3BRYA

Crystal structure of the ralstonia pickettii toluene transporter tbux
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
434
structure length
389
Chain Sequence
VFNLEGFGPVSRAMGGTGAAFDIGPAAMMENPATLGLMGEGRHFSLGLDVVSTDIKVTTASSGNHGNNNGPYFAPQTAFVYRQGRYAFGAGIFAEGGLGTQYGGSSFLSRTSNGVDTGLDQFSRLLVLRVPFSAAYHVTDKLTVGASVDAVWTSLNLGTLLDVSQIGTLAGQGRVSGTLVPTLLGVPGLSGGYIDFSGVQAWGIGGRLGLTYQVTPDTRIGAAYQAKTHVGDLTGQATLSAVGNIPLKGDVTVRNFQMPAQLTVGISHQFNDQLSVSADYQRVFWSSVMKDMNVGFVQSGSAANLDLSLPQNYRDISVFGIGAEYRYNAKWTFRGGFHYAQETTSLTGGVSYAIGKNDVIDFALSVALRKTSVTHSQVNAVIAYQKRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TbuX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Ralstonia pickettii
total genus 77
structure length 389
sequence length 434
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bryA00
3BRZA 2R4NA 2R88A 3PF1A 3PGUA 2R4PA 1T1LA 1T16A 2R4OA 2R89A 2R4LA 2R8AA 3DWNA 3BRYA 3DWOX 3PGRA 3PGSA 3BS0A
chains in the Genus database with same CATH superfamily
2X9KA 1E54A 1QJ9A 2LFUA 3NJTA 2KC0A 3KZIO 5DL7A 4GHBA 2GE4A 3UAQA 4AKRA 4B61A 3G7GA 5B66O 3BRYA 5G39A 1Q9FA 2ODJA 2KZ7A 3O0EA 3AAAA 2YPVA 2JQYA 4FRXA 4KR8A 5DL5A 2YNKA 4FSOA 2FGQX 2O4VA 4RLBA 2WJQA 1IZNB 3DWOX 4IL6O 1QJPA 4XNLA 2JMMA 3AA1B 3BS0A 4GCQA 4AUIA 3UPGA 4AKRB 2N2LA 4N74A 4QQ1A 2ERVA 2R4OA 5KAIO 3A0HO 4O3YA 3WI5A 2KZ7B 3VZUX 3WU2O 3HWBA 2PRNA 3AAAB 4O49A 2KXPA 2R88A 4AYNA 3NSGA 4LSIA 4FQEA 1G90A 3POXA 3DA3A 4C69X 2F1TA 3QRCA 2XTQA 3AA7A 4N58A 4AYID 5EE2A 1OSMA 3SYBA 4O3WA 1QJ8A 3DA4A 2XMXA 3LK42 2PORA 1OPFA 3PRNA 5ADXL 1GFQA 5DL6A 3V8UA 3FYXA 1BXWA 2KXPB 3SY7A 2Y0KA 4FZNA 3VZTX 4E1TA 3PGUA 3LK3A 4AYMC 5G3AA 5DL8A 4D64A 2XE1A 3PGRA 2OMFA 2J1NA 2K0LA 4FZMA 2M06A 1ZHWA 3AA7B 2F1CX 3C5OA 3UU2A 4PUXA 3VY9X 5FVNA 2F1VA 4UB8O 4FESA 4C4VB 5IYUA 3HOEA 3KVDD 2QTKA 1ORMA 3PQUA 1BT9A 4N75A 4O3ZA 3T24A 3LK3B 2ZLDA 4AZLA 2FGRA 4N59A 1PRNA 1MPFA 3POQA 3AA6A 2M07A 5D5DA 1ZHZA 2W81C 3PGSA 1GFMA 2IWVA 2XE2A 4K3BA 4KR4A 4LSHA 4FRTA 7PRNA 1H6S1 5GTIO 1HXXA 5KAFO 3POUA 3RBHA 3K19A 4LSFA 5T5FA 4C4VA 3PORA 8PRNA 4G75A 4PJ0O 4RLCA 4Z3TA 4XNKA 1T1LA 4U9CA 2MNHA 2R8AA 3JTYA 4LSEA 3AA0A 1ZHTA 1THQA 3AA6B 4JFBA 