4IL6O

Structure of sr-substituted photosystem ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
b'QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 53
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4il6O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4il6O02
5G38A 5GTHO 2AXTO 3WU2O 3A0BO 5G3AA 4PJ0O 4IL6O 3JCUO 1S5LO 5GTIO 4UB8O 5G39A 5H2FO 5TISO 5KAIO 4UB6O 5B66O 5B5EO 3KZIO 5E79O 3A0HO 5KAFO
chains in the Genus database with same CATH superfamily
4U9CA 2IWWA 2KZ7A 3O0EA 3LK3B 3DA4A 1Q9FA 1BT9A 3AA6A 3PGRA 5DL8A 5GTHO 3VE1A 4KRAA 1HXXA 3AAAA 3HOEA 2XTQA 3POXA 4O3YA 4D65A 3K19A 4E1SA 3VY8X 3VZUX 5IYUA 4O3ZA 2XTRA 5DL5A 4PJ0O 1QJ8A 3JTYA 1OSMA 4IL6O 1GFPA 2R89A 2F1TA 4AUIA 2F1CX 2LHFA 3FYXA 3LK42 2R4LA 4FOZA 4C4VB 1GFQA 1H6S1 4N58A 4O4UA 4XNKA 6PRNA 2K4TA 2LFUA 2M07A 4LSHA 5KAIO 3LK2A 5AFUK 2MNHA 3AA0A 2YPVA 4UB6O 4FT6A 2J1NA 1GFOA 1PHOA 3T20A 2M06A 2JQYA 4AYID 3BRZA 3AA1A 3PGUA 4KR8A 3PORA 1T1LA 3DWOX 1YS5A 2ERVA 3TZGA 3AA0B 1PRNA 4N75A 4FQEA 5KAFO 4AFKA 3DWNA 4LSIA 2N2MA 5T5FA 2Y7SA 4LSFA 4BUMX 3WI5A 2XE5A 5PRNA 2Y0HA 1MM5A 1GFNA 2AXTO 4GCQA 2KC0A 1THQA 4FZLA 3WU2O 4AKRA 4RJWA 3LK41 2KZ7B 5G3AA 4D5UA 4O4XA 4RJXA 1E54A 1ZHYA 2R4OA 2W80C 3PF1A 3AA6B 2R4PA 4UB8O 4O3WA 5G39A 4C00A 3DZMA 2PORA 3PQUA 4LSEA 3AAAB 1IZNA 2IWVA 5AFUL 1OPFA 3HWBA 3EMNX 2GE4A 4GCPA 4GHBA 5EE2A 3PQSA 4FZNA 3SYBA 4GCSA 3AA7A 1ZHZA 3QRAA 5DL7A 4FESA 3RBHA 3UAQA 1QJ9A 5ADXL 3LK2B 5ADXK 1ZHWA 4AKMA 2KXPA 2OMFA 3BRYA 2WVPA 3VY9X 4O3XB 5G38A 3AA7B 3PRNA 4F4BA 4G76A 3AA1B 3SZVA 1QJPA 3POQA 4O49A 3AAEA 4AZLA 3A0BO 4C69X 2XMXA 1BXWA 3UPGA 4D64A 2XE2A 8PRNA 1S5LO 5G26A 1ZHTA 2MHLA 2XG6A 2Y0LA 4PUXA 3VZWX 5H2FO 3BS0A 2PRNA 1MM4A 2FGQX 1ZHXA 3NSGA 4AKRB 4CTDA 3SY9A 2O4VA 2KDYA 4N74A 3LK3A 2R88A 3QRCA 5B66O 3SZDA 4FSOA 3SY7A 4AYEC 5B5EO 7PRNA 1MPFA 2WJRA 4RLBA 2W81C 3PGSA 5D5DA 2N2LA 1IZNB 3HW9A 3JCUO 5E79O 1GFMA 3A0HO 3T24A 1BH3A 3T0SA 2J4UP 2ZLDA 4PR7A 4XNLA 3A2SX 4AYDC 3GP6A 4B61A 1HXUA 4G75A 4FRTA 2R4NA 3C5OA 2X9KA 2Y0KA 3SYSA 2K0LA 2Y2XA 