1MPFA

Structural and functional alterations of a colicin resistant mutant of ompf-porin from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFDGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional alterations of a colicin-resistant mutant of OmpF porin from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1994-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1mpfA00
2J4UP 3POQA 2PORA 1E54A 1OPFA 3JTYA 2Y0KA 3PRNA 2J1NA 3VZWX 4RJWA 3K19A 2XG6A 1BH3A 3SZDA 4BUMX 2ZFGA 1PRNA 8PRNA 4FOZA 3SZVA 3T20A 3UU2A 3HWBA 4GCSA 4LSEA 1GFOA 1GFPA 5PRNA 6PRNA 2Y2XA 3UPGA 4D64A 1BT9A 2XE2A 3VZTX 1OSMA 5FVNA 1HXUA 5DL8A 3SY9A 2XE5A 4KRAA 3NSGA 4GCPA 4KR4A 4FRTA 4FSOA 4D5UA 3T24A 3SY7A 3SYBA 3PORA 4FT6A 4KR8A 1PHOA 1MPFA 2K4TA 4LSIA 2Y0LA 4FSPA 5JDPA 3VZUX 4JFBA 4AUIA 3EMNX 2ZLDA 3SYSA 4D65A 2FGQX 1GFMA 3O0EA 2PRNA 3POXA 3POUA 2FGRA 1HXTA 3VY8X 2OMFA 5DL7A 5DL6A 3HW9A 4C69X 4LSHA 4LSFA 3WI4A 3FYXA 1H6S1 1GFNA 3VY9X 2ODJA 3WI5A 2O4VA 4GCQA 3A2SX 4FMSA 4RJXA 4FRXA 5DL5A 1GFQA 1HXXA 2Y0HA 3T0SA 7PRNA 2XE1A 2QTKA 2XE3A
chains in the Genus database with same CATH superfamily
2R4OA 2J4UP 3POQA 2PORA 1MM4A 1E54A 4IL6O 1OPFA 3JTYA 3DWOX 4O3ZA 5G26A 2Y0KA 3KZIO 3QRCA 3PRNA 2F1VA 1YS5A 2J1NA 3A0BO 3VZWX 4C00A 1P4TA 5B66O 4FZNA 4FQEA 4FESA 4RJWA 3K19A 1ZHZA 3LK41 2XG6A 1QJ8A 2KC0A 1BH3A 4E1SA 3SZDA 3HOEA 4BUMX 2ZFGA 3LK2A 4XNLA 1PRNA 2AXTO 5EE2A 8PRNA 4O4XA 3PGUA 4PR7A 3UAQA 4FOZA 2YPVA 2XTRA 3SZVA 5E79O 4RL9A 3UU2A 3T20A 3PGSA 2WJRA 2WVPA 1G90A 2XTQA 3HWBA 4GCSA 4XNKA 4LSEA 3AA6A 1GFOA 3AAAA 1GFPA 2MNHA 4G76A 5T5FA 4UB8O 5PRNA 4K3BA 6PRNA 2Y2XA 3DZMA 4GHBA 4AKRA 2YNKA 4AKMA 4N74A 4O3YA 3NJTA 3AAEB 3LK3A 4JCHA 4O49A 2WJQA 3RBHA 3VE2A 1ZHTA 2GE4A 3KVDD 4GF4A 5H2FO 3UPGA 3PQSA 2LFUA 4N75A 4AYID 4D64A 1BT9A 4C4VA 1IZNA 2R88A 3AA0A 2XE2A 3VZTX 4AYDC 1OSMA 5FVNA 5IYUA 3QRAA 3AA6B 1HXUA 4PUXA 5DL8A 1ZHWA 4RLCA 4QQ1A 3SY9A 1Q9FA 2XE5A 2X27X 3NSGA 4KRAA 4GCPA 5AFUK 4KR4A 3LK3B 1THQA 5GTIO 4FRTA 4FSOA 4D5UA 1ZHXA 5G39A 3T24A 2K0LA 2KDYA 3VE1A 4C4VB 3AA0B 3SY7A 5ADXK 3SYBA 2IWVA 3PORA 4FT6A 1Q9GA 4KR8A 1PHOA 1MPFA 1QJ9A 2ERVA 2K4TA 4LSIA 2KXPA 2Y0LA 4O3WA 5GV0A 4N59A 3LK2B 4FUVA 5ADXL 4FSPA 5JDPA 