA 3QRAA 4JCHA 2KZ7B 4FRTA 4AKRB 4KR8A 1PRNA 4GCQA 3TZGA 4FZMA 4E1TA 3AAEA 1G90A 3HOEA 2N2LA 4AKRA 5JDPA 2LHFA 3SYSA 7PRNA 4G76A 4AYID 4QQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  1MM4 A;  2ERV A;  1QJP A;  1BXW A;  2N2M A;  2F1V A;  1Q9F A;  2MNH A;  2F1T A;  4PUX A;  2M06 A;  3C5O A;  1ORM A;  3QRC A;  2K0L A;  1QJ9 A;  3QRA A;  1P4T A;  2JMM A;  1Q9G A;  1THQ A;  3G7G A;  2X27 X;  1QJ8 A;  1G90 A;  1MM5 A;  2M07 A;  2N2L A;  3GP6 A;  4RLC A;  2LHF A;  2MHL A; 
#chains in the Genus database with same CATH topology
 2OMF A;  2ZLD A;  1IZN B;  1OPF A;  3POU A;  3UU2 A;  4LSI A;  4D64 A;  4E1S A;  3NJT A;  3K19 A;  4RJX A;  2N2M A;  3VZW X;  3WI5 A;  4IL6 O;  4AYM C;  1E54 A;  3AAA A;  4FSO A;  2XTQ A;  2MNH A;  3POX A;  2R89 A;  3WU2 O;  4LSH A;  4N75 A;  3AA6 A;  1HXT A;  2O4V A;  3HOL A;  4AYN A;  4CTD A;  4LSE A;  4KR4 A;  3O0E A;  3DWO X;  3PQU A;  5KAI O;  4O3X B;  2F1C X;  4O49 A;  5PRN A;  5G38 A;  3LK3 B;  3PRN A;  3SY7 A;  1QJ9 A;  3SY9 A;  2XE3 A;  4LSF A;  4K3B A;  1GFP A;  2JMM A;  5GV0 A;  3VZT X;  4PJ0 O;  1GFN A;  4XNL A;  5G39 A;  4FOZ A;  2Y7S A;  3KZI O;  2X27 X;  4AUI A;  1MPF A;  1ZHY A;  2XE2 A;  3AA7 B;  1ZHZ A;  3LK3 A;  3PGU A;  3AAA B;  4FMS A;  3A0B O;  4RLC A;  3AA1 B;  4RLB A;  5G3A A;  2IWV A;  2R8A A;  3LK4 2;  5IYU A;  4RJW A;  5EE2 A;  1HXU A;  3VE2 A;  4PR7 A;  5D5D A;  5FVN A;  5AFU K;  4UB6 O;  3JTY A;  1QJP A;  2R4L A;  3UAQ A;  3PQS A;  4Z3T A;  5DL5 A;  5KAF O;  4AYD C;  3AA0 B;  3PGR A;  5DL7 A;  5AFU L;  4PUX A;  3V8U A;  1IZN A;  1GFO A;  3SYB A;  2X9K A;  3JCU O;  1ZHT A;  4GCS A;  5B66 O;  1ORM A;  2AXT O;  4N58 A;  3UPG A;  3AAE B;  2PRN A;  3POQ A;  3BRY A;  3A2S X;  3VZU X;  3LK2 B;  4AFK A;  1BH3 A;  3WI4 A;  3EMN X;  2QTK A;  3BRZ A;  2R4O A;  2ZFG A;  1PHO A;  2XG6 A;  3G7G A;  3PGS A;  1QJ8 A;  4K3C A;  2KDY A;  4FZN A;  4AKM A;  4C00 A;  2M07 A;  3GP6 A;  4O4X A;  3T0S A;  3NSG A;  5ADX K;  2MHL A;  2XE5 A;  2KXP A;  3FYX A;  4FZL A;  5DL8 A;  4FQE A;  3POR A;  1MM4 A;  2ERV A;  1OSM A;  2R4N A;  3SZV A;  4C4V A;  3AA6 B;  4O3W A;  2R4P A;  3AA7 A;  2W80 C;  1S5L O;  2XMX A;  3HWB A;  1BXW A;  1GFM A;  2ODJ A;  3A0H O;  1ZHW A;  2F1V A;  4FES A;  4GF4 A;  4C4V B;  2FGR A;  4GCP A;  2WVP A;  2F1T A;  2KC0 A;  3DA4 A;  4F4B A;  2XTR A;  2M06 A;  2Y0H A;  2JQY A;  2IWW A;  2WJR A;  5GTI O;  2Y0L A;  1BT9 A;  1ZHX A;  4U9C A;  2FGQ X;  3VY9 X;  3QRC A;  4RL9 A;  1P4T A;  3SZD A;  1Q9G A;  2YNK A;  4O3Y A;  1THQ A;  4G75 A;  3HW9 A;  5DL6 A;  3VE1 A;  4AZL A;  2J1N A;  4XNK A;  4C69 X;  8PRN A;  3T20 A;  1H6S 1;  1MM5 A;  2LFU A;  3AA1 A;  1T16 A;  3KVD D;  4FT6 A;  3VY8 X;  4GHB A;  4AYE C;  3AA0 A;  2Y0K A;  1GFQ A;  1YS5 A;  4FSP A;  2GE4 A;  4O3Z A;  4N59 A;  4B61 A;  5B5E O;  4D65 A;  6PRN A;  2K4T A;  3T24 A;  1T1L A;  2KXP B;  1HXX A;  2YPV A;  2W81 C;  4N74 A;  3BS0 A;  1Q9F