4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
b'GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
2X8XX 4QAYA 3NJTA 4N75A 3OG5A 3Q6BA 4C4VB 3EFCA 4C4VA 2V9HA 3MC8A 4K3CA 4N74A 2VH1A 4XGAB 4C00A 4PK1A 2VH2A 2MHJA 4BZAA 3MC9A 4K3BA 2QCZA 2QDFA
chains in the Genus database with same CATH superfamily
2JVCA 2D5GA 2XK5A 4LK0M 2I38A 4G50A 3DVNU 2Q5WD 5HKHA 1QKZA 1ET9A 2VH1A 1LO5D 4MGYE 4IWQA 2WXOA 2OJRA 3C0RB 2VRRB 4UB6O 2Y5CA 1ZE3D 2ZLDA 2KANA 2NMQA 3E9SA 3IG3A 3Q3NC 1WXVA 5LLIA 2N9XA 1BUIC 1FIQA 3AE2B 4YT0B 2RMMA 2L0TA 1UGMA 2CS4A 2ON8A 2ZPYA 3AE8B 3K19A 1VCBA 1HTQA 3OWEB 4AYID 2N7EA 4RM8A 4XYCA 2H88B 3PLVA 1MPEA 1ZP0B 1GB1A 1TKYA 4MJSA 4JE3B 2SEBD 4BKTA 1RRBA 2NPTB 4ZHOA 3LJ3A 1V86A 1KLVA 1IYFA 4GDLB 4IUMB 1WGGA 2ERVA 3LK2A 1NVID 1VRAB 4ZRPA 3A9JA 2KT7A 1EM7A 2J53A 4K7UA 3TJPA 5DL8A 1FRRA 2NCNA 3ZJVA 2W3RA 5EE1A 4JIOU 1F1HA 3N32A 1WX7A 4ZYSA 4ARIA 1WFYA 4PYUA 1WM2A 1RM6C 4YSXB 4R3DA 5GTHO 2WNMA 1WSPA 1UWMA 4B95A 2BGFA 2O2VB 2DAFA 1SSNA 4FHKA 1P7EA 4TMAB 2PTLA 1JMLA 1U4AA 1UBIA 2KDMA 1SE4A 3AAEB 3L4PA 2K6DB 2KTRA 2N1VA 2JYTA 1S5LO 2HTHA 4AJYB 2J0KA 3IAS1 2IWWA 3U7DA 2X27X 4HVBA 3RFZB 2YNKA 4IW0A 2KFKB 3AE7B 2O4VA 4BUMX 1MVKA 3AULA 3T3NA 3QCAA 3AMZA 2M0XA 2KOXA 2W54A 3O0EA 2KDFB 2PLPA 4NQLB 4CO7A 4KKJA 1FRDA 5G3AA 4NJCA 5AFUL 1XLQA 1IZNA 4MSQB 4FADA 2FNJB 2JRIB 4GN1A 2PPHA 2WXNA 3L16A 1FEHA 2UYZB 3LYYA 4M8MA 3T0SA 2ZPNA 2WXFA 4BBNC 2FGQX 1E8XA 2BS4B 3A1QA 5DL5A 4K3BA 4I6PA 1EU3A 4YSZB 1F2RC 3ETRA 1I4HA 4D2KA 2JF5A 1BXTA 4KGTA 2ZNVC 2BTEA 1OFFA 3I63C 3LK41 1Q5WB 1YQ4B 2K8HA 2LHDA 4DWFA 2WDVB 3AM9A 3JSVA 2G1EA 1FNWA 1UUPA 4W9FA 4ZHPA 3RT3B 3VY8X 2KNBA 3RBHA 4FN2A 2L83A 3R7RA 3VZUX 3AE3B 2IY0B 3VH4B 1ISNA 4HROA 3H9DA 1KTKA 3OJ4B 3R2TA 1DGJA 1GFPA 2JPHA 4RNAA 4HLEA 1GJZA 1B1ZA 2HDEA 2BYTA 1V81A 2QMTA 1ZPSA 3PORA 2MBQA 2LD9A 1QOFA 1N62A 3A0BO 3Q3FA 4W9EA 5LXHA 2MRPA 4NAWA 2M19A 2K3UA 1JWUD 2G4DB 2KC2A 5C2TB 2EELA 2R4LA 4IWPA 4LTUA 3QC8B 4GIVA 1JW9D 2YEPB 3B2FA 2PORA 3I57A 3N1ZC 3W2DA 4EKUA 2YLMA 1T1LA 1WMHB 2HJ1A 2MLBA 4RJXA 3SFEB 2KO3A 2A4ZA 3P4PB 1YQ3B 4UB8O 3KLSX 4W9GA 4AWJA 1AYFA 2KVZA 4DBGA 1YN4A 1WGKA 4P16A 4AYDC 4RH6A 4G0NB 3ZJUA 2IPKD 4KR8A 5HHDG 2IWVA 5AFUK 3U8ZA 4DHZB 4BKSA 1UWXA 2KDIA 3T24A 1IGDA 1QOAA 4BVUC 5HG2A 1C4PA 2W81C 1SJHD 2MJ3A 1TZ1A 1FFVA 2A5UA 2INNE 2BS3B 4YTNB 4YTMB 3DHIC 1C1YB 4EZJA 4FOZA 3AA1B 1KFYB 4A8XC 3L08A 4IKGA 4O3YA 1V1PB 3NUHB 3UIPB 4J3OD 4AZLA 4JCHA 4B0EA 3BYYB 3V6CB 2DENB 2KVRA 4JLCA 5FVNA 4KGRA 1WE6A 3NJTA 4MACA 3NOBA 1B9RA 3PQUA 3DBLB 3UINB 3BY4B 2DAJA 4C4VB 3RPFC 2BWES 1ZGUB 2JWUA 1P98A 3LK3B 3BK2A 2F1TA 4M8NA 1FXTB 4BOSC 4KVGB 3ZIMA 5D2MB 3M62B 1JCKB 4NZLB 3BRYA 1BT0A 2ZJDA 2R2QA 2LJ5A 