4C4VA 5JDPA 1T16A 1ORMA 2YNKA 2XE1A 4N59A 2XE3A 2F1VA 5FVNA 3KVDD 4Z3TA 1P4TA 5DL6A 5GV0A 2JMMA 2WJQA 2X27X 4FUVA 4JCHA 4RL9A 2KXPB 1G90A 4FRXA 5GTIO 3G7GA 4E1TA 3WI4A 3UU2A 4RLCA 5TISO 2QTKA 3V8UA 4FZMA 3AAEB 3VE2A 3NJTA 4FSPA 4FMSA 3DA3A 3VZTX 4K3BA 4KR4A 4K3CA 4QQ1A 4AYMC 2ODJA 4GF4A 1HXTA 3HOLA 2FGRA 3KZIO 4AYNA 1Q9GA 2R8AA 3POUA 2ZFGA 4JFBA
chains in the Genus database with same CATH topology
5G38A 5GTHO 2AXTO 3WU2O 3A0BO 5G3AA 4PJ0O 4IL6O 3JCUO 1S5LO 5GTIO 4UB8O 5G39A 5H2FO 5TISO 5KAIO 4UB6O 5B66O 5B5EO 3KZIO 5E79O 3A0HO 5KAFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G38 A;  5GTH O;  2AXT O;  3WU2 O;  3A0B O;  5G3A A;  4PJ0 O;  4IL6 O;  3JCU O;  1S5L O;  5GTI O;  4UB8 O;  5G39 A;  5H2F O;  5TIS O;  5KAI O;  4UB6 O;  5B66 O;  5B5E O;  3KZI O;  5E79 O;  3A0H O;  5KAF O; 
#chains in the Genus database with same CATH topology
 4U9C A;  2IWW A;  2KZ7 A;  3O0E A;  3LK3 B;  3DA4 A;  1Q9F A;  1BT9 A;  3AA6 A;  3PGR A;  5DL8 A;  5GTH O;  3VE1 A;  4KRA A;  1HXX A;  3AAA A;  3HOE A;  2XTQ A;  3POX A;  4O3Y A;  4D65 A;  3K19 A;  4E1S A;  3VY8 X;  3VZU X;  5IYU A;  4O3Z A;  2XTR A;  5DL5 A;  4PJ0 O;  1QJ8 A;  3JTY A;  1OSM A;  4IL6 O;  1GFP A;  2R89 A;  2F1T A;  4AUI A;  2F1C X;  2LHF A;  3FYX A;  3LK4 2;  2R4L A;  4FOZ A;  4C4V B;  1GFQ A;  1H6S 1;  4N58 A;  4O4U A;  4XNK A;  6PRN A;  2K4T A;  2LFU A;  2M07 A;  4LSH A;  5KAI O;  3LK2 A;  5AFU K;  2MNH A;  3AA0 A;  2YPV A;  4UB6 O;  4FT6 A;  2J1N A;  1GFO A;  1PHO A;  3T20 A;  2M06 A;  2JQY A;  4AYI D;  3BRZ A;  3AA1 A;  3PGU A;  4KR8 A;  3POR A;  1T1L A;  3DWO X;  1YS5 A;  2ERV A;  3TZG A;  3AA0 B;  1PRN A;  4N75 A;  4FQE A;  5KAF O;  4AFK A;  3DWN A;  4LSI A;  2N2M A;  5T5F A;  2Y7S A;  4LSF A;  4BUM X;  3WI5 A;  2XE5 A;  5PRN A;  2Y0H A;  1MM5 A;  1GFN A;  2AXT O;  4GCQ A;  2KC0 A;  1THQ A;  4FZL A;  3WU2 O;  4AKR A;  4RJW A;  3LK4 1;  2KZ7 B;  5G3A A;  4D5U A;  4O4X A;  4RJX A;  1E54 A;  1ZHY A;  2R4O A;  2W80 C;  3PF1 A;  3AA6 B;  2R4P A;  4UB8 O;  4O3W A;  5G39 