3BRYA

Crystal structure of the ralstonia pickettii toluene transporter tbux
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
434
structure length
389
Chain Sequence
VFNLEGFGPVSRAMGGTGAAFDIGPAAMMENPATLGLMGEGRHFSLGLDVVSTDIKVTTASSGNHGNNNGPYFAPQTAFVYRQGRYAFGAGIFAEGGLGTQYGGSSFLSRTSNGVDTGLDQFSRLLVLRVPFSAAYHVTDKLTVGASVDAVWTSLNLGTLLDVSQIGTLAGQGRVSGTLVPTLLGVPGLSGGYIDFSGVQAWGIGGRLGLTYQVTPDTRIGAAYQAKTHVGDLTGQATLSAVGNIPLKGDVTVRNFQMPAQLTVGISHQFNDQLSVSADYQRVFWSSVMKDMNVGFVQSGSAANLDLSLPQNYRDISVFGIGAEYRYNAKWTFRGGFHYAQETTSLTGGVSYAIGKNDVIDFALSVALRKTSVTHSQVNAVIAYQKRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TbuX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Transport protein
total genus 77
structure length 389
sequence length 434
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bryA00
3PF1A 2R89A 2R4PA 1T16A 3BRYA 2R88A 3BRZA 3DWNA 3DWOX 3PGRA 3PGSA 1T1LA 2R4OA 3PGUA 2R4NA 2R4LA 3BS0A 2R8AA
chains in the Genus database with same CATH superfamily
3PORA 3SY9A 4AKRB 3LK2A 2F1TA 3NSGA 2X27X 3K19A 4C00A 2YNKA 1ZHYA 1Q9FA 2W81C 2XE1A 2Y7SA 3DA3A 3A0BO 5E79O 1G90A 4FSPA 1S5LO 3DWOX 3WI5A 3SZVA 5PRNA 4RJXA 3VY9X 4B61A 4D5UA 1P4TA 6PRNA 2KZ7A 1BXWA 2WVPA 4K3CA 2M07A 2XTQA 4N59A 4BUMX 2MNHA 3AA0B 4G75A 3UU2A 7PRNA 3WI4A 3GP6A 1IZNB 4AUIA 3BS0A 5KAFO 1HXXA 4O3YA 3AA7B 5IYUA 5G26A 3O0EA 4GCSA 2PORA 3SYSA 4KR8A 3BRZA 1YS5A 2F1CX 1PHOA 4K3BA 2X9KA 4O4UA 2Y2XA 3PQSA 4LSEA 4N58A 3POQA 3LK42 2FGRA 4FZLA 1GFMA 3TZGA 4AYID 3A2SX 1OSMA 2AXTO 2KDYA 2Y0HA 3QRCA 2ZFGA 4FZMA 3LK2B 4O3XB 3VY8X 5G39A 5DL8A 1OPFA 1HXUA 1QJ9A 2XMXA 3HOLA 3POXA 3VZUX 2N2LA 5DL6A 3G7GA 3UPGA 3LK3A 3KVDD 4FT6A 4AYEC 4RLCA 3C5OA 4AYNA 4GHBA 4C4VA 5T5FA 4IL6O 4UB8O 4Z3TA 5GTHO 2J4UP 4D64A 5ADXK 3JCUO 3PGUA 3DZMA 2KZ7B 3HW9A 3V8UA 3AAAA 4F4BA 8PRNA 3BRYA 2M06A 2JQYA 5AFUK 1GFQA 2MHLA 4GCPA 2KXPA 4RJWA 4PUXA 2R4LA 2R8AA 3EMNX 3HOEA 5D5DA 3SY7A 5ADXL 4LSIA 1ZHWA 2R88A 2XE2A 4N74A 4O3ZA 1QJ8A 2PRNA 3HWBA 2ERVA 2LFUA 4N75A 5DL5A 2IWVA 2R4OA 2WJRA 3FYXA 4RL9A 4AFKA 5AFUL 5GV0A 3AA1A 2XG6A 2R4PA 4GF4A 2J1NA 3AA6A 3NJTA 3PRNA 1PRNA 2IWWA 1GFPA 1ZHZA 4FSOA 5DL7A 5JDPA 5B5EO 2KC0A 4E1SA 3AAEA 