1MPFA

Structural and functional alterations of a colicin resistant mutant of ompf-porin from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFDGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional alterations of a colicin-resistant mutant of OmpF porin from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1994-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1mpfA00
4JFBA 5PRNA 5JDPA 3SY7A 3WI4A 4GCSA 4C69X 3SZVA 1HXXA 2J1NA 2XG6A 2PRNA 2ZFGA 2PORA 2XE3A 5DL7A 4FSPA 4BUMX 1H6S1 5DL6A 3VZUX 1PRNA 1GFPA 4D64A 3A2SX 3O0EA 3SZDA 2FGRA 2Y2XA 4LSIA 2Y0HA 3SYSA 2OMFA 4LSHA 4LSFA 5DL5A 7PRNA 3JTYA 4D65A 2ZLDA 4FMSA 4RJWA 3EMNX 4FOZA 4KR8A 3NSGA 4LSEA 2O4VA 3SY9A 3HWBA 3SYBA 1HXUA 3FYXA 1HXTA 4KRAA 1BT9A 1GFMA 3WI5A 4GCQA 2XE1A 3VZWX 2J4UP 4FRTA 3T24A 4FT6A 4GCPA 4FRXA 4KR4A 3UPGA 4AUIA 1OSMA 8PRNA 5FVNA 2XE5A 3K19A 3VZTX 1GFOA 2XE2A 2ODJA 3VY8X 1PHOA 3POQA 4FSOA 4D5UA 3POXA 1GFQA 5DL8A 2FGQX 2Y0KA 2Y0LA 1BH3A 1E54A 3VY9X 3HW9A 3POUA 3T0SA 1OPFA 2QTKA 3PRNA 3UU2A 3PORA 1MPFA 3T20A 1GFNA 6PRNA 4RJXA 2K4TA
chains in the Genus database with same CATH superfamily
1ZHZA 4G76A 4O3XB 2MHLA 2MNHA 4JFBA 5PRNA 5JDPA 3SY7A 3WI4A 3JCUO 4GCSA 4AFKA 2XTRA 3AA1A 2R4LA 4C69X 2X9KA 1ZHTA 3SZVA 1HXXA 3LK3B 3VE2A 4F4BA 3WU2O 3AA1B 3PQUA 4N59A 4C4VB 2J1NA 2XG6A 2PRNA 2ZFGA 2PORA 2R4NA 4AYEC 4AZLA 1THQA 2XE3A 3G7GA 4D5UA 5DL7A 3HOLA 1YS5A 4FSPA 4BUMX 1H6S1 3DWOX 3PQSA 3AA6A 3DZMA 3GP6A 4UB8O 5DL6A 5E79O 3VZUX 4AKRB 1PRNA 5D5DA 1GFPA 2R8AA 1Q9GA 5KAIO 4D64A 2IWVA 1ZHWA 3A2SX 3AA6B 3O0EA 4FZNA 4IL6O 2FGRA 2YPVA 1ZHYA 4U9CA 2Y2XA 4LSIA 3AAEA 4G75A 4O3WA 4RLBA 1S5LO 3DA3A 4C00A 2N2MA 4K3BA 1G90A 1QJPA 2Y0HA 3LK42 4RL9A 3SYSA 4JCHA 5ADXL 2KZ7B 4UB6O 3AAEB 2ERVA 2OMFA 3A0HO 3LK2A 2LFUA 3LK3A 4LSHA 4LSFA 5DL5A 3JTYA 4E1SA 4C4VA 5AFUK 4O3YA 2ZLDA 4D65A 4FZLA 1MM5A 5EE2A 3LK2B 4FMSA 1ORMA 4RJWA 4E1TA 3EMNX 4Z3TA 4FOZA 4RLCA 4FQEA 4KR8A 2JQYA 2K0LA 3LK41 3NSGA 3RBHA 4O4XA 4LSEA 2O4VA 3SY9A 4PUXA 3HWBA 2YNKA 3SYBA 1HXUA 2XTQA 3AA7B 3FYXA 1HXTA 2X27X 4QQ1A 2R4OA 4KRAA 2KDYA 2KC0A 4N74A 1T16A 2WJRA 4AYMC 3HOEA 4AYNA 1IZNB 1BT9A 2KZ7A 1GFMA 1MM4A 4N75A 3WI5A 4GCQA 2XE1A 3VZWX 2J4UP 2W80C 4FRTA 