3BRYA

Crystal structure of the ralstonia pickettii toluene transporter tbux
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
434
structure length
389
Chain Sequence
b'VFNLEGFGPVSRAMGGTGAAFDIGPAAMMENPATLGLMGEGRHFSLGLDVVSTDIKVTTASSGNHGNNNGPYFAPQTAFVYRQGRYAFGAGIFAEGGLGTQYGGSSFLSRTSNGVDTGLDQFSRLLVLRVPFSAAYHVTDKLTVGASVDAVWTSLNLGTLLDVSQIGTLAGQGRVSGTLVPTLLGVPGLSGGYIDFSGVQAWGIGGRLGLTYQVTPDTRIGAAYQAKTHVGDLTGQATLSAVGNIPLKGDVTVRNFQMPAQLTVGISHQFNDQLSVSADYQRVFWSSVMKDMNVGFVQSGSAANLDLSLPQNYRDISVFGIGAEYRYNAKWTFRGGFHYAQETTSLTGGVSYAIGKNDVIDFALSVALRKTSVTHSQVNAVIAYQKRFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TbuX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Transport protein
total genus 77
structure length 389
sequence length 434
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bryA00
1T1LA 3PGUA 2R4OA 3BRYA 3PF1A 3BRZA 3DWNA 2R4NA 3DWOX 2R89A 3PGSA 1T16A 2R4PA 3BS0A 2R4LA 2R88A 3PGRA 2R8AA
chains in the Genus database with same CATH superfamily
1ZHYA 4FZLA 1ZHZA 1BH3A 4XNKA 3HWBA 2Y2XA 1S5LO 4G75A 4AYEC 1IZNB 5DL6A 3AA0B 4FRXA 1PHOA 2F1TA 2WJQA 2XE3A 3NJTA 2MHLA 4O3WA 1HXTA 1Q9FA 4UB6O 4N74A 3VE2A 3T20A 2N2MA 3PGSA 5JDPA 1Q9GA 3AAAB 3LK42 2K0LA 4O49A 5T5FA 3QRAA 4AYMC 5TISO 3PORA 4JFBA 3LK2B 3TZGA 2M06A 3AA1B 2JQYA 2YNKA 2XTRA 3NSGA 1ZHXA 2XTQA 4XNLA 1QJ8A 4D64A 2PORA 5IYUA 1MM5A 4KR8A 4F4BA 4Z3TA 3UAQA 2KXPB 2Y7SA 5DL5A 3AA6B 2X27X 4FESA 3WI5A 3PGUA 2WJRA 2Y0KA 4LSHA 4RJXA 4RJWA 4FT6A 3HOLA 4G76A 3VZWX 3JCUO 2J4UP 4PJ0O 4C69X 3FYXA 1HXXA 3PQSA 5GV0A 4GF4A 2R4NA 5KAFO 4IL6O 2R4PA 4LSEA 3DA4A 5G39A 5DL8A 4LSIA 4AYNA 4U9CA 3JTYA 3VY9X 5KAIO 4GCPA 4FMSA 3EMNX 3PF1A 2XG6A 4FOZA 4E1TA 1OSMA 4FZMA 4O3YA 3AA7B 5H2FO 4B61A 1GFPA 1IZNA 3AA0A 5D5DA 4AKMA 2FGQX 2K4TA 3PRNA 4FUVA 1T1LA 1MM4A 2AXTO 2OMFA 4KR4A 5EE2A 3K19A 3HOEA 4JCHA 1OPFA 4QQ1A 5G38A 2R89A 5GTIO 4D65A 2KZ7B 3AAAA 4D5UA 3O0EA 2FGRA 3A0BO 2ZLDA 2XE2A 4FRTA 2F1CX 5PRNA 1HXUA 3LK2A 1BT9A 3AA1A 3AAEB 4CTDA 1T16A 2LHFA 4C00A 4N59A 2R4LA 2YPVA 3SZDA 2R8AA 3C5OA 2KXPA 3SZVA 4AKRB 1YS5A 3AA6A 1GFQA 4BUMX 6PRNA 2XE5A 3DWNA 3DWOX 3T24A 4GCQA 2ODJA 3DZMA 2X9KA 3BS0A 2IWVA 4N58A 4PR7A 3VY8X 