3VZUX 4JFBA 2R89A 3G7GA 3V8UA 2KZ7A 2JMMA 4FZMA 4AUIA 3EMNX 4AYNA 2ZLDA 1ZHYA 1S5LO 4AZLA 2R4NA 3SYSA 2F1CX 4D65A 5B5EO 2FGQX 3JCUO 5D5DA 3C5OA 3AAAB 3AA7A 2IWWA 3BS0A 5GTHO 3BRYA 1GFMA 4AKRB 4AFKA 3PF1A 2JQYA 3AA1A 3O0EA 2KXPB 2R4LA 2PRNA 3POXA 3A0HO 3POUA 4UB6O 4O3XB 5AFUL 2FGRA 3GP6A 2KZ7B 4U9CA 4AYMC 5KAFO 4FZLA 1HXTA 1IZNB 2XMXA 3DA3A 2N2LA 3PGRA 4N58A 2OMFA 2Y7SA 4PJ0O 3VY8X 5DL7A 4G75A 5DL6A 3AA7B 2MHLA 2N2MA 3HW9A 3BRZA 5G38A 4C69X 2X9KA 4K3CA 4LSHA 4RLBA 4E1TA 2M06A 3AA1B 4LSFA 2M07A 3WI4A 2R4PA 2LHFA 3AAEA 3FYXA 1T16A 1H6S1 1ORMA 1BXWA 3PQUA 1GFNA 5KAIO 4AYEC 3VY9X 5TISO 1QJPA 4B61A 2ODJA 2R8AA 3WI5A 2O4VA 1T1LA 5G3AA 3DWNA 4Z3TA 4GCQA 3A2SX 1MM5A 2W81C 4FMSA 4FRXA 4RJXA 1GFQA 5DL5A 3TZGA 3LK42 1HXXA 4O4UA 3WU2O 2F1TA 3HOLA 2Y0HA 4F4BA 3DA4A 3T0SA 7PRNA 2W80C 2XE1A 4CTDA 2QTKA 2XE3A
chains in the Genus database with same CATH topology
2J4UP 3POQA 2PORA 1MM4A 1E54A 5G26A 1OPFA 3JTYA 4O3ZA 2Y0KA 3QRCA 3PRNA 2F1VA 1YS5A 2J1NA 3VZWX 1P4TA 4FZNA 4FESA 4RJWA 3K19A 1ZHZA 3LK41 2XG6A 1QJ8A 2KC0A 1BH3A 4E1SA 3SZDA 3HOEA 4BUMX 2ZFGA 3LK2A 4XNLA 1PRNA 5EE2A 8PRNA 4O4XA 3UAQA 4FOZA 2YPVA 2XTRA 3SZVA 4RL9A 3UU2A 3T20A 1G90A 2XTQA 3HWBA 4GCSA 4XNKA 4LSEA 3AA6A 1GFOA 3AAAA 1GFPA 2MNHA 4G76A 5T5FA 5PRNA 6PRNA 2Y2XA 4GHBA 4AKRA 2YNKA 4AKMA 4O3YA 3AAEB 3LK3A 4JCHA 4O49A 3RBHA 3VE2A 3UPGA 1ZHTA 2GE4A 3KVDD 4GF4A 3PQSA 2LFUA 4AYID 4D64A 1BT9A 1IZNA 3AA0A 2XE2A 3VZTX 4AYDC 1OSMA 5FVNA 5IYUA 3QRAA 3AA6B 1HXUA 4PUXA 5DL8A 1ZHWA 4RLCA 4QQ1A 3SY9A 1Q9FA 2XE5A 2X27X 3NSGA 4KRAA 4GCPA 5AFUK 4KR4A 3LK3B 1THQA 4FRTA 4FSOA 4D5UA 1ZHXA 3T24A 2K0LA 2KDYA 3VE1A 3AA0B 3SY7A 5ADXK 3SYBA 3PORA 4FT6A 1Q9GA 4KR8A 1PHOA 1MPFA 1QJ9A 2ERVA 2K4TA 4LSIA 2KXPA 2Y0LA 4O3WA 5GV0A 4N59A 3LK2B 4FUVA 5ADXL 4FSPA 5JDPA 3VZUX 4JFBA 3G7GA 3V8UA 2KZ7A 2JMMA 4FZMA 4AUIA 3EMNX 4AYNA 2ZLDA 1ZHYA 4AZLA 3SYSA 4D65A 2FGQX 5D5DA 3C5OA 3AAAB 3AA7A 1GFMA 4AKRB 4AFKA 3AA1A 3O0EA 2KXPB 2PRNA 3POXA 3POUA 4O3XB 5AFUL 2FGRA 3GP6A 2KZ7B 4U9CA 4AYMC 4FZLA 1HXTA 1IZNB 2XMXA 3DA3A 2N2LA 4N58A 3VY8X 2OMFA 2Y7SA 5DL7A 4G75A 5DL6A 3AA7B 2MHLA 2N2MA 3HW9A 4C69X 4LSHA 4RLBA 4E1TA 2M06A 3AA1B 4LSFA 2M07A 3WI4A 2LHFA 3AAEA 3FYXA 3PQUA 