3IT6B 2GBNA 3SZVA 5H92C 2JWZA 3ML9A 2KJHB 1JROA 3AE1B 2WDQB 4O4UA 2HE7A 1P3QU 2M07A 3R8BA 3AA6B 4RLCA 3UF8A 2LGXA 1TZOA 3PRZA 2KJRA 3A4SC 2NBWB 3UI3A 4XNLA 3C19A 3N30A 2KKCA 1PUTA 1I42A 1PQSA 1WF9A 4WAAA 1SIFA 2BYFA 1J7AA 2L32A 3QIJA 2R89A 2WXKA 3R7QA 2KHWB 3RYTA 4E71A 4GF4A 2LFUA 2I2YA 5LNK1 1YJ1A 2W55A 3QJZA 2K5PA 3AE5B 4ZRQA 3RZFA 1C4AA 1FCCC 1KF6B 2JUOA 2QCZA 4W9LA 3BVGA 1J0GA 2MEKA 1M4VA 1P1AA 2EKIA 1WYGA 4OHJA 1KLUD 2NVUI 3T8MA 3H7PA 4K7SA 1YX5B 4L23A 2ZEQA 2L0FA 2MP2A 2WYQA 3RD2A 1ZHYA 2KTFA 3QA8A 2WU5B 2H89B 1TY0A 1ZDVA 3FC4A 2JYEA 1WGHA 3H8HA 3WAPA 2QEJC 2LGDA 2WXRA 1S1QB 4K7WA 2CU1A 2GBKA 3IXSA 1T0SC 3HIZA 1JQ4A 3L0WB 4RGNA 3Q8FA 1QT9A 1XXGA 3DWMA 5EDSA 1I7HA 3KWLA 5IP4D 2HD5B 4RF1A 1V1OA 3AA0B 1EWCA 2GI9A 4HRSA 3P2BA 1TGZB 3W5VB 1PGBA 1EU4A 4FZNA 4FJYA 1YS5A 3TEWA 1K8RB 1TS4A 2NR2A 4K81A 3RZWC 2N7JA 2F1VA 2RD0A 3JYUA 1KM7A 5BYSA 4DQOC 3AEEB 4W9JA 3MC0B 1OQYA 2WP9B 5H8YE 5D3IB 1NBFC 3TUOA 3ZTCA 1NENB 1I4QA 7PRNA 4HCPB 2BYEA 5AEKB 2JZPA 4H2AA 4B6WA 4W9DA 3AA7B 1TY2A 2KWVB 5E79O 2OMFA 3DWGC 1LQBA 1UZXB 5KHOA 2CHZA 1XLOA 3U52E 8PRNA 1QZEA 2DNFA 4FJZA 5C23A 1GFQA 2KK8A 3B2GA 3B08A 1N6ZA 3RN9C 3MJWA 3DA3A 3BINA 1DYQA 2KQSA 2IJ0A 4KDLB 1E7PB 2WXIA 3DBSA 3IBEA 5FK9C 3VQIA 2LMCA 1TYGB 1FCLA 2N1WA 3ZNZB 2WQYB 1KH0A 4GDKA 1YQBA 4JGHB 3CWIA 2BS2B 2WXPA 3DVGX 2FCQA 3KQ4A 4ASWC 3VTUA 4RJWA 1IPGA 5GTIO 3RNBC 1L6VA 5IYUA 1JRUA 4RGTA 5MPOA 4E74A 3A9KB 3ZQ4A 2JRHA 3VUYA 3VY9X 4RGOS 5CHWA 4MH0E 5G5GA 2WGSA 1I4XA 3VFKA 4O3ZA 1BMLC 4AS1A 5EE3A 1WJNA 3BWUD 1WXQA 2LRWA 4HDQA 4C69X 3TCAA 3AAAB 1P9DU 2QILA 4BKGA 5IN7A 1PFDA 3A33B 4M0WA 2KWCA 2IBIB 3FAHA 4CQNA 3CIRB 1A5RA 4ANXA 3V61A 1J7CA 4M00A 2RPVA 2BYVE 1MHHE 3GB1A 3GE3C 4EZLA 1LFDA 2K0LA 1F9JA 3VR9B 5IKCM 5J2RA 1UGJA 2G9HD 4MM3B 2Z0DB 5E6PA 2LZ6A 1Z5SB 3RNGC 4BZAA 1G90A 2NBUA 3DBLI 3SY7A 1L4DB 3ZGZA 4N75A 3HM3A 1V80A 4PS3A 3VZWX 3HK0A 3PV1A 3ZO5B 3HHMA 2ZNVB 3Q2AC 4WWOA 3WU2O 5ADXL 4FRXA 3MTNB 1FNUA 1YOVB 3NS1A 3I3TB 1EWYC 4ANUA 3QHTA 2G3QB 4LNKA 4OZCA 1UH6A 2WU2B 4KIKB 1DOYA 1TS3A 3MC9A 2XE5A 4MEMA 3KUCB 2Y7SA 4IM2A 2WXJA 3ZRCA 1E7VA 2ZZPB 1J7BA 4GHBA 2BT6A 5DL7A 3PRPB 1X1MA 2M1MA 4KR4A 3UAQA 4RM9A 1IBXA 4AYMC 4HCNB 3TZGA 3L17A 3BS0A 2FIDA 1RFAA 4PJ0O 2FUHB 1MG4A 2GOWA 3NVWA 3AECB 2G45B 4AFKA 1HXYD 1RYJA 2PE6B 1WXSA 1TS2A 3WA0A 3M63B 1WGYA 4FXCA 2KLCA 1E8ZA 3B1LX 2N9EB 2WX1A 1D6EC 2CHWA 2V9HA 1ZXHA 3Q8EA 4O3WA 2PIAA 3M95A 2UU7A 2JXXA 1VR9A 1TKEA 5I4DA 2G4SA 3P4SB 3AXCA 4XZ4A 5E6NA 2LRUA 1N5XA 4QAYA 3PGSA 2PE9A 5DL6A 1WJUA 3AU4A 2LFIA 5JDPA 1E8WA 1E90A 2WXLA 3GE8C 3GZNB 2R4OA 3VR8B 4WJQA 4RF0A 4PR7A 2M17A 4YL8A 1J8CA 3RULA 1VLBA 1YJJA 1K53A 2LHFA 4LSEA 3N1XC 4CYEA 3OLMD 2NPTA 2BVCA 