4GF4A 4O3ZA 4FT6A 4GCPA 3PGRA 3T24A 5B66O 3AA0A 4FRXA 3AAAA 4KR4A 5IYUA 3UPGA 4AUIA 1OSMA 2F1CX 5T5FA 5AFUL 8PRNA 2F1TA 3AA0B 3DA4A 3AAAB 4XNLA 3C5OA 2JMMA 5G26A 1BXWA 4FZMA 3NJTA 3PF1A 4PR7A 2XE5A 5FVNA 2M07A 3AA7A 3K19A 3TZGA 4CTDA 3KVDD 5G38A 4N58A 4PJ0O 3VZTX 2GE4A 3KZIO 1Q9FA 3PGSA 2Y7SA 1GFOA 1IZNA 2XE2A 2ODJA 3VY8X 3BS0A 1PHOA 3DWNA 3POQA 4FSOA 1QJ9A 3V8UA 4B61A 2KXPB 5KAFO 3POXA 3VE1A 3A0BO 1GFQA 3QRCA 4AKMA 2XMXA 5DL8A 5ADXK 5H2FO 7PRNA 2IWWA 2FGQX 2AXTO 2Y0KA 2W81C 2Y0LA 1BH3A 4XNKA 1E54A 5G39A 3VY9X 2N2LA 3HW9A 1QJ8A 2R89A 5GV0A 4GHBA 3POUA 4AYDC 1ZHXA 3T0SA 1T1LA 3SZDA 1OPFA 4O49A 2LHFA 5G3AA 3QRAA 2QTKA 2R4PA 3PGUA 3PRNA 3UAQA 4FESA 3UU2A 3PORA 1MPFA 2F1VA 2M06A 5TISO 4O4UA 4AYID 5B5EO 2R88A 2WJQA 4K3CA 3T20A 2WVPA 4AKRA 1GFNA 1P4TA 6PRNA 5GTHO 4FUVA 5GTIO 4RJXA 2KXPA 2K4TA 3BRYA 3BRZA
chains in the Genus database with same CATH topology
1ZHZA 4G76A 4O3XB 2MHLA 2MNHA 4JFBA 5PRNA 5JDPA 3SY7A 3WI4A 4GCSA 4AFKA 2XTRA 3AA1A 4C69X 1ZHTA 3SZVA 1HXXA 3LK3B 3VE2A 4F4BA 3AA1B 3PQUA 4N59A 2J1NA 2XG6A 2PRNA 2ZFGA 2PORA 4AYEC 4AZLA 1THQA 2XE3A 3G7GA 5DL7A 3HOLA 1YS5A 4FSPA 4BUMX 1H6S1 3PQSA 3AA6A 3GP6A 5DL6A 3VZUX 1PRNA 5D5DA 1GFPA 1Q9GA 4D64A 1ZHWA 3A2SX 3AA6B 3O0EA 4FZNA 4U9CA 2FGRA 2YPVA 1ZHYA 3SZDA 2Y2XA 4LSIA 3AAEA 4G75A 4O3WA 4RLBA 3DA3A 1G90A 2N2MA 1QJPA 2Y0HA 3LK42 4RL9A 3SYSA 4JCHA 5ADXL 2KZ7B 3AAEB 2ERVA 2OMFA 3LK2A 3LK3A 2LFUA 4LSHA 4LSFA 5DL5A 4E1SA 3JTYA 7PRNA 4O3YA 2ZLDA 4D65A 4FZLA 1MM5A 5EE2A 3LK2B 4FMSA 1ORMA 4RJWA 4E1TA 3EMNX 4Z3TA 4FOZA 4RLCA 4KR8A 3LK41 2K0LA 3NSGA 3RBHA 4O4XA 4LSEA 2O4VA 3SY9A 4PUXA 3HWBA 2YNKA 3SYBA 1HXUA 2XTQA 3AA7B 3FYXA 1HXTA 2X27X 4QQ1A 4KRAA 2KDYA 2KC0A 4AYMC 3HOEA 4AYNA 1IZNB 1BT9A 2KZ7A 1GFMA 1MM4A 3WI5A 4GCQA 2XE1A 3VZWX 2J4UP 2W80C 4FRTA 4GF4A 4O3ZA 4FT6A 4GCPA 3T24A 5IYUA 3AA0A 4FRXA 3AAAA 4KR4A 3UPGA 4AUIA 1OSMA 5T5FA 5AFUL 8PRNA 2F1TA 3AA0B 3DA4A 3AAAB 4XNLA 3C5OA 2JMMA 5G26A 1BXWA 4FZMA 5FVNA 2XE5A 2M07A 3AA7A 3K19A 3TZGA 3KVDD 4N58A 3VZTX 2GE4A 1Q9FA 2Y7SA 1GFOA 1IZNA 2XE2A 2ODJA 3VY8X 4AKRB 1PHOA 3POQA 4FSOA 3V8UA 1QJ9A 4D5UA 5AFUK 2KXPB 3POXA 3VE1A 3QRCA 1GFQA 4AKMA 2XMXA 5DL8A 5ADXK 2FGQX 2Y0KA 2W81C 2Y0LA 1BH3A 4XNKA 