2XTRA 2N2MA 2ZLDA 4PR7A 1H6S1 5GTIO 4FQEA 1BT9A 1THQA 5TISO 1MPFA 1GFNA 4PJ0O 4FESA 4AYDC 1Q9GA 2W80C 3LK41 3LK3B 4CTDA 2K0LA 2JMMA 2GE4A 3PGSA 4LSFA 4AKRA 2XE5A 4O49A 1T1LA 3PQUA 5KAIO 4C4VB 4D65A 1QJPA 2ODJA 4XNKA 3A0HO 2F1VA 2FGQX 1HXTA 2XE3A 3AAAB 3SYBA 2YPVA 4KRAA 3UAQA 1BH3A 1ORMA 2WJQA 4FRXA 4FRTA 4JFBA 3WU2O 3SZDA 3KZIO 3VE1A 4KR4A 4QQ1A 2KXPB 2K4TA 3VE2A 5H2FO 3VZTX 2R89A 3VZWX 2Y0KA 3DWNA 4XNLA 4C69X 4JCHA 4RLBA 1E54A 3AA0A 4AZLA 5G38A 4AKMA 1IZNA 2LHFA 2R4NA 5B66O 5G3AA 1MM5A 1ZHTA 2OMFA 3AA1B 5EE2A 3AA7A 4FUVA 3POUA 3AA6B 3T24A 1ZHXA 4FMSA 4O3WA 4AYMC 1MM4A 3T20A 3DA4A 4G76A 4O4XA 2Y0LA 2QTKA 5FVNA 3AAEB 3PF1A 1T16A 3PGRA 4U9CA 3JTYA 3QRAA 4FOZA 2O4VA 3T0SA 4UB6O 3RBHA 4FZNA 4LSHA 4E1TA 4GCQA 1GFOA
chains in the Genus database with same CATH topology
3PF1A 2R89A 2R4PA 1T16A 3BRYA 2R88A 3BRZA 3DWNA 3DWOX 3PGRA 3PGSA 1T1LA 2R4OA 3PGUA 2R4NA 2R4LA 3BS0A 2R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PF1 A;  2R89 A;  2R4P A;  1T16 A;  3BRY A;  2R88 A;  3BRZ A;  3DWN A;  3DWO X;  3PGR A;  3PGS A;  1T1L A;  2R4O A;  3PGU A;  2R4N A;  2R4L A;  3BS0 A;  2R8A A; 
#chains in the Genus database with same CATH topology
 3POR A;  3SY9 A;  4AKR B;  3LK2 A;  2F1T A;  3NSG A;  2X27 X;  3K19 A;  4C00 A;  2YNK A;  1ZHY A;  1Q9F A;  2W81 C;  2XE1 A;  2Y7S A;  3DA3 A;  3A0B O;  5E79 O;  1G90 A;  4FSP A;  1S5L O;  3DWO X;  3WI5 A;  3SZV A;  5PRN A;  4RJX A;  3VY9 X;  4B61 A;  4D5U A;  1P4T A;  6PRN A;  2KZ7 A;  1BXW A;  2WVP A;  4K3C A;  2M07 A;  2XTQ A;  4N59 A;  4BUM X;  2MNH A;  3AA0 B;  4G75 A;  3UU2 A;  7PRN A;  3WI4 A;  3GP6 A;  1IZN B;  4AUI A;  3BS0 A;  5KAF O;  1HXX A;  4O3Y A;  3AA7 B;  5IYU A;  5G26 A;  3O0E A;  4GCS A;  2POR A;  3SYS A;  4KR8 A;  3BRZ A;  1YS5 A;  2F1C X;  1PHO A;  4K3B A;  2X9K A;  4O4U A;  2Y2X A;  3PQS A;  4LSE A;  4N58 A;  3POQ A;  3LK4 2;  2FGR A;  4FZL A;  1GFM A;  3TZG A;  4AYI D;  3A2S X;  1OSM A;  2AXT O;  2KDY A;  2Y0H A;  3QRC A;  2ZFG A;  4FZM A;  3LK2 B;  4O3X B;  3VY8 X;  5G39 A;  5DL8 A;  1OPF A;  1HXU A;  1QJ9 A;  2XMX A;  3HOL A;  3POX A;  3VZU X;  2N2L A;  5DL6 A;  3G7G A;  3UPG A;  3LK3 A;  3KVD D;  4FT6 A;  4AYE C;  4RLC A;  3C5O A;  4AYN A;  4GHB A;  4C4V A;  5T5F A;  4IL6 O;  4UB8 O;  4Z3T A;  5GTH O;  2J4U P;  4D64 A;  5ADX K;  3JCU O;  3PGU A;  3DZM A;  2KZ7 B;  3HW9 A;  3V8U A;  3AAA A;  4F4B A;  8PRN A;  3BRY A;  2M06 A;  2JQY A;  5AFU K;  1GFQ A;  2MHL A;  4GCP A;  2KXP A;  4RJW A;  4PUX A;  2R4L A;  2R8A A;  3EMN X;  3HOE A;  5D5D A;  3SY7 A;  5ADX L;  4LSI A;  1ZHW A;  2R88 A;  2XE2 A;  4N74 A;  4O3Z A;  1QJ8 A;  2PRN A;  3HWB A;  2ERV A;  2LFU A;  4N75 A;  5DL5 A;  2IWV A;  2R4O A;  2WJR A;  3FYX A;  4RL9 A;  4AFK A;  5AFU L;  5GV0 A;  3AA1 A;  2XG6 A;  2R4P A;  4GF4 A;  2J1N A;  3AA6 A;  3NJT A;  3PRN A;  1PRN A;  2IWW A;  1GFP A;  1ZHZ A;  4FSO A;  5DL7 A;  5JDP A;  5B5E O;  2KC0 A;  4E1S A;  3AAE A;  2XTR A;  2N2M A;  2ZLD A;  4PR7 A;  1H6S 1;  5GTI O;  4FQE A;  1BT9 A;  1THQ A;  5TIS O;  1MPF A;  1GFN A;  4PJ0 O;  4FES A;  4AYD C;  1Q9G A;  2W80 C;  3LK4 1;  3LK3 B;  4CTD A;  2K0L A;  2JMM A;  2GE4 A;  3PGS A;  4LSF A;  4AKR A;  2XE5 A;  4O49 A;  1T1L A;  3PQU A;  5KAI O;  4C4V B;  4D65 A;  1QJP A;  2ODJ A;  4XNK A;  3A0H O;  2F1V A;  2FGQ X;  1HXT A;  2XE3 A;  3AAA B;  3SYB A;  2YPV A;  4KRA A;  3UAQ A;  1BH3 A;  1ORM A;  2WJQ A;  4FRX A;  4FRT A;  4JFB A;  3WU2 O;  3SZD A;  3KZI O;  3VE1 A;  4KR4 A;  4QQ1 A;  2KXP B;  2K4T A;  3VE2 A;  5H2F O;  3VZT X;  2R89 A;  3VZW X;  2Y0K A;  3DWN A;  4XNL A;  4C69 X;  4JCH A;  4RLB A;  1E54 A;  3AA0 A;  4AZL A;  5G38 A;  4AKM A;  1IZN A;  2LHF A;  2R4N A;  5B66 O;  5G3A A;  1MM5 A;  1ZHT A;  2OMF A;  3AA1 B;  5EE2 A;  3AA7 A;  4FUV A;  3POU A;  3AA6 B;  3T24 A;  1ZHX A;  4FMS A;  4O3W A;  4AYM C;  1MM4 A;  3T20 A;  3DA4 A;  4G76 A;  4O4X A;  2Y0L A;  2QTK A;  5FVN A;  3AAE B;  3PF1 A;  1T16 A;  3PGR A;  4U9C A;  3JTY A;  3QRA A;  4FOZ A;  2O4V A;  3T0S A;  4UB6 O;  3RBH A;  4FZN A;  4LSH A;  4E1T A;  4GCQ A;  1GFO A; 
#chains in the Genus database with same CATH homology
 3PF1 A;  2R89 A;  2R4P A;  1T16 A;  3BRY A;  2R88 A;  3BRZ A;  3DWN A;  3DWO X;  3PGR A;  3PGS A;  1T1L A;  2R4O A;  3PGU A;  2R4N A;  2R4L A;  3BS0 A;  2R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...