3MFGA 1P0RA 3BK1A 2PMVA 4LSIA 1XCQL 3RNEC 1QQRA 2KXPB 3ZJTA 4BFRA 4CTDA 2L7RA 4GDLA 4NJ7A 2KX3A 3QX1A 1QOBA 1WE7A 2KDBA 2MCNB 3PHXB 4OVVA 3ZDMC 4GU2A 3N3KB 3RCZA 3AEFB 3VRAB 4A3OA 5DPSA 1WWTA 1MG8A 1H4RA 3AU5A 2JZZA 1N61A 2K1FA 5ADXK 3KUDB 3GP6A 3ZVVA 1TBEA 2QJLA 2AEHA 2R88A 2J0JA 3WAMA 2O2VA 3TMPB 3P4RB 2ODJA 2L76A 1J19A 4US8A 4RMAA 4XE0A 4TQ1A 4FT6A 4GGQA 3R2IA 1XLPA 4LJOB 2PRNA 2LHEA 2LXCA 3WAOA 3BIID 5G2NA 2DZIA 4DXFA 3AAEA 2YPVA 1RAXA 5GMVA 3NHEB 1MHXA 4UDUC 4TV3A 2KJ6A 2I1KA 1Y8RC 2IDYA 2KQ4X 1I4GA 5BMHA 2K22A 5FR3A 2NS5A 3Q14C 2D3BA 1XQQA 1L0YB 2BQQA 1WI0A 4LCDE 2KFKA 1P7FA 1RWSA 5JHBA 2M8SA 3LDZE 2DWQA 2KXJA 2KWDA 4KDIC 2IY1B 4AUQC 4JQWC 3RUIB 2LGIA 2Y2XA 3ZKJC 3NVYA 3AEDB 1JWAD 4RLBA 2KLGA 2ZW1A 1FXAA 5GXGB 3EC8A 3O65B 2PVOD 2ONQA 4AKRB 1ZKHA 4KSLC 1WZ3A 3T3OA 3FYXA 2IO1B 3UIOB 5DPTA 3VZTX 3AEGB 3DBHB 4USAA 4KRAA 3Q69A 4Q2JA 5IA7A 2ACZB 2QTKA 2QC8A 4FMSA 2LI5A 2XEWA 4O1NA 3SEBA 2EKEC 3Q3JA 3H1UA 4RCOA 1WRDB 2KZ7B 3PRMB 3ECIA 3Q6BA 2PEAA 2KFJA 3S2AA 3APFA 2JU6X 1M94A 5FR6A 1C9FA 5BYQA 4WJOA 1NDDA 2K4TA 2WVPA 3U30A 1BXWA 4OW0A 5BO4B 4W9HA 2IO0B 4TUUA 2L00B 1WM3A 1BH3A 2XN9C 3KYCD 2MBOA 1N60A 4HJKA 3EGRA 1T6BX 2RDHA 3DQVA 4FLHA 2Z0EB 1D5MC 1GPXA 5CHFA 3PGRA 4EUTA 3PREA 1ZHXA 2N9PC 1ZW7A 1LXDA 2NTSA 4FBJB 1QILA 1ZUD2 2RR9A 4HPLB 3TIXA 3P42A 1C3TA 1WZ0A 5CTRC 3JVZX 4WQMA 1F2RI 2WJRA 3MP9A 4URKA 1PGXA 2BPSA 3PZ8A 1PHOA 2GBJA 3Q8BA 1QF6A 1Q1OA 3CSTA 4ZRJA 2ASQA 4N59A 3U4EG 2D07B 2JQYA 1JWSD 4IDIA 1V6EA 2HTME 3PSEB 2OEDA 2WWZA 2ZW0A 1E7UA 1YD8U 4RGMA 3BYTB 4YXDB 1FXIA 2Z8LA 3VH3B 4B9KA 1WMHA 2UWQA 3LB8C 2MBBB 3AH7A 2BBCA 5EE0A 2WXQA 3FILB 3L54A 4C00A 1LM8B 3R3MA 2XE3A 1XCTL 3UQBA 1OPFA 1OQRA 3EUB2 2VZKB 3HW9A 2HJ8A 4A20A 3L10B 1NYRA 2N2MA 2QHOA 4C56C 2AYOB 4LNFA 3GOEA 3NVVA 5J18A 2DYMA 3NS8A 2AQ2B 4GB9A 2CR5A 1JALA 4P6VF 2VZKD 3I9V1 3ZYYX 1WRIA 2L05A 2NTTA 1V1PA 1SBBB 4EEWA 5D3DA 2ZVOA 2L3ZA 3Q8CA 2MA9B 4DDGD 3UU2A 1TTNA 1XF5L 3P1MA 3QARA 3ZW3A 2MQJA 5BMIA 2IYDB 2E3TA 3GZNI 3NVZA 2KC0A 2OJWA 3EFCA 4C4VA 5KHQA 2KQ7A 1C77A 3DBRB 3LK3A 3ZUNA 2R4NA 2XMXA 3AE4B 4C7YA 1WXMA 2Y5BB 3QRAA 2W82A 3TEXA 2LUEA 2QIEB 1EF1A 3B0AA 5B5EO 3AN1A 4MELA 1L4ZB 1GNUA 4A55A 1FFUA 2LXAA 2SAKA 3KW5B 4NPNA 1H6S1 3SDLC 3MHSD 2GBMA 3KH0A 4NY0A 4ZRIA 4FJVB 1V97A 3AA6A 2N0SB 3ENEA 1IP9A 2V0GA 4P1CC 3PGEA 4MGIE 3O13A 3HRDD 5IO9A 1XLNA 4HXDA 1SE3A 4J6IA 2R61A 5DPWA 4NQKE 1XO3A 4DK5A 1WR6E 4C80A 4ANWA 1CJEA 1SIJA 4BOZB 1ESFA 4EE2A 5KAFO 2K39A 3WI4A 3ML8A 1ZDXA 2AL3A 4EZKA 3VUWA 3SFDB 4FQEA 1WGRA 1Z2MA 2FAZA 2O6VB 1HXUA 2J4UP 1GC7A 1L2NA 2V3PA 3QQ8B 1L5PA 4WWMA 3IHPC 2GLSA 3HWBA 1GFMA 4XWTA 1VD2A 3K9OB 1D3ZA 2ZFGA 4G3XB 4FUVA 4WJPA 4FULA 2O6VD 4K3CA 2LGYA 2KC1A 