1H6S1 1ORMA 1BXWA 4AYEC 1GFNA 3VY9X 1QJPA 4B61A 2ODJA 3WI5A 2O4VA 4Z3TA 4GCQA 3A2SX 1MM5A 2W81C 4FMSA 4FRXA 4RJXA 1GFQA 5DL5A 3TZGA 3LK42 1HXXA 4O4UA 2F1TA 3HOLA 2Y0HA 4F4BA 3DA4A 3T0SA 7PRNA 2W80C 2XE1A 2QTKA 2XE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4U P;  3POQ A;  2POR A;  1E54 A;  1OPF A;  3JTY A;  2Y0K A;  3PRN A;  2J1N A;  3VZW X;  4RJW A;  3K19 A;  2XG6 A;  1BH3 A;  3SZD A;  4BUM X;  2ZFG A;  1PRN A;  8PRN A;  4FOZ A;  3SZV A;  3T20 A;  3UU2 A;  3HWB A;  4GCS A;  4LSE A;  1GFO A;  1GFP A;  5PRN A;  6PRN A;  2Y2X A;  3UPG A;  4D64 A;  1BT9 A;  2XE2 A;  3VZT X;  1OSM A;  5FVN A;  1HXU A;  5DL8 A;  3SY9 A;  2XE5 A;  4KRA A;  3NSG A;  4GCP A;  4KR4 A;  4FRT A;  4FSO A;  4D5U A;  3T24 A;  3SY7 A;  3SYB A;  3POR A;  4FT6 A;  4KR8 A;  1PHO A;  1MPF A;  2K4T A;  4LSI A;  2Y0L A;  4FSP A;  5JDP A;  3VZU X;  4JFB A;  4AUI A;  3EMN X;  2ZLD A;  3SYS A;  4D65 A;  2FGQ X;  1GFM A;  3O0E A;  2PRN A;  3POX A;  3POU A;  2FGR A;  1HXT A;  3VY8 X;  2OMF A;  5DL7 A;  5DL6 A;  3HW9 A;  4C69 X;  4LSH A;  4LSF A;  3WI4 A;  3FYX A;  1H6S 1;  1GFN A;  3VY9 X;  2ODJ A;  3WI5 A;  2O4V A;  4GCQ A;  3A2S X;  4FMS A;  4RJX A;  4FRX A;  5DL5 A;  1GFQ A;  1HXX A;  2Y0H A;  3T0S A;  7PRN A;  2XE1 A;  2QTK A;  2XE3 A; 
#chains in the Genus database with same CATH topology
 2R4O A;  2J4U P;  3POQ A;  2POR A;  1MM4 A;  1E54 A;  4IL6 O;  1OPF A;  3JTY A;  3DWO X;  4O3Z A;  5G26 A;  2Y0K A;  3KZI O;  3QRC A;  3PRN A;  2F1V A;  1YS5 A;  2J1N A;  3A0B O;  3VZW X;  4C00 A;  1P4T A;  5B66 O;  4FZN A;  4FQE A;  4FES A;  4RJW A;  3K19 A;  1ZHZ A;  3LK4 1;  2XG6 A;  1QJ8 A;  2KC0 A;  1BH3 A;  4E1S A;  3SZD A;  3HOE A;  4BUM X;  2ZFG A;  3LK2 A;  4XNL A;  1PRN A;  2AXT O;  5EE2 A;  8PRN A;  4O4X A;  3PGU A;  4PR7 A;  3UAQ A;  4FOZ A;  2YPV A;  2XTR A;  3SZV A;  5E79 O;  4RL9 A;  3UU2 A;  3T20 A;  3PGS A;  2WJR A;  2WVP A;  1G90 A;  2XTQ A;  3HWB A;  4GCS A;  4XNK A;  4LSE A;  3AA6 A;  1GFO A;  3AAA A;  1GFP A;  2MNH A;  4G76 A;  5T5F A;  4UB8 O;  5PRN A;  4K3B A;  6PRN A;  2Y2X A;  3DZM A;  4GHB A;  4AKR A;  2YNK A;  4AKM A;  4N74 A;  4O3Y A;  3NJT A;  3AAE B;  3LK3 A;  4JCH A;  4O49 A;  2WJQ A;  3RBH A;  3VE2 A;  1ZHT A;  2GE4 A;  3KVD D;  4GF4 A;  5H2F O;  3UPG A;  3PQS A;  2LFU A;  4N75 A;  4AYI D;  4D64 A;  1BT9 A;  4C4V A;  1IZN A;  2R88 A;  3AA0 A;  2XE2 A;  3VZT X;  4AYD C;  1OSM A;  5FVN A;  5IYU A;  3QRA A;  3AA6 B;  1HXU A;  4PUX A;  5DL8 A;  1ZHW A;  4RLC A;  4QQ1 A;  3SY9 A;  1Q9F A;  2XE5 A;  2X27 X;  3NSG A;  4KRA A;  4GCP A;  5AFU K;  4KR4 A;  3LK3 B;  1THQ A;  5GTI O;  4FRT A;  4FSO A;  4D5U A;  1ZHX A;  5G39 A;  3T24 A;  2K0L A;  2KDY A;  3VE1 A;  4C4V B;  3AA0 B;  3SY7 A;  5ADX K;  3SYB A;  2IWV A;  3POR A;  4FT6 A;  1Q9G A;  4KR8 A;  1PHO A;  1MPF A;  1QJ9 A;  2ERV A;  2K4T A;  4LSI A;  2KXP A;  2Y0L A;  4O3W A;  5GV0 A;  4N59 A;  3LK2 B;  4FUV A;  5ADX L;  4FSP A;  5JDP A;  3VZU X;  4JFB A;  2R89 A;  3G7G A;  3V8U A;  2KZ7 A;  2JMM A;  4FZM A;  4AUI A;  3EMN X;  4AYN A;  2ZLD A;  1ZHY A;  1S5L O;  4AZL A;  2R4N A;  3SYS A;  2F1C X;  4D65 A;  5B5E O;  2FGQ X;  3JCU O;  5D5D A;  3C5O A;  3AAA B;  3AA7 A;  2IWW A;  3BS0 A;  5GTH O;  3BRY A;  1GFM A;  4AKR B;  4AFK A;  3PF1 A;  2JQY A;  3AA1 A;  3O0E A;  2KXP B;  2R4L A;  2PRN A;  3POX A;  3A0H O;  3POU A;  4UB6 O;  4O3X B;  5AFU L;  2FGR A;  3GP6 A;  2KZ7 B;  4U9C A;  4AYM C;  5KAF O;  4FZL A;  1HXT A;  1IZN B;  2XMX A;  3DA3 A;  2N2L A;  3PGR A;  4N58 A;  2OMF A;  2Y7S A;  4PJ0 O;  3VY8 X;  5DL7 A;  4G75 A;  5DL6 A;  3AA7 B;  2MHL A;  2N2M A;  3HW9 A;  3BRZ A;  5G38 A;  4C69 X;  2X9K A;  4K3C A;  4LSH A;  4RLB A;  4E1T A;  2M06 A;  3AA1 B;  4LSF A;  2M07 A;  3WI4 A;  2R4P A;  2LHF A;  3AAE A;  3FYX A;  1T16 A;  1H6S 1;  1ORM A;  1BXW A;  3PQU A;  1GFN A;  5KAI O;  4AYE C;  3VY9 X;  5TIS O;  1QJP A;  4B61 A;  2ODJ A;  2R8A A;  3WI5 A;  2O4V A;  1T1L A;  5G3A A;  3DWN A;  4Z3T A;  4GCQ A;  3A2S X;  1MM5 A;  2W81 C;  4FMS A;  4FRX A;  4RJX A;  1GFQ A;  5DL5 A;  3TZG A;  3LK4 2;  1HXX A;  4O4U A;  3WU2 O;  2F1T A;  3HOL A;  2Y0H A;  4F4B A;  3DA4 A;  3T0S A;  7PRN A;  2W80 C;  2XE1 A;  4CTD A;  2QTK A;  2XE3 A; 
#chains in the Genus database with same CATH homology