2GE4A 3WI4A 4C4VB 3UPGA 2M07A 2XMXA 1QJPA 4FSOA 2R4OA 3POUA 3A0HO 4FQEA 4UB8O 4AZLA 3LK41 3VZTX 5AFUL 3LK3B 2N2LA 4N75A 1THQA 3KZIO 4K3BA 4RLBA 3SY7A 4C4VA 5G3AA 1ORMA 4GCSA 4O3XB 4GHBA 4K3CA 4RLCA 4PUXA 3RBHA 5ADXK 3SYSA 4AYID 3WU2O 2J1NA 5ADXL 3AA7A 4O3ZA 3POQA 2Y0HA 4AUIA 3V8UA 1G90A 5E79O 3BRZA 3PQUA 4E1SA 2LFUA 3QRCA 4KRAA 3VE1A 2MNHA 2IWWA 1ZHTA 2KZ7A 2XE1A 2Y0LA 4RL9A 1BXWA 5B66O 1PRNA 4FSPA 5B5EO 3AAEA 3VZUX 1MPFA 2KC0A 1E54A 3DA3A 2WVPA 3PGRA 4FZNA 4O4UA 3BRYA 5DL7A 4AKRA 5FVNA 3SYBA 7PRNA 2W81C 1QJ9A 3HW9A 4AYDC 2R88A 8PRNA 2KDYA 1H6S1 5AFUK 3UU2A 1GFMA 1ZHWA 4O4XA 1P4TA 2ZFGA 2PRNA 4LSFA 4AFKA 5G26A 2JMMA 3KVDD 5GTHO 1GFNA 2W80C 3A2SX 3LK3A 2ERVA 2O4VA 3SY9A 2F1VA 3POXA 2QTKA 3G7GA 3T0SA 3GP6A 1GFOA
chains in the Genus database with same CATH topology
1T1LA 3PGUA 2R4OA 3BRYA 3PF1A 3BRZA 3DWNA 2R4NA 3DWOX 2R89A 3PGSA 1T16A 2R4PA 3BS0A 2R4LA 2R88A 3PGRA 2R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  3PGU A;  2R4O A;  3BRY A;  3PF1 A;  3BRZ A;  3DWN A;  2R4N A;  3DWO X;  2R89 A;  3PGS A;  1T16 A;  2R4P A;  3BS0 A;  2R4L A;  2R88 A;  3PGR A;  2R8A A; 
#chains in the Genus database with same CATH topology
 1ZHY A;  4FZL A;  1ZHZ A;  1BH3 A;  4XNK A;  3HWB A;  2Y2X A;  1S5L O;  4G75 A;  4AYE C;  1IZN B;  5DL6 A;  3AA0 B;  4FRX A;  1PHO A;  2F1T A;  2WJQ A;  2XE3 A;  3NJT A;  2MHL A;  4O3W A;  1HXT A;  1Q9F A;  4UB6 O;  4N74 A;  3VE2 A;  3T20 A;  2N2M A;  3PGS A;  5JDP A;  1Q9G A;  3AAA B;  3LK4 2;  2K0L A;  4O49 A;  5T5F A;  3QRA A;  4AYM C;  5TIS O;  3POR A;  4JFB A;  3LK2 B;  3TZG A;  2M06 A;  3AA1 B;  2JQY A;  2YNK A;  2XTR A;  3NSG A;  1ZHX A;  2XTQ A;  4XNL A;  1QJ8 A;  4D64 A;  2POR A;  5IYU A;  1MM5 A;  4KR8 A;  4F4B A;  4Z3T A;  3UAQ A;  2KXP B;  2Y7S A;  5DL5 A;  3AA6 B;  2X27 X;  4FES A;  3WI5 A;  3PGU A;  2WJR A;  2Y0K A;  4LSH A;  4RJX A;  4RJW A;  4FT6 A;  3HOL A;  4G76 A;  3VZW X;  3JCU O;  2J4U P;  4PJ0 O;  4C69 X;  3FYX A;  1HXX A;  3PQS A;  5GV0 A;  4GF4 A;  2R4N A;  5KAF O;  4IL6 O;  2R4P A;  4LSE A;  3DA4 A;  5G39 A;  5DL8 A;  4LSI A;  4AYN A;  4U9C A;  3JTY A;  3VY9 X;  5KAI O;  4GCP A;  4FMS A;  3EMN X;  