2B76B 3APDA 5AUKA 4KSKC 3VHTC 2E6XA 1GC6A 2X9KA 2V1YA 3Q8AA 1NEKB 4B0MA 4MSMB 4NNJB 4WWPA 5TSSA 3A4RA 5AZFA 3VDZA 3W1YA 3ZXVA 1OQQA 1K52A 2BWFA 4KZ0A 4L2YA 1TIFA 2N4FA 3DBHI 2V3SA 2DX5B 5G39A 2WXGA 4HJGE 4PYZA 3PLUA 1NI3A 4JX1C 2D3CA 2X38A 1WJ6A 2L8JA 3OJ3A 3BVMA 1EUVB 1E6EB 2J52A 4REZA 3AA0A 2V4LA 2R2OA 3BZDB 1E54A 1G6JA 3PHWB 2MBHA 1ACCA 4E1TA 5H2FO 4P1BC 3Q3MC 2RDGA 4YSYB 5IAAC 4L1BA 2LVQA 4YWGG 1YMHE 2C9WB 4G11A 2KACA 3ZNGC 5JH5C 1GOZA 1E9MA 3AE6B 1KRHA 3WI5A 4LDTB 3AA7A 2IO2B 4ARCA 4WWNA 1ZHTA 2MJEA 2LUMA 2RSUA 3DA4A 2GBRA 3KZIO 2DBYA 1GB4A 2GB1A 1Q9FA 2Y0LA 1RLFA 1FD6A 3V60A 3P4QB 4LDTD 2L1AA 2LVOA 2AQ1B 3Q3OC 4XDDA 2RPQA 4D65A 1UF0A 2KYWA 5HI1A 2WS3B 4US9A 2XK5B 4AUIA 4S17A 4F1SA 4PS7A 3UGBB 3H7SA 2B3AA 4G76A 4JWSC 1Y56A 2YVCA 2K0PA 2I1JA 3JW0X 3X0WA 1KOTA 4XWWA 4ACFA 4FRTA 2XTRA 1V8CA 2J4XA 4AQ7A 2WJQA 3DPDA 1D5ZC 2QDFA 1YIWA 3KWVA 3R66C 3DHGC 2DYBA 3EA6A 1FMAD 3T20A 3RMKC 3DCGA 3A9KA 6PRNA 4ZYNA 1IGCA 4IL6O 1NYQA 1QJ8A 1UBQA 3PS6A 1NI2A 2IGDA 3DZMA 4MJSB 2KDEB 4A90A 2VH2A 3AAAA 3U7ZA 3RNCC 1HZ6A 3PTFC 2LGSA 3KVFB 2R8AA 1XT9B 2IO3B 3C5OA 1HTOA 3MHZA 2JXTA 5E6JA 1HXTA 3VTWA 3LK2B 3PZDA 3A9JB 4S0RA 4A9AA 4A6QA 4HPMB 4WAFA 2CJNA 4N9F4 4I6NB 4G75A 3U2SC 2KN5A 2JSVX 2D2QA 1VZ7A 1VZ6A 4MT5A 2KMCA 4MM3A 5BMGA 2RGFA 3EFUA 1ZXIA 2XE2A 3ONSA 1OSMA 2J42A 3DBRI 5G38A 3W1SA 1N5WA 3HVZA 3JTYA 2DZMA 3HVDA 2DYOA 2D3GA 3V6EB 5T5FA 3NSGA 3DVNV 3M3JA 1WGDA 2KTRB 1QJ9A 3EMNX 1JWBD 3NZSA 2PVGC 4KIKA 1WY8A 2V3NA 1I4PA 3CMMB 2IZVB 3A2SX 3QK0A 3OG5A 2C7MB 4U9CA 2MWSB 3URYA 2K25A 4TKNA 2K9XA 2W80C 4TQ0A 3KYDD 2KD0A 1T0QC 2XTQA 4RFBA 4F7ZA 1GAQB 1E5WA 2MHJA 3WANA 3AE9B 1JWMD 1IUEA 3N20C 1SGHA 2CKHB 1XD3B 5DCNA 2AWTA 1E0ZA 2XG6A 1IZNB 2WXHA 4DDID 3MC8A 4N6EB 3RI7C 2BKFA 2AQ3B 2F1CX 3A1QB 3SD5A 5B66O 3PVLA 2KWUB 3VE2A 2ZCBA 1K50A 5D7GA 1N63A 3QAQA 1YN5A 4FA6A 3EHVA 1CMXB 3POQA 5KAIO 3JSVB 3GS2A 1ZHZA 1C79A 3OAWA 4Z3TA 1ROEA 2REXA 2FIFA 1OEYJ 2KN4A 2MSED 1F77A 3DVGY 4HK2A 3FKYA 2N7DA 4FSOA 4O4XA 4CHKA 3PGUA 3TBLD 4AYNA 1P4TA 1ZHWA 3POUA 4F8CB 2KXPA 3L13A 3H6NA 2ZCCA 2M06A 4P7IA 2BB5A 2LASA 4HKQA 3C8YA 1YJIA 3IVFA 4BAXA 1L0XB 4KKIA 1YN3A 2MH7A 5C1ZA 1WJ4A 5JHAA 2GE4A 4WIPA 1SEBD 1WX9A 1PGAA 1SJED 1WXAA 2X8XX 3ZLZA 4GXBA 2N9KA 3ZXRA 1UD7A 3UQAA 2IGHA 4NAWB 1I4RA 2XNAC 2YEPF 3W9CB 2MBEA 2D11A 3W1SC 4LLGM 4QQ1A 3KUZA 2JX5A 1JRPA 1I35A 4LNNA 3HOLA 3JCUO 5D5DA 1R7SA 4MGZE 2JZ3B 1SB3C 2WXMA 2TSSA 3ZNHB 2PKOA 2WLBA 4KZCA 2C5LC 4AYEC 2V4IB 5CHVC 4GLSC 3GP7A 1T0YA 2KMMA 2JMMA 1TJEA 4W9CA 2WDTB 3E56A 3PT2B 2Y0KA 4PT5A 3N9YC 1H8CA 2FGRA 1MFWA 3SU8X 4FZLA 2K6QA 1TT5B 1HZ5A 3ZRFA 5TR5A 1V2YA 3IT4B 4WJNA 4GCSA 3PQSA 1VDVA 2D3AA 4IOIE 4DXGA 4GCPA 1KLGD 3ALBA 