4D5UA 4FT6A 3T20A 3LK41 3PF1A 2R4NA 5E79O 1MM4A 2XE3A 2Y0HA 4KRAA 1ZHYA 4K3CA 4PR7A 4RJXA 5H2FO 2J4UP 1Q9GA 4C00A 2KDYA 5G26A 3SY9A 3LK2A 1PHOA 3VZWX 3A0BO 4GCSA 4RJWA 2R4PA 1YS5A 2R89A 3AAEA 5TISO 4AYEC 3AA0B 3EMNX 4GF4A 4FUVA 1S5LO 5ADXK 2IWWA 4RL9A 5AFUL 2K4TA 4O4XA 2XE5A 3GP6A 5JDPA 1MM5A 3PQSA 1T16A 3A2SX 4O4UA 1P4TA 5G38A 3SZDA 1GFPA 2WJRA 3DZMA 3LK2B 4FOZA 4AKMA 2N2MA 3SYSA 1ZHXA 4UB6O 4E1SA 2LHFA 2ZFGA 3BRZA 4FMSA 3T0SA 3VE1A 1HXUA 3HOLA 3HW9A 4AYDC 5B5EO 2XTRA 3AAEB 4GCPA 3QRAA 4O3XB 3VY8X 4BUMX 3SZVA 3TZGA 2X27X 1BH3A 4G76A 4CTDA 4F4BA 6PRNA 1GFOA 2R4LA 4FZLA 5GV0A 2Y2XA 2WVPA 1GFNA 5GTHO 3JCUO 5AFUK 4AFKA 4FSPA 3WI4A 2XG6A 4JCHA 5PRNA 3DWNA 2MHLA 1IZNA 2AXTO 2Y0LA 2W80C 4D65A 3VE2A 1HXTA 2Y7SA 3AA1A
chains in the Genus database with same CATH topology
3BRZA 2R4NA 2R88A 3PF1A 3PGUA 2R4PA 1T1LA 1T16A 2R4OA 2R89A 2R4LA 2R8AA 3DWNA 3BRYA 3DWOX 3PGRA 3PGSA 3BS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRZ A;  2R4N A;  2R88 A;  3PF1 A;  3PGU A;  2R4P A;  1T1L A;  1T16 A;  2R4O A;  2R89 A;  2R4L A;  2R8A A;  3DWN A;  3BRY A;  3DWO X;  3PGR A;  3PGS A;  3BS0 A; 
#chains in the Genus database with same CATH topology
 2X9K A;  1E54 A;  1QJ9 A;  2LFU A;  3NJT A;  2KC0 A;  3KZI O;  5DL7 A;  4GHB A;  2GE4 A;  3UAQ A;  4AKR A;  4B61 A;  3G7G A;  5B66 O;  3BRY A;  5G39 A;  1Q9F A;  2ODJ A;  2KZ7 A;  3O0E A;  3AAA A;  2YPV A;  2JQY A;  4FRX A;  4KR8 A;  5DL5 A;  2YNK A;  4FSO A;  2FGQ X;  2O4V A;  4RLB A;  2WJQ A;  1IZN B;  3DWO X;  4IL6 O;  1QJP A;  4XNL A;  2JMM A;  3AA1 B;  3BS0 A;  4GCQ A;  4AUI A;  3UPG A;  4AKR B;  2N2L A;  4N74 A;  4QQ1 A;  2ERV A;  2R4O A;  5KAI O;  3A0H O;  4O3Y A;  3WI5 A;  2KZ7 B;  3VZU X;  3WU2 O;  3HWB A;  2PRN A;  3AAA B;  4O49 A;  2KXP A;  2R88 A;  4AYN A;  3NSG A;  4LSI A;  4FQE A;  1G90 A;  3POX A;  3DA3 A;  4C69 X;  2F1T A;  3QRC A;  2XTQ A;  3AA7 A;  4N58 A;  4AYI D;  5EE2 A;  1OSM A;  3SYB A;  4O3W A;  1QJ8 A;  3DA4 A;  2XMX A;  3LK4 2;  2POR A;  1OPF A;  3PRN A;  5ADX L;  1GFQ A;  5DL6 A;  3V8U A;  3FYX A;  1BXW A;  2KXP B;  3SY7 A;  2Y0K A;  4FZN A;  3VZT X;  4E1T A;  3PGU A;  3LK3 A;  4AYM C;  5G3A