1E54A 3VY9X 2N2LA 3HW9A 1QJ8A 5GV0A 4GHBA 3POUA 4AYDC 1ZHXA 3T0SA 1OPFA 4O49A 2LHFA 3QRAA 2QTKA 3PRNA 3UAQA 4FESA 3UU2A 3PORA 1MPFA 2F1VA 2M06A 4AYID 4O4UA 3T20A 4AKRA 1GFNA 1P4TA 6PRNA 4FUVA 4RJXA 2KXPA 2K4TA 4B61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFB A;  5PRN A;  5JDP A;  3SY7 A;  3WI4 A;  4GCS A;  4C69 X;  3SZV A;  1HXX A;  2J1N A;  2XG6 A;  2PRN A;  2ZFG A;  2POR A;  2XE3 A;  5DL7 A;  4FSP A;  4BUM X;  1H6S 1;  5DL6 A;  3VZU X;  1PRN A;  1GFP A;  4D64 A;  3A2S X;  3O0E A;  3SZD A;  2FGR A;  2Y2X A;  4LSI A;  2Y0H A;  3SYS A;  2OMF A;  4LSH A;  4LSF A;  5DL5 A;  7PRN A;  3JTY A;  4D65 A;  2ZLD A;  4FMS A;  4RJW A;  3EMN X;  4FOZ A;  4KR8 A;  3NSG A;  4LSE A;  2O4V A;  3SY9 A;  3HWB A;  3SYB A;  1HXU A;  3FYX A;  1HXT A;  4KRA A;  1BT9 A;  1GFM A;  3WI5 A;  4GCQ A;  2XE1 A;  3VZW X;  2J4U P;  4FRT A;  3T24 A;  4FT6 A;  4GCP A;  4FRX A;  4KR4 A;  3UPG A;  4AUI A;  1OSM A;  8PRN A;  5FVN A;  2XE5 A;  3K19 A;  3VZT X;  1GFO A;  2XE2 A;  2ODJ A;  3VY8 X;  1PHO A;  3POQ A;  4FSO A;  4D5U A;  3POX A;  1GFQ A;  5DL8 A;  2FGQ X;  2Y0K A;  2Y0L A;  1BH3 A;  1E54 A;  3VY9 X;  3HW9 A;  3POU A;  3T0S A;  1OPF A;  2QTK A;  3PRN A;  3UU2 A;  3POR A;  1MPF A;  3T20 A;  1GFN A;  6PRN A;  4RJX A;  2K4T A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  4G76 A;  4O3X B;  2MHL A;  2MNH A;  4JFB A;  5PRN A;  5JDP A;  3SY7 A;  3WI4 A;  3JCU O;  4GCS A;  4AFK A;  2XTR A;  3AA1 A;  2R4L A;  4C69 X;  2X9K A;  1ZHT A;  3SZV A;  1HXX A;  3LK3 B;  3VE2 A;  4F4B A;  3WU2 O;  3AA1 B;  3PQU A;  4N59 A;  4C4V B;  2J1N A;  2XG6 A;  2PRN A;  2ZFG A;  2POR A;  2R4N A;  4AYE C;  4AZL A;  1THQ A;  2XE3 A;  3G7G A;  4D5U A;  5DL7 A;  3HOL A;  1YS5 A;  4FSP A;  4BUM X;  1H6S 1;  3DWO X;  3PQS A;  3AA6 A;  3DZM A;  3GP6 A;  4UB8 O;  5DL6 A;  5E79 O;  3VZU X;  4AKR B;  1PRN A;  5D5D A;  1GFP A;  2R8A A;  1Q9G A;  5KAI O;  4D64 A;  2IWV A;  1ZHW A;  3A2S X;  3AA6 B;  3O0E A;  4FZN A;  4IL6 O;  2FGR A;  2YPV A;  1ZHY A;  4U9C A;  2Y2X A;  4LSI A;  3AAE A;  4G75 A;  4O3W A;  4RLB A;  1S5L O;  3DA3 A;  4C00 A;  2N2M A;  4K3B A;  1G90 A;  1QJP A;  2Y0H A;  3LK4 2;  4RL9 A;  3SYS A;  4JCH