2BF8B 4F4BA 3IFWB 2OHFA 4GCQA 2N9LA 1T3QA 4OVZA 4AKRA 4BKSD 4PUXA 1R4MB 1ZOYB 2EMSA 3D32A 3VVWB 1TS5A 4M02A 3LK42 5L83A 4WH4A 3LXFA 3WALA 4A3PA 1FM0D 2BKRB 2FCMA 2XE1A 3RNFC 2CHXA 1DOIA 4FSPA 2KMAA 4WQOB 1E10A 2KZ7A 1EF5A 2DLBA 2EMTA 1YX6B 3MJ5A 1PDXA 3AB5A 4XC2A 1L7YA 2LVPA 4PS8A 3V05A 3QRCA 1T0RC 2MJDA 4XDCA 1T5XD 4DHZE 2N2LA 5T8IA 4HPPA 2FCSA 4KGSA 3EECA 3QWZB 1C4CA 4AJWA 3APCA 2OOBB 3J9CA 3SYSA 2CJOA 2FE8A 2BB6A 4IM0A 1WX8A 5DPRA 4ZRKA 3V3XA 5AUIA 1SE2A 1KJTA 1HA5A 2K8BA 1CK1A 4NAMA 4DXAB 4ICVA 4IC7B 4E3CA 4HDOA 1V5TA 2Z59B 3SR6A 1R4NB 4RL9A 2DHZA 1EO6A 1ENFA 1GFNA 4N58A 1D4BA 2J1NA 1C78A 4II2B 2IGGA 4ZDVA 1ET6A 2Y5PA 1K51A 5JZEB 3T9LA 4XNKA 3RNAC 1OEYA 2KX0A 1SE9A 2NBVB 2R4PA 2LJIA 1VZ8A 2XBBC 5PRNA 4C7ZA 4WURA 3AA1A 1RFKA 4FESA 1MM5A 2JY6A 5IOIA 2WHIA 1GUAB 2ICIA 4NJ6A 3NZ3A 2FBWB 1WH3A 1C76A 4HWIB 3CSFA 3WIMA 1Q10A 4GSWA 4IWOA 5G55A 5AZHA 4II3B 5J17A 3H7PB 3BVZA 5D6JB 1V9JA 2MP2B 5LXIB 3FILA 3SY9A 2INCC 4LNOA 4MGKE 2MW5A 4AP4C 5GV0A 3V8UA 1MPFA 2BW2A 2LEKA 2MX2A 3DHHC 3VRBB 2M0AA 1UELA 2RDBC 3B9JA 4KV2A 1FO4A 3HM6X 1CQVA 2CU3A 4ANVA 4LSHA 2MNHA 4PK1A 3PPAA 4MDKE 1THQA 2DZKA 5C3JB 1MI0A 4K1RB 1FPYA 5FKAC 1PRNA 4D64A 2PW9A 3TEZA 2AX5A 3N1YC 1BT9A 3IAM1 5CX3A 1HXXA 3ZDTA 3POXA 4EFOA 5EE9A 3VTVA 4MH8A 1AWDA 2INDC 3SYBA 1HEZE 3NY5A 3VXWA 3NG0A 4FHJA 5G26A 3DWOX 1CZPA 3AEBB 1HQRD 3BRZA 4AKMA 1AN8A 1GG3A 4JL9A 4O49A 2LWPA 4IM3A 5E6OA 2KDYA 5BYRA 4ICUA 3TSSA 1SF0A 2INPE 2WX0A 3DWNA 1Q0WB 3DOWA 2J7QB 3A0HO 2C60A 4X57B 1E8YA 4JPSA 3CF6E 4HKZE 3P63A 2W9NA 4M01A 3G7GA 3SZDA 4OZAA 1DOXA 2AXTO 1OGWA 4GDKB 5AZGA 2ZVNA 4TSSA 3TEYA 1FNVA 2JT4B 1QLBB 2KZRA 1S3SG 3KVDD 2PJHA 4LSFA 3UPGA 4B61A 4HEA1 2O6VA 4IG7B 4EOYA 2WDRB 2DZJA 5TISO 1F52A 3PZ7A 3VAWA 1GFOA 1WYWB 3V62A 2C7NB 2FUG1 1ORMA 1D5XC 4YTPB 1AW7A 1PYWD 4AOFA 3NZUA 2GRIA 4FZMA 1YNTE 2M4NA 4LJPB 1QJPA 4M0WB 1MJDA 4D5UA 1F0ZA 3ABVB 3DDCB 1LGRA 3AEAB 5JXVA 3ZTDA 4ZOHC 2C7HA 2M56B 4W9KA 1R4MI 4BBNF 3X23A 1V49A 1T16A 1TKGA 4N74A 1MM4A 3VE1A 2KAJA 1V5OA 4XX5A 1L0VB 2MHLA 4E1SA 1STEA 1UNSA 1AARA 3NRZA 1L6UA 4I6LB 1Q9GA 4W9IA 4DHJB 5G5HA 5HFYA 1VJKA 2Y0HA 2Y3AA 1A70A 2L52A 3PRNA 4KX6B 1WR1A 3ZNID 2D10A 3W5UB 5D94A 4DHJD 1HE8A 2QSDA 3AI5A 2FCNA 4GOCA 4ITKA 4JFBA 3I5JC 2AL6A 2JQRB 3WCQA 1SXTA 3HOEA 2GMIC 3PO0A 1IBXB 1OTRB 1QOGA 4LNIA 1R4NI 4XGAB 1XEEA 2K8CA 2W3SA 3HUIA 5EE2A 1WIAA 2J0MA 3K9PB 4OVUA 3TL5A 3VUXA 3SHQA 4JWUC 5L95C 4GMVA 4O3XB 4OZBA 3AV8A 3PF1A
chains in the Genus database with same CATH topology