A;  2J4U P;  5T5F A;  2POR A;  5G26 A;  3LK2 A;  4O4U A;  4BUM X;  2XE1 A;  3LK4 1;  4JFB A;  3C5O A;  3DA3 A;  3PF1 A;  4FRX A;  2Y2X A;  2KZ7 A;  5H2F O;  4KRA A;  3RBH A;  2R88 A;  4D5U A;  4FUV A;  2K0L A;  5ADX L;  3QRA A;  4JCH A;  2KZ7 B;  4FRT A;  4AKR B;  5TIS O;  4KR8 A;  1PRN A;  4GCQ A;  3TZG A;  4FZM A;  5E79 O;  2WJQ A;  4E1T A;  3DZM A;  3DWN A;  3AAE A;  4UB8 O;  1G90 A;  3HOE A;  2N2L A;  4AKR A;  5JDP A;  2LHF A;  5GTH O;  3SYS A;  7PRN A;  4G76 A;  4AYI D;  4QQ1 A; 
#chains in the Genus database with same CATH homology
 2OMF A;  2ZLD A;  1IZN B;  1OPF A;  3POU A;  3UU2 A;  4LSI A;  4D64 A;  4E1S A;  3K19 A;  4RJX A;  2N2M A;  3VZW X;  3WI5 A;  4AYM C;  1E54 A;  3AAA A;  4FSO A;  2XTQ A;  2MNH A;  3POX A;  4LSH A;  3AA6 A;  1HXT A;  2O4V A;  3HOL A;  4AYN A;  4LSE A;  4KR4 A;  3O0E A;  3PQU A;  4O3X B;  4O49 A;  5PRN A;  3LK3 B;  3PRN A;  3SY7 A;  1QJ9 A;  3SY9 A;  2XE3 A;  4LSF A;  1GFP A;  2JMM A;  5GV0 A;  3VZT X;  1GFN A;  4XNL A;  4AUI A;  4FOZ A;  2Y7S A;  2X27 X;  1MPF A;  1ZHY A;  2XE2 A;  3AA7 B;  1ZHZ A;  3LK3 A;  3AAA B;  4FMS A;  4RLC A;  3AA1 B;  4RLB A;  3LK4 2;  5IYU A;  4RJW A;  5EE2 A;  1HXU A;  3VE2 A;  5FVN A;  5D5D A;  5AFU K;  3JTY A;  1QJP A;  3UAQ A;  3PQS A;  4Z3T A;  5DL5 A;  4AYD C;  3AA0 B;  5AFU L;  5DL7 A;  4PUX A;  3V8U A;  1IZN A;  1GFO A;  3SYB A;  1ZHT A;  4GCS A;  1ORM A;  4N58 A;  3UPG A;  3AAE B;  2PRN A;  3POQ A;  3A2S X;  3VZU X;  3LK2 B;  4AFK A;  1BH3 A;  3WI4 A;  3EMN X;  2QTK A;  2ZFG A;  1PHO A;  2XG6 A;  3G7G A;  1QJ8 A;  2KDY A;  4FZN A;  4AKM A;  2M07 A;  3GP6 A;  4O4X A;  3T0S A;  3NSG A;  5ADX K;  2MHL A;  2XE5 A;  2KXP A;  3FYX A;  4FZL A;  5DL8 A;  3POR A;  1MM4 A;  2ERV A;  1OSM A;  3SZV A;  3AA6 B;  4O3W A;  3AA7 A;  2W80 C;  2XMX A;  3HWB A;  1BXW A;  1GFM A;  2ODJ A;  1ZHW A;  2F1V A;  4FES A;  4GF4 A;  2FGR A;  4GCP A;  2F1T A;  2KC0 A;  3DA4 A;  4F4B A;  2XTR A;  2M06 A;  2Y0H A;  2Y0L A;  1BT9 A;  1ZHX A;  4U9C A;  2FGQ X;  3VY9 X;  3QRC A;  4RL9 A;  1P4T A;  3SZD A;  1Q9G A;  2YNK A;  4O3Y A;  1THQ A;  4G75 A;  3HW9 A;  5DL6 A;  3VE1 A;  4AZL A;  2J1N A;  4XNK A;  4C69 X;  8PRN A;  3T20 A;  1H6S 1;  1MM5 A;  2LFU A;  3AA1 A;  3KVD D;  4FT6 A;  3VY8 X;  4GHB A;  4AYE C;  3AA0 A;  2Y0K A;  1GFQ A;  1YS5 A;  4FSP A;  2GE4 A;  4O3Z A;  4N59 A;  4B61 A;  6PRN A;  4D65 A;  2K4T A;  3T24 A;  2YPV A;  2KXP B;  1HXX A;  2W81 C;  1Q9F A;  2J4U P;  5T5F A;  2POR A;  5G26 A;  3LK2 A;  4O4U A;  4BUM X;  2XE1 A;  3LK4 1;  4JFB A;  3C5O A;  3DA3 A;  4FRX A;  2Y2X A;  2KZ7 A;  4KRA A;  3RBH A;  4D5U A;  5ADX L;  4FUV A;  2K0L A;  3QRA A;  4JCH A;  2KZ7 B;  4FRT A;  4AKR B;  4KR8 A;  1PRN A;  4GCQ A;  3TZG A;  4FZM A;  4E1T A;  3AAE A;  1G90 A;  3HOE A;  2N2L A;  4AKR A;  5JDP A;  2LHF A;  3SYS A;  7PRN A;  4G76 A;  4AYI D;  4QQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...