4IL6O

Structure of sr-substituted photosystem ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 53
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 4il6O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 4il6O02
5H2FO 5G39A 4UB6O 5KAFO 5KAIO 5B66O 3A0HO 5GTIO 3KZIO 2AXTO 3JCUO 5G38A 3WU2O 5E79O 1S5LO 5B5EO 5TISO 5G3AA 3A0BO 4IL6O 5GTHO 4PJ0O 4UB8O
chains in the Genus database with same CATH superfamily
4KR8A 1Q9GA 2R89A 4N74A 5H2FO 4FSOA 1ZHXA 5IYUA 2WJQA 2XG6A 4FZMA 1MM4A 2Y0KA 4KR4A 5KAIO 3BS0A 2O4VA 3LK3A 3SY9A 2IWWA 5GTIO 4AYEC 4C00A 3DWNA 3HWBA 1E54A 2Y0LA 2MNHA 5G26A 2ODJA 4GHBA 4FOZA 1OSMA 3K19A 4LSIA 4QQ1A 5EE2A 4D64A 4F4BA 6PRNA 4FMSA 5G38A 1HXXA 3GP6A 2XTRA 5E79O 8PRNA 4E1SA 1BXWA 4FRTA 3SZDA 3RBHA 4O4UA 1BH3A 4FZLA 4KRAA 3AA1B 4AYMC 2R4OA 2W81C 3AA7B 1G90A 3PQSA 3HOLA 2N2MA 2QTKA 2R4NA 4PUXA 3PORA 1ZHZA 4PJ0O 4O3YA 1PHOA 2F1TA 3HW9A 3AA7A 3T20A 3AA1A 5GV0A 4GCPA 4JCHA 4XNKA 7PRNA 1YS5A 2K0LA 1GFNA 2Y7SA 2F1VA 4O3XB 3VE1A 5G39A 2YNKA 4O4XA 1ZHWA 3A0HO 1HXUA 3T0SA 2FGRA 3VZWX 3DA4A 4G75A 2X9KA 5DL5A 2JQYA 3AAAB 4B61A 3WI4A 4D5UA 4N58A 1H6S1 4AKMA 1Q9FA 1GFOA 4FRXA 4AZLA 2JMMA 3AAAA 4AYID 2XE2A 2OMFA 4AUIA 4C69X 3JTYA 2PORA 4UB8O 1QJ8A 3EMNX 2MHLA 3PRNA 4GCSA 5G3AA 5TISO 4AKRB 2X27X 3LK2A 4BUMX 3QRCA 3O0EA 3SYBA 3PGSA 4IL6O 3C5OA 3WI5A 4O3WA 3LK2B 3TZGA 1ZHYA 1ORMA 4LSEA 3PQUA 2ZLDA 2KZ7B 5DL7A 3V8UA 4N59A 4U9CA 4XNLA 3AAEB 3LK41 3NSGA 2R4PA 3NJTA 4FESA 4FSPA 2XE3A 1GFMA 3G7GA 3T24A 4AYDC 5ADXK 4AFKA 3UPGA 2W80C 4K3CA 5DL6A 1BT9A 2KC0A 5ADXL 3POUA 4RJWA 4CTDA 2R88A 2N2LA 3POQA 2R8AA 2XTQA 3VZUX 5AFUL 3VZTX 4GCQA 3UAQA 3PGRA 3DZMA 3HOEA 3KVDD 3WU2O 1QJPA 3AAEA 4RL9A 3BRYA 5JDPA 5T5FA 1QJ9A 3DA3A 4LSFA 2KXPA 4O49A 5B5EO 3A0BO 2FGQX 4G76A 2J1NA 1THQA 5DL8A 5D5DA 5GTHO 2WVPA 3VY8X 1PRNA 2XE1A 1IZNA 2KZ7A 3VY9X 1P4TA 5FVNA 4AKRA 2WJRA 2XE5A 1GFQA 2ZFGA 3FYXA 4C4VA 1OPFA 2Y0HA 1GFPA 3AA6B 4FQEA 5KAFO 4UB6O 3SZVA 5B66O 2KXPB 2J4UP 3VE2A 3AA0A 3POXA 3KZIO 4RLCA 3BRZA 4K3BA 3DWOX 4FUVA 2IWVA 3AA0B 4E1TA 1HXTA 2AXTO 3JCUO 3PGUA 4PR7A 3UU2A 4FT6A 2YPVA 1T16A 4D65A 2Y2XA 4RJXA 3PF1A 4FZNA 4RLBA 1MM5A 3LK42 3A2SX 4GF4A 2M06A 1S5LO 3LK3B 4O3ZA 3AA6A 3SY7A 4C4VB 4Z3TA 1T1LA 1ZHTA 2GE4A 3QRAA 4JFBA 1MPFA 2F1CX 4AYNA 4N75A 2LFUA 5AFUK 2K4TA 2LHFA 2XMXA 2ERVA 1IZNB 4LSHA 5PRNA 3SYSA 2R4LA 2M07A 2KDYA 2PRNA
chains in the Genus database with same CATH topology
5H2FO 5G39A 4UB6O 5KAFO 5KAIO 5B66O 3A0HO 5GTIO 3KZIO 2AXTO 3JCUO 5G38A 3WU2O 5E79O 1S5LO 5B5EO 5TISO 5G3AA 3A0BO 4IL6O 5GTHO 4PJ0O 4UB8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F O;  5G39 A;  4UB6 O;  5KAF O;  5KAI O;  5B66 O;  3A0H O;  5GTI O;  3KZI O;  2AXT O;  3JCU O;  5G38 A;  3WU2 O;  5E79 O;  1S5L O;  5B5E O;  5TIS O;  5G3A A;  3A0B O;  4IL6 O;  5GTH O;  4PJ0 O;  4UB8 O; 
#chains in the Genus database with same CATH topology
 4KR8 A;  1Q9G A;  2R89 A;  4N74 A;  5H2F O;  4FSO A;  1ZHX A;  5IYU A;  2WJQ A;  2XG6 A;  4FZM A;  1MM4 A;  2Y0K A;  4KR4 A;  5KAI O;  3BS0 A;  2O4V A;  3LK3 A;  3SY9 A;  2IWW A;  5GTI O;  4AYE C;  4C00 A;  3DWN A;  3HWB A;  1E54 A;  2Y0L A;  2MNH A;  5G26 A;  2ODJ A;  4GHB A;  4FOZ A;  1OSM A;  3K19 A;  4LSI A;  4QQ1 A;  5EE2 A;  4D64 A;  4F4B A;  6PRN A;  4FMS A;  5G38 A;  1HXX A;  3GP6 A;  2XTR A;  5E79 O;  8PRN A;  4E1S A;  1BXW A;  4FRT A;  3SZD A;  3RBH A;  4O4U A;  1BH3 A;  4FZL A;  4KRA A;  3AA1 B;  4AYM C;  2R4O A;  2W81 C;  3AA7 B;  1G90 A;  3PQS A;  3HOL A;  2N2M A;  2QTK A;  2R4N A;  4PUX A;  3POR A;  1ZHZ A;  4PJ0 O;  4O3Y A;  1PHO A;  2F1T A;  3HW9 A;  3AA7 A;  3T20 A;  3AA1 A;  5GV0 A;  4GCP A;  4JCH A;  4XNK A;  7PRN A;  1YS5 A;  2K0L A;  1GFN A;  2Y7S A;  2F1V A;  4O3X B;  3VE1 A;  5G39 A;  2YNK A;  4O4X A;  1ZHW A;  3A0H O;  1HXU A;  3T0S A;  2FGR A;  3VZW X;  3DA4 A;  4G75 A;  2X9K A;  5DL5 A;  2JQY A;  3AAA B;  4B61 A;  3WI4 A;  4D5U A;  4N58 A;  1H6S 1;  4AKM A;  1Q9F A;  1GFO A;  4FRX A;  4AZL A;  2JMM A;  3AAA A;  4AYI D;  2XE2 A;  2OMF A;  4AUI A;  4C69 X;  3JTY A;  2POR A;  4UB8 