2X8XX 4QAYA 3NJTA 4N75A 3OG5A 3Q6BA 4C4VB 3EFCA 4C4VA 2V9HA 3MC8A 4K3CA 4N74A 2VH1A 4XGAB 4C00A 4PK1A 2VH2A 2MHJA 4BZAA 3MC9A 4K3BA 2QCZA 2QDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8X X;  4QAY A;  3NJT A;  4N75 A;  3OG5 A;  3Q6B A;  4C4V B;  3EFC A;  4C4V A;  2V9H A;  3MC8 A;  4K3C A;  4N74 A;  2VH1 A;  4XGA B;  4C00 A;  4PK1 A;  2VH2 A;  2MHJ A;  4BZA A;  3MC9 A;  4K3B A;  2QCZ A;  2QDF A; 
#chains in the Genus database with same CATH topology
 2JVC A;  2D5G A;  2XK5 A;  4LK0 M;  2I38 A;  4G50 A;  3DVN U;  2Q5W D;  5HKH A;  1QKZ A;  1ET9 A;  2VH1 A;  1LO5 D;  4MGY E;  4IWQ A;  2WXO A;  2OJR A;  3C0R B;  2VRR B;  4UB6 O;  2Y5C A;  1ZE3 D;  2ZLD A;  2KAN A;  2NMQ A;  3E9S A;  3IG3 A;  3Q3N C;  1WXV A;  5LLI A;  2N9X A;  1BUI C;  1FIQ A;  3AE2 B;  4YT0 B;  2RMM A;  2L0T A;  1UGM A;  2CS4 A;  2ON8 A;  2ZPY A;  3AE8 B;  3K19 A;  1VCB A;  1HTQ A;  3OWE B;  4AYI D;  2N7E A;  4RM8 A;  4XYC A;  2H88 B;  3PLV A;  1MPE A;  1ZP0 B;  1GB1 A;  1TKY A;  4MJS A;  4JE3 B;  2SEB D;  4BKT A;  1RRB A;  2NPT B;  4ZHO A;  3LJ3 A;  1V86 A;  1KLV A;  1IYF A;  4GDL B;  4IUM B;  1WGG A;  2ERV A;  3LK2 A;  1NVI D;  1VRA B;  4ZRP A;  3A9J A;  2KT7 A;  1EM7 A;  2J53 A;  4K7U A;  3TJP A;  5DL8 A;  1FRR A;  2NCN A;  3ZJV A;  2W3R A;  5EE1 A;  4JIO U;  1F1H A;  3N32 A;  1WX7 A;  4ZYS A;  4ARI A;  1WFY A;  4PYU A;  1WM2 A;  1RM6 C;  4YSX B;  4R3D A;  5GTH O;  2WNM A;  1WSP A;  1UWM A;  4B95 A;  2BGF A;  2O2V B;  2DAF A;  1SSN A;  4FHK A;  1P7E A;  4TMA B;  2PTL A;  1JML A;  1U4A A;  1UBI A;  2KDM A;  1SE4 A;  3AAE B;  3L4P A;  2K6D B;  2KTR A;  2N1V A;  2JYT A;  1S5L O;  2HTH A;  4AJY B;  2J0K A;  3IAS 1;  2IWW A;  3U7D A;  2X27 X;  4HVB A;  3RFZ B;  2YNK A;  4IW0 A;  2KFK B;  3AE7 B;  2O4V A;  4BUM X;  1MVK A;  3AUL A;  3T3N A;  3QCA A;  3AMZ A;  2M0X A;  2KOX A;  2W54 A;  3O0E A;  2KDF B;  2PLP A;  4NQL B;  4CO7 A;  4KKJ A;  1FRD A;  5G3A A;  4NJC A;  5AFU L;  1XLQ A;  1IZN A;  4MSQ B;  4FAD A;  2FNJ B;  2JRI B;  4GN1 A;  2PPH A;  2WXN A;  3L16 A;  1FEH A;  2UYZ B;  3LYY A;  4M8M A;  3T0S A;  2ZPN A;  2WXF A;  4BBN C;  2FGQ X;  1E8X A;  2BS4 B;  3A1Q A;  5DL5 A;  4K3B A;  4I6P A;  1EU3 A;  4YSZ B;  1F2R C;  3ETR A;  1I4H A;  4D2K A;  2JF5 A;  1BXT A;  4KGT A;  2ZNV C;  2BTE A;  1OFF A;  3I63 C;  3LK4 1;  1Q5W B;  1YQ4 B;  2K8H A;  2LHD A;  4DWF A;  2WDV B;  3AM9 A;  3JSV A;  2G1E A;  1FNW A;  1UUP A;  4W9F A;  4ZHP A;  3RT3 B;  3VY8 X;  2KNB A;  3RBH A;  4FN2 A;  2L83 A;  3R7R A;  3VZU X;  3AE3 B;  2IY0 B;  3VH4 B;  1ISN A;  4HRO A;  3H9D A;  1KTK A;  3OJ4 B;  3R2T A;  1DGJ A;  1GFP A;  2JPH A;  4RNA A;  4HLE A;  1GJZ A;  1B1Z A;  2HDE A;  2BYT A;  1V81 A;  2QMT A;  1ZPS A;  3POR A;  2MBQ A;  2LD9 A;  1QOF A;  1N62 A;  3A0B O;  3Q3F A;  4W9E A;  5LXH A;  2MRP A;  4NAW A;  2M19 A;  2K3U A;  1JWU D;  2G4D B;  2KC2 A;  5C2T B;  