A;  5DL8 A;  4D64 A;  2XE1 A;  3PGR A;  2OMF A;  2J1N A;  2K0L A;  4FZM A;  2M06 A;  1ZHW A;  3AA7 B;  2F1C X;  3C5O A;  3UU2 A;  4PUX A;  3VY9 X;  5FVN A;  2F1V A;  4UB8 O;  4FES A;  4C4V B;  5IYU A;  3HOE A;  3KVD D;  2QTK A;  1ORM A;  3PQU A;  1BT9 A;  4N75 A;  4O3Z A;  3T24 A;  3LK3 B;  2ZLD A;  4AZL A;  2FGR A;  4N59 A;  1PRN A;  1MPF A;  3POQ A;  3AA6 A;  2M07 A;  5D5D A;  1ZHZ A;  2W81 C;  3PGS A;  1GFM A;  2IWV A;  2XE2 A;  4K3B A;  4KR4 A;  4LSH A;  4FRT A;  7PRN A;  1H6S 1;  5GTI O;  1HXX A;  5KAF O;  3POU A;  3RBH A;  3K19 A;  4LSF A;  5T5F A;  4C4V A;  3POR A;  8PRN A;  4G75 A;  4PJ0 O;  4RLC A;  4Z3T A;  4XNK A;  1T1L A;  4U9C A;  2MNH A;  2R8A A;  3JTY A;  4LSE A;  3AA0 A;  1ZHT A;  1THQ A;  3AA6 B;  4JFB A;  4D5U A;  4FT6 A;  3T20 A;  3LK4 1;  3PF1 A;  2R4N A;  5E79 O;  1MM4 A;  2XE3 A;  2Y0H A;  4KRA A;  1ZHY A;  4K3C A;  4PR7 A;  4RJX A;  5H2F O;  2J4U P;  1Q9G A;  4C00 A;  2KDY A;  5G26 A;  3SY9 A;  3LK2 A;  1PHO A;  3VZW X;  3A0B O;  4GCS A;  4RJW A;  2R4P A;  1YS5 A;  2R89 A;  3AAE A;  5TIS O;  4AYE C;  3AA0 B;  3EMN X;  4GF4 A;  4FUV A;  1S5L O;  5ADX K;  2IWW A;  4RL9 A;  5AFU L;  2K4T A;  4O4X A;  2XE5 A;  3GP6 A;  5JDP A;  1MM5 A;  3PQS A;  1T16 A;  3A2S X;  4O4U A;  1P4T A;  5G38 A;  3SZD A;  1GFP A;  2WJR A;  3DZM A;  3LK2 B;  4FOZ A;  4AKM A;  2N2M A;  3SYS A;  1ZHX A;  4UB6 O;  4E1S A;  2LHF A;  2ZFG A;  3BRZ A;  4FMS A;  3T0S A;  3VE1 A;  1HXU A;  3HOL A;  3HW9 A;  4AYD C;  5B5E O;  2XTR A;  3AAE B;  4GCP A;  3QRA A;  4O3X B;  3VY8 X;  4BUM X;  3SZV A;  3TZG A;  2X27 X;  1BH3 A;  4G76 A;  4CTD A;  4F4B A;  6PRN A;  1GFO A;  2R4L A;  4FZL A;  5GV0 A;  2Y2X A;  2WVP A;  1GFN A;  5GTH O;  3JCU O;  5AFU K;  4AFK A;  4FSP A;  3WI4 A;  2XG6 A;  4JCH A;  5PRN A;  3DWN A;  2MHL A;  1IZN A;  2AXT O;  2Y0L A;  2W80 C;  4D65 A;  3VE2 A;  1HXT A;  2Y7S A;  3AA1 A; 
#chains in the Genus database with same CATH homology
 3BRZ A;  2R4N A;  2R88 A;  3PF1 A;  3PGU A;  2R4P A;  1T1L A;  1T16 A;  2R4O A;  2R89 A;  2R4L A;  2R8A A;  3DWN A;  3BRY A;  3DWO X;  3PGR A;  3PGS A;  3BS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...