A;  5ADX L;  2KZ7 B;  4UB6 O;  3AAE B;  2ERV A;  2OMF A;  3A0H O;  3LK2 A;  2LFU A;  3LK3 A;  4LSH A;  4LSF A;  5DL5 A;  3JTY A;  4E1S A;  4C4V A;  5AFU K;  4O3Y A;  2ZLD A;  4D65 A;  4FZL A;  1MM5 A;  5EE2 A;  3LK2 B;  4FMS A;  1ORM A;  4RJW A;  4E1T A;  3EMN X;  4Z3T A;  4FOZ A;  4RLC A;  4FQE A;  4KR8 A;  2JQY A;  2K0L A;  3LK4 1;  3NSG A;  3RBH A;  4O4X A;  4LSE A;  2O4V A;  3SY9 A;  4PUX A;  3HWB A;  2YNK A;  3SYB A;  1HXU A;  2XTQ A;  3AA7 B;  3FYX A;  1HXT A;  2X27 X;  4QQ1 A;  2R4O A;  4KRA A;  2KDY A;  2KC0 A;  4N74 A;  1T16 A;  2WJR A;  4AYM C;  3HOE A;  4AYN A;  1IZN B;  1BT9 A;  2KZ7 A;  1GFM A;  1MM4 A;  4N75 A;  3WI5 A;  4GCQ A;  2XE1 A;  3VZW X;  2J4U P;  2W80 C;  4FRT A;  4GF4 A;  4O3Z A;  4FT6 A;  4GCP A;  3PGR A;  3T24 A;  5B66 O;  3AA0 A;  4FRX A;  3AAA A;  4KR4 A;  5IYU A;  3UPG A;  4AUI A;  1OSM A;  2F1C X;  5T5F A;  5AFU L;  8PRN A;  2F1T A;  3AA0 B;  3DA4 A;  3AAA B;  4XNL A;  3C5O A;  2JMM A;  5G26 A;  1BXW A;  4FZM A;  3NJT A;  3PF1 A;  4PR7 A;  2XE5 A;  5FVN A;  2M07 A;  3AA7 A;  3K19 A;  3TZG A;  4CTD A;  3KVD D;  5G38 A;  4N58 A;  4PJ0 O;  3VZT X;  2GE4 A;  3KZI O;  1Q9F A;  3PGS A;  2Y7S A;  1GFO A;  1IZN A;  2XE2 A;  2ODJ A;  3VY8 X;  3BS0 A;  1PHO A;  3DWN A;  3POQ A;  4FSO A;  1QJ9 A;  3V8U A;  4B61 A;  2KXP B;  5KAF O;  3POX A;  3VE1 A;  3A0B O;  1GFQ A;  3QRC A;  4AKM A;  2XMX A;  5DL8 A;  5ADX K;  5H2F O;  7PRN A;  2IWW A;  2FGQ X;  2AXT O;  2Y0K A;  2W81 C;  2Y0L A;  1BH3 A;  4XNK A;  1E54 A;  5G39 A;  3VY9 X;  2N2L A;  3HW9 A;  1QJ8 A;  2R89 A;  5GV0 A;  4GHB A;  3POU A;  4AYD C;  1ZHX A;  3T0S A;  1T1L A;  3SZD A;  1OPF A;  4O49 A;  2LHF A;  5G3A A;  3QRA A;  2QTK A;  2R4P A;  3PGU A;  3PRN A;  3UAQ A;  4FES A;  3UU2 A;  3POR A;  1MPF A;  2F1V A;  2M06 A;  5TIS O;  4O4U A;  4AYI D;  5B5E O;  2R88 A;  2WJQ A;  4K3C A;  3T20 A;  2WVP A;  4AKR A;  1GFN A;  1P4T A;  6PRN A;  5GTH O;  4FUV A;  5GTI O;  4RJX A;  2KXP A;  2K4T A;  3BRY A;  3BRZ A; 
#chains in the Genus database with same CATH homology