O;  1QJ8 A;  3EMN X;  2MHL A;  3PRN A;  4GCS A;  5G3A A;  5TIS O;  4AKR B;  2X27 X;  3LK2 A;  4BUM X;  3QRC A;  3O0E A;  3SYB A;  3PGS A;  4IL6 O;  3C5O A;  3WI5 A;  4O3W A;  3LK2 B;  3TZG A;  1ZHY A;  1ORM A;  4LSE A;  3PQU A;  2ZLD A;  2KZ7 B;  5DL7 A;  3V8U A;  4N59 A;  4U9C A;  4XNL A;  3AAE B;  3LK4 1;  3NSG A;  2R4P A;  3NJT A;  4FES A;  4FSP A;  2XE3 A;  1GFM A;  3G7G A;  3T24 A;  4AYD C;  5ADX K;  4AFK A;  3UPG A;  2W80 C;  4K3C A;  5DL6 A;  1BT9 A;  2KC0 A;  5ADX L;  3POU A;  4RJW A;  4CTD A;  2R88 A;  2N2L A;  3POQ A;  2R8A A;  2XTQ A;  3VZU X;  5AFU L;  3VZT X;  4GCQ A;  3UAQ A;  3PGR A;  3DZM A;  3HOE A;  3KVD D;  3WU2 O;  1QJP A;  3AAE A;  4RL9 A;  3BRY A;  5JDP A;  5T5F A;  1QJ9 A;  3DA3 A;  4LSF A;  2KXP A;  4O49 A;  5B5E O;  3A0B O;  2FGQ X;  4G76 A;  2J1N A;  1THQ A;  5DL8 A;  5D5D A;  5GTH O;  2WVP A;  3VY8 X;  1PRN A;  2XE1 A;  1IZN A;  2KZ7 A;  3VY9 X;  1P4T A;  5FVN A;  4AKR A;  2WJR A;  2XE5 A;  1GFQ A;  2ZFG A;  3FYX A;  4C4V A;  1OPF A;  2Y0H A;  1GFP A;  3AA6 B;  4FQE A;  5KAF O;  4UB6 O;  3SZV A;  5B66 O;  2KXP B;  2J4U P;  3VE2 A;  3AA0 A;  3POX A;  3KZI O;  4RLC A;  3BRZ A;  4K3B A;  3DWO X;  4FUV A;  2IWV A;  3AA0 B;  4E1T A;  1HXT A;  2AXT O;  3JCU O;  3PGU A;  4PR7 A;  3UU2 A;  4FT6 A;  2YPV A;  1T16 A;  4D65 A;  2Y2X A;  4RJX A;  3PF1 A;  4FZN A;  4RLB A;  1MM5 A;  3LK4 2;  3A2S X;  4GF4 A;  2M06 A;  1S5L O;  3LK3 B;  4O3Z A;  3AA6 A;  3SY7 A;  4C4V B;  4Z3T A;  1T1L A;  1ZHT A;  2GE4 A;  3QRA A;  4JFB A;  1MPF A;  2F1C X;  4AYN A;  4N75 A;  2LFU A;  5AFU K;  2K4T A;  2LHF A;  2XMX A;  2ERV A;  1IZN B;  4LSH A;  5PRN A;  3SYS A;  2R4L A;  2M07 A;  2KDY A;  2PRN A; 
#chains in the Genus database with same CATH homology
 5H2F O;  5G39 A;  4UB6 O;  5KAF O;  5KAI O;  5B66 O;  3A0H O;  5GTI O;  3KZI O;  2AXT O;  3JCU O;  5G38 A;  3WU2 O;  5E79 O;  1S5L O;  5B5E O;  5TIS O;  5G3A A;  3A0B O;  4IL6 O;  5GTH O;  4PJ0 O;  4UB8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...