3PF1 A;  2XG6 A;  4FOZ A;  4E1T A;  1OSM A;  4FZM A;  4O3Y A;  3AA7 B;  5H2F O;  4B61 A;  1GFP A;  1IZN A;  3AA0 A;  5D5D A;  4AKM A;  2FGQ X;  2K4T A;  3PRN A;  4FUV A;  1T1L A;  1MM4 A;  2AXT O;  2OMF A;  4KR4 A;  5EE2 A;  3K19 A;  3HOE A;  4JCH A;  1OPF A;  4QQ1 A;  5G38 A;  2R89 A;  5GTI O;  4D65 A;  2KZ7 B;  3AAA A;  4D5U A;  3O0E A;  2FGR A;  3A0B O;  2ZLD A;  2XE2 A;  4FRT A;  2F1C X;  5PRN A;  1HXU A;  3LK2 A;  1BT9 A;  3AA1 A;  3AAE B;  4CTD A;  1T16 A;  2LHF A;  4C00 A;  4N59 A;  2R4L A;  2YPV A;  3SZD A;  2R8A A;  3C5O A;  2KXP A;  3SZV A;  4AKR B;  1YS5 A;  3AA6 A;  1GFQ A;  4BUM X;  6PRN A;  2XE5 A;  3DWN A;  3DWO X;  3T24 A;  4GCQ A;  2ODJ A;  3DZM A;  2X9K A;  3BS0 A;  2IWV A;  4N58 A;  4PR7 A;  3VY8 X;  2GE4 A;  3WI4 A;  4C4V B;  3UPG A;  2M07 A;  2XMX A;  1QJP A;  4FSO A;  2R4O A;  3POU A;  3A0H O;  4FQE A;  4UB8 O;  4AZL A;  3LK4 1;  3VZT X;  5AFU L;  3LK3 B;  2N2L A;  4N75 A;  1THQ A;  3KZI O;  4K3B A;  4RLB A;  3SY7 A;  4C4V A;  5G3A A;  1ORM A;  4GCS A;  4O3X B;  4GHB A;  4K3C A;  4RLC A;  4PUX A;  3RBH A;  5ADX K;  3SYS A;  4AYI D;  3WU2 O;  2J1N A;  5ADX L;  3AA7 A;  4O3Z A;  3POQ A;  2Y0H A;  4AUI A;  3V8U A;  1G90 A;  5E79 O;  3BRZ A;  3PQU A;  4E1S A;  2LFU A;  3QRC A;  4KRA A;  3VE1 A;  2MNH A;  2IWW A;  1ZHT A;  2KZ7 A;  2XE1 A;  2Y0L A;  4RL9 A;  1BXW A;  5B66 O;  1PRN A;  4FSP A;  5B5E O;  3AAE A;  3VZU X;  1MPF A;  2KC0 A;  1E54 A;  3DA3 A;  2WVP A;  3PGR A;  4FZN A;  4O4U A;  3BRY A;  5DL7 A;  4AKR A;  5FVN A;  3SYB A;  7PRN A;  2W81 C;  1QJ9 A;  3HW9 A;  4AYD C;  2R88 A;  8PRN A;  2KDY A;  1H6S 1;  5AFU K;  3UU2 A;  1GFM A;  1ZHW A;  4O4X A;  1P4T A;  2ZFG A;  2PRN A;  4LSF A;  4AFK A;  5G26 A;  2JMM A;  3KVD D;  5GTH O;  1GFN A;  2W80 C;  3A2S X;  3LK3 A;  2ERV A;  2O4V A;  3SY9 A;  2F1V A;  3POX A;  2QTK A;  3G7G A;  3T0S A;  3GP6 A;  1GFO A; 
#chains in the Genus database with same CATH homology
 1T1L A;  3PGU A;  2R4O A;  3BRY A;  3PF1 A;  3BRZ A;  3DWN A;  2R4N A;  3DWO X;  2R89 A;  3PGS A;  1T16 A;  2R4P A;  3BS0 A;  2R4L A;  2R88 A;  3PGR A;  2R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...