 1ZHZ A;  4G76 A;  4O3X B;  2MHL A;  2MNH A;  4JFB A;  5PRN A;  5JDP A;  3SY7 A;  3WI4 A;  4GCS A;  4AFK A;  2XTR A;  3AA1 A;  4C69 X;  1ZHT A;  3SZV A;  1HXX A;  3LK3 B;  3VE2 A;  4F4B A;  3AA1 B;  3PQU A;  4N59 A;  2J1N A;  2XG6 A;  2PRN A;  2ZFG A;  2POR A;  4AYE C;  4AZL A;  1THQ A;  2XE3 A;  3G7G A;  5DL7 A;  3HOL A;  1YS5 A;  4FSP A;  4BUM X;  1H6S 1;  3PQS A;  3AA6 A;  3GP6 A;  5DL6 A;  3VZU X;  1PRN A;  5D5D A;  1GFP A;  1Q9G A;  4D64 A;  1ZHW A;  3A2S X;  3AA6 B;  3O0E A;  4FZN A;  4U9C A;  2FGR A;  2YPV A;  1ZHY A;  3SZD A;  2Y2X A;  4LSI A;  3AAE A;  4G75 A;  4O3W A;  4RLB A;  3DA3 A;  1G90 A;  2N2M A;  1QJP A;  2Y0H A;  3LK4 2;  4RL9 A;  3SYS A;  4JCH A;  5ADX L;  2KZ7 B;  3AAE B;  2ERV A;  2OMF A;  3LK2 A;  3LK3 A;  2LFU A;  4LSH A;  4LSF A;  5DL5 A;  4E1S A;  3JTY A;  7PRN A;  4O3Y A;  2ZLD A;  4D65 A;  4FZL A;  1MM5 A;  5EE2 A;  3LK2 B;  4FMS A;  1ORM A;  4RJW A;  4E1T A;  3EMN X;  4Z3T A;  4FOZ A;  4RLC A;  4KR8 A;  3LK4 1;  2K0L A;  3NSG A;  3RBH A;  4O4X A;  4LSE A;  2O4V A;  3SY9 A;  4PUX A;  3HWB A;  2YNK A;  3SYB A;  1HXU A;  2XTQ A;  3AA7 B;  3FYX A;  1HXT A;  2X27 X;  4QQ1 A;  4KRA A;  2KDY A;  2KC0 A;  4AYM C;  3HOE A;  4AYN A;  1IZN B;  1BT9 A;  2KZ7 A;  1GFM A;  1MM4 A;  3WI5 A;  4GCQ A;  2XE1 A;  3VZW X;  2J4U P;  2W80 C;  4FRT A;  4GF4 A;  4O3Z A;  4FT6 A;  4GCP A;  3T24 A;  5IYU A;  3AA0 A;  4FRX A;  3AAA A;  4KR4 A;  3UPG A;  4AUI A;  1OSM A;  5T5F A;  5AFU L;  8PRN A;  2F1T A;  3AA0 B;  3DA4 A;  3AAA B;  4XNL A;  3C5O A;  2JMM A;  5G26 A;  1BXW A;  4FZM A;  5FVN A;  2XE5 A;  2M07 A;  3AA7 A;  3K19 A;  3TZG A;  3KVD D;  4N58 A;  3VZT X;  2GE4 A;  1Q9F A;  2Y7S A;  1GFO A;  1IZN A;  2XE2 A;  2ODJ A;  3VY8 X;  4AKR B;  1PHO A;  3POQ A;  4FSO A;  3V8U A;  1QJ9 A;  4D5U A;  5AFU K;  2KXP B;  3POX A;  3VE1 A;  3QRC A;  1GFQ A;  4AKM A;  2XMX A;  5DL8 A;  5ADX K;  2FGQ X;  2Y0K A;  2W81 C;  2Y0L A;  1BH3 A;  4XNK A;  1E54 A;  3VY9 X;  2N2L A;  3HW9 A;  1QJ8 A;  5GV0 A;  4GHB A;  3POU A;  4AYD C;  1ZHX A;  3T0S A;  1OPF A;  4O49 A;  2LHF A;  3QRA A;  2QTK A;  3PRN A;  3UAQ A;  4FES A;  3UU2 A;  3POR A;  1MPF A;  2F1V A;  2M06 A;  4AYI D;  4O4U A;  3T20 A;  4AKR A;  1GFN A;  1P4T A;  6PRN A;  4FUV A;  4RJX A;  2KXP A;  2K4T A;  4B61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...