 2J4U P;  3POQ A;  2POR A;  1MM4 A;  1E54 A;  5G26 A;  1OPF A;  3JTY A;  4O3Z A;  2Y0K A;  3QRC A;  3PRN A;  2F1V A;  1YS5 A;  2J1N A;  3VZW X;  1P4T A;  4FZN A;  4FES A;  4RJW A;  3K19 A;  1ZHZ A;  3LK4 1;  2XG6 A;  1QJ8 A;  2KC0 A;  1BH3 A;  4E1S A;  3SZD A;  3HOE A;  4BUM X;  2ZFG A;  3LK2 A;  4XNL A;  1PRN A;  5EE2 A;  8PRN A;  4O4X A;  3UAQ A;  4FOZ A;  2YPV A;  2XTR A;  3SZV A;  4RL9 A;  3UU2 A;  3T20 A;  1G90 A;  2XTQ A;  3HWB A;  4GCS A;  4XNK A;  4LSE A;  3AA6 A;  1GFO A;  3AAA A;  1GFP A;  2MNH A;  4G76 A;  5T5F A;  5PRN A;  6PRN A;  2Y2X A;  4GHB A;  4AKR A;  2YNK A;  4AKM A;  4O3Y A;  3AAE B;  3LK3 A;  4JCH A;  4O49 A;  3RBH A;  3VE2 A;  3UPG A;  1ZHT A;  2GE4 A;  3KVD D;  4GF4 A;  3PQS A;  2LFU A;  4AYI D;  4D64 A;  1BT9 A;  1IZN A;  3AA0 A;  2XE2 A;  3VZT X;  4AYD C;  1OSM A;  5FVN A;  5IYU A;  3QRA A;  3AA6 B;  1HXU A;  4PUX A;  5DL8 A;  1ZHW A;  4RLC A;  4QQ1 A;  3SY9 A;  1Q9F A;  2XE5 A;  2X27 X;  3NSG A;  4KRA A;  4GCP A;  5AFU K;  4KR4 A;  3LK3 B;  1THQ A;  4FRT A;  4FSO A;  4D5U A;  1ZHX A;  3T24 A;  2K0L A;  2KDY A;  3VE1 A;  3AA0 B;  3SY7 A;  5ADX K;  3SYB A;  3POR A;  4FT6 A;  1Q9G A;  4KR8 A;  1PHO A;  1MPF A;  1QJ9 A;  2ERV A;  2K4T A;  4LSI A;  2KXP A;  2Y0L A;  4O3W A;  5GV0 A;  4N59 A;  3LK2 B;  4FUV A;  5ADX L;  4FSP A;  5JDP A;  3VZU X;  4JFB A;  3G7G A;  3V8U A;  2KZ7 A;  2JMM A;  4FZM A;  4AUI A;  3EMN X;  4AYN A;  2ZLD A;  1ZHY A;  4AZL A;  3SYS A;  4D65 A;  2FGQ X;  5D5D A;  3C5O A;  3AAA B;  3AA7 A;  1GFM A;  4AKR B;  4AFK A;  3AA1 A;  3O0E A;  2KXP B;  2PRN A;  3POX A;  3POU A;  4O3X B;  5AFU L;  2FGR A;  3GP6 A;  2KZ7 B;  4U9C A;  4AYM C;  4FZL A;  1HXT A;  1IZN B;  2XMX A;  3DA3 A;  2N2L A;  4N58 A;  3VY8 X;  2OMF A;  2Y7S A;  5DL7 A;  4G75 A;  5DL6 A;  3AA7 B;  2MHL A;  2N2M A;  3HW9 A;  4C69 X;  4LSH A;  4RLB A;  4E1T A;  2M06 A;  3AA1 B;  4LSF A;  2M07 A;  3WI4 A;  2LHF A;  3AAE A;  3FYX A;  3PQU A;  1H6S 1;  1ORM A;  1BXW A;  4AYE C;  1GFN A;  3VY9 X;  1QJP A;  4B61 A;  2ODJ A;  3WI5 A;  2O4V A;  4Z3T A;  4GCQ A;  3A2S X;  1MM5 A;  2W81 C;  4FMS A;  4FRX A;  4RJX A;  1GFQ A;  5DL5 A;  3TZG A;  3LK4 2;  1HXX A;  4O4U A;  2F1T A;  3HOL A;  2Y0H A;  4F4B A;  3DA4 A;  3T0S A;  7PRN A;  2W80 C;  2XE1 A;  2QTK A;  2XE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...