2EEL A;  2R4L A;  4IWP A;  4LTU A;  3QC8 B;  4GIV A;  1JW9 D;  2YEP B;  3B2F A;  2POR A;  3I57 A;  3N1Z C;  3W2D A;  4EKU A;  2YLM A;  1T1L A;  1WMH B;  2HJ1 A;  2MLB A;  4RJX A;  3SFE B;  2KO3 A;  2A4Z A;  3P4P B;  1YQ3 B;  4UB8 O;  3KLS X;  4W9G A;  4AWJ A;  1AYF A;  2KVZ A;  4DBG A;  1YN4 A;  1WGK A;  4P16 A;  4AYD C;  4RH6 A;  4G0N B;  3ZJU A;  2IPK D;  4KR8 A;  5HHD G;  2IWV A;  5AFU K;  3U8Z A;  4DHZ B;  4BKS A;  1UWX A;  2KDI A;  3T24 A;  1IGD A;  1QOA A;  4BVU C;  5HG2 A;  1C4P A;  2W81 C;  1SJH D;  2MJ3 A;  1TZ1 A;  1FFV A;  2A5U A;  2INN E;  2BS3 B;  4YTN B;  4YTM B;  3DHI C;  1C1Y B;  4EZJ A;  4FOZ A;  3AA1 B;  1KFY B;  4A8X C;  3L08 A;  4IKG A;  4O3Y A;  1V1P B;  3NUH B;  3UIP B;  4J3O D;  4AZL A;  4JCH A;  4B0E A;  3BYY B;  3V6C B;  2DEN B;  2KVR A;  4JLC A;  5FVN A;  4KGR A;  1WE6 A;  3NJT A;  4MAC A;  3NOB A;  1B9R A;  3PQU A;  3DBL B;  3UIN B;  3BY4 B;  2DAJ A;  4C4V B;  3RPF C;  2BWE S;  1ZGU B;  2JWU A;  1P98 A;  3LK3 B;  3BK2 A;  2F1T A;  4M8N A;  1FXT B;  4BOS C;  4KVG B;  3ZIM A;  5D2M B;  3M62 B;  1JCK B;  4NZL B;  3BRY A;  1BT0 A;  2ZJD A;  2R2Q A;  2LJ5 A;  3IT6 B;  2GBN A;  3SZV A;  5H92 C;  2JWZ A;  3ML9 A;  2KJH B;  1JRO A;  3AE1 B;  2WDQ B;  4O4U A;  2HE7 A;  1P3Q U;  2M07 A;  3R8B A;  3AA6 B;  4RLC A;  3UF8 A;  2LGX A;  1TZO A;  3PRZ A;  2KJR A;  3A4S C;  2NBW B;  3UI3 A;  4XNL A;  3C19 A;  3N30 A;  2KKC A;  1PUT A;  1I42 A;  1PQS A;  1WF9 A;  4WAA A;  1SIF A;  2BYF A;  1J7A A;  2L32 A;  3QIJ A;  2R89 A;  2WXK A;  3R7Q A;  2KHW B;  3RYT A;  4E71 A;  4GF4 A;  2LFU A;  2I2Y A;  5LNK 1;  1YJ1 A;  2W55 A;  3QJZ A;  2K5P A;  3AE5 B;  4ZRQ A;  3RZF A;  1C4A A;  1FCC C;  1KF6 B;  2JUO A;  2QCZ A;  4W9L A;  3BVG A;  1J0G A;  2MEK A;  1M4V A;  1P1A A;  2EKI A;  1WYG A;  4OHJ A;  1KLU D;  2NVU I;  3T8M A;  3H7P A;  4K7S A;  1YX5 B;  4L23 A;  2ZEQ A;  2L0F A;  2MP2 A;  2WYQ A;  3RD2 A;  1ZHY A;  2KTF A;  3QA8 A;  2WU5 B;  2H89 B;  1TY0 A;  1ZDV A;  3FC4 A;  2JYE A;  1WGH A;  3H8H A;  3WAP A;  2QEJ C;  2LGD A;  2WXR A;  1S1Q B;  4K7W A;  2CU1 A;  2GBK A;  3IXS A;  1T0S C;  3HIZ A;  1JQ4 A;  3L0W B;  4RGN A;  3Q8F A;  1QT9 A;  1XXG A;  3DWM A;  5EDS A;  1I7H A;  3KWL A;  5IP4 D;  2HD5 B;  4RF1 A;  1V1O A;  3AA0 B;  1EWC A;  2GI9 A;  4HRS A;  3P2B A;  1TGZ B;  3W5V B;  1PGB A;  1EU4 A;  4FZN A;  4FJY A;  1YS5 A;  3TEW A;  1K8R B;  1TS4 A;  2NR2 A;  4K81 A;  3RZW C;  2N7J A;  2F1V A;  2RD0 A;  3JYU A;  1KM7 A;  5BYS A;  4DQO C;  3AEE B;  4W9J A;  3MC0 B;  1OQY A;  2WP9 B;  5H8Y E;  5D3I B;  1NBF C;  3TUO A;  3ZTC A;  1NEN B;  1I4Q A;  7PRN A;  4HCP B;  2BYE A;  5AEK B;  2JZP A;  4H2A A;  4B6W A;  4W9D A;  3AA7 