A;  4C00 A;  3DZM A;  2POR A;  3PQU A;  4LSE A;  3AAA B;  1IZN A;  2IWV A;  5AFU L;  1OPF A;  3HWB A;  3EMN X;  2GE4 A;  4GCP A;  4GHB A;  5EE2 A;  3PQS A;  4FZN A;  3SYB A;  4GCS A;  3AA7 A;  1ZHZ A;  3QRA A;  5DL7 A;  4FES A;  3RBH A;  3UAQ A;  1QJ9 A;  5ADX L;  3LK2 B;  5ADX K;  1ZHW A;  4AKM A;  2KXP A;  2OMF A;  3BRY A;  2WVP A;  3VY9 X;  4O3X B;  5G38 A;  3AA7 B;  3PRN A;  4F4B A;  4G76 A;  3AA1 B;  3SZV A;  1QJP A;  3POQ A;  4O49 A;  3AAE A;  4AZL A;  3A0B O;  4C69 X;  2XMX A;  1BXW A;  3UPG A;  4D64 A;  2XE2 A;  8PRN A;  1S5L O;  5G26 A;  1ZHT A;  2MHL A;  2XG6 A;  2Y0L A;  4PUX A;  3VZW X;  5H2F O;  3BS0 A;  2PRN A;  1MM4 A;  2FGQ X;  1ZHX A;  3NSG A;  4AKR B;  4CTD A;  3SY9 A;  2O4V A;  2KDY A;  4N74 A;  3LK3 A;  2R88 A;  3QRC A;  5B66 O;  3SZD A;  4FSO A;  3SY7 A;  4AYE C;  5B5E O;  7PRN A;  1MPF A;  2WJR A;  4RLB A;  2W81 C;  3PGS A;  5D5D A;  2N2L A;  1IZN B;  3HW9 A;  3JCU O;  5E79 O;  1GFM A;  3A0H O;  3T24 A;  1BH3 A;  3T0S A;  2J4U P;  2ZLD A;  4PR7 A;  4XNL A;  3A2S X;  4AYD C;  3GP6 A;  4B61 A;  1HXU A;  4G75 A;  4FRT A;  2R4N A;  3C5O A;  2X9K A;  2Y0K A;  3SYS A;  2K0L A;  2Y2X A;  4C4V A;  5JDP A;  1T16 A;  1ORM A;  2YNK A;  2XE1 A;  4N59 A;  2XE3 A;  2F1V A;  5FVN A;  3KVD D;  4Z3T A;  1P4T A;  5DL6 A;  5GV0 A;  2JMM A;  2WJQ A;  2X27 X;  4FUV A;  4JCH A;  4RL9 A;  2KXP B;  1G90 A;  4FRX A;  5GTI O;  3G7G A;  4E1T A;  3WI4 A;  3UU2 A;  4RLC A;  5TIS O;  2QTK A;  3V8U A;  4FZM A;  3AAE B;  3VE2 A;  3NJT A;  4FSP A;  4FMS A;  3DA3 A;  3VZT X;  4K3B A;  4KR4 A;  4K3C A;  4QQ1 A;  4AYM C;  2ODJ A;  4GF4 A;  1HXT A;  3HOL A;  2FGR A;  3KZI O;  4AYN A;  1Q9G A;  2R8A A;  3POU A;  2ZFG A;  4JFB A; 
#chains in the Genus database with same CATH homology
 5G38 A;  5GTH O;  2AXT O;  3WU2 O;  3A0B O;  5G3A A;  4PJ0 O;  4IL6 O;  3JCU O;  1S5L O;  5GTI O;  4UB8 O;  5G39 A;  5H2F O;  5TIS O;  5KAI O;  4UB6 O;  5B66 O;  5B5E O;  3KZI O;  5E79 O;  3A0H O;  5KAF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...