B;  1TY2 A;  2KWV B;  5E79 O;  2OMF A;  3DWG C;  1LQB A;  1UZX B;  5KHO A;  2CHZ A;  1XLO A;  3U52 E;  8PRN A;  1QZE A;  2DNF A;  4FJZ A;  5C23 A;  1GFQ A;  2KK8 A;  3B2G A;  3B08 A;  1N6Z A;  3RN9 C;  3MJW A;  3DA3 A;  3BIN A;  1DYQ A;  2KQS A;  2IJ0 A;  4KDL B;  1E7P B;  2WXI A;  3DBS A;  3IBE A;  5FK9 C;  3VQI A;  2LMC A;  1TYG B;  1FCL A;  2N1W A;  3ZNZ B;  2WQY B;  1KH0 A;  4GDK A;  1YQB A;  4JGH B;  3CWI A;  2BS2 B;  2WXP A;  3DVG X;  2FCQ A;  3KQ4 A;  4ASW C;  3VTU A;  4RJW A;  1IPG A;  5GTI O;  3RNB C;  1L6V A;  5IYU A;  1JRU A;  4RGT A;  5MPO A;  4E74 A;  3A9K B;  3ZQ4 A;  2JRH A;  3VUY A;  3VY9 X;  4RGO S;  5CHW A;  4MH0 E;  5G5G A;  2WGS A;  1I4X A;  3VFK A;  4O3Z A;  1BML C;  4AS1 A;  5EE3 A;  1WJN A;  3BWU D;  1WXQ A;  2LRW A;  4HDQ A;  4C69 X;  3TCA A;  3AAA B;  1P9D U;  2QIL A;  4BKG A;  5IN7 A;  1PFD A;  3A33 B;  4M0W A;  2KWC A;  2IBI B;  3FAH A;  4CQN A;  3CIR B;  1A5R A;  4ANX A;  3V61 A;  1J7C A;  4M00 A;  2RPV A;  2BYV E;  1MHH E;  3GB1 A;  3GE3 C;  4EZL A;  1LFD A;  2K0L A;  1F9J A;  3VR9 B;  5IKC M;  5J2R A;  1UGJ A;  2G9H D;  4MM3 B;  2Z0D B;  5E6P A;  2LZ6 A;  1Z5S B;  3RNG C;  4BZA A;  1G90 A;  2NBU A;  3DBL I;  3SY7 A;  1L4D B;  3ZGZ A;  4N75 A;  3HM3 A;  1V80 A;  4PS3 A;  3VZW X;  3HK0 A;  3PV1 A;  3ZO5 B;  3HHM A;  2ZNV B;  3Q2A C;  4WWO A;  3WU2 O;  5ADX L;  4FRX A;  3MTN B;  1FNU A;  1YOV B;  3NS1 A;  3I3T B;  1EWY C;  4ANU A;  3QHT A;  2G3Q B;  4LNK A;  4OZC A;  1UH6 A;  2WU2 B;  4KIK B;  1DOY A;  1TS3 A;  3MC9 A;  2XE5 A;  4MEM A;  3KUC B;  2Y7S A;  4IM2 A;  2WXJ A;  3ZRC A;  1E7V A;  2ZZP B;  1J7B A;  4GHB A;  2BT6 A;  5DL7 A;  3PRP B;  1X1M A;  2M1M A;  4KR4 A;  3UAQ A;  4RM9 A;  1IBX A;  4AYM C;  4HCN B;  3TZG A;  3L17 A;  3BS0 A;  2FID A;  1RFA A;  4PJ0 O;  2FUH B;  1MG4 A;  2GOW A;  3NVW A;  3AEC B;  2G45 B;  4AFK A;  1HXY D;  1RYJ A;  2PE6 B;  1WXS A;  1TS2 A;  3WA0 A;  3M63 B;  1WGY A;  4FXC A;  2KLC A;  1E8Z A;  3B1L X;  2N9E B;  2WX1 A;  1D6E C;  2CHW A;  2V9H A;  1ZXH A;  3Q8E A;  4O3W A;  2PIA A;  3M95 A;  2UU7 A;  2JXX A;  1VR9 A;  1TKE A;  5I4D A;  2G4S A;  3P4S B;  3AXC A;  4XZ4 A;  5E6N A;  2LRU A;  1N5X A;  4QAY A;  3PGS A;  2PE9 A;  5DL6 A;  1WJU A;  3AU4 A;  2LFI A;  5JDP A;  1E8W A;  1E90 A;  2WXL A;  3GE8 C;  3GZN B;  2R4O A;  3VR8 B;  4WJQ A;  4RF0 A;  4PR7 A;  2M17 A;  4YL8 A;  1J8C A;  3RUL A;  1VLB A;  1YJJ A;  1K53 A;  2LHF A;  4LSE A;  3N1X C;  4CYE A;  3OLM D;  2NPT A;  2BVC A;  3MFG A;  1P0R A;  3BK1 A;  2PMV A;  4LSI A;  1XCQ L;  3RNE C;  1QQR A;  2KXP B;  3ZJT A;  4BFR A;  4CTD A;  2L7R A;  4GDL A;  4NJ7 A;  2KX3 A;  3QX1 A;  1QOB A;  1WE7 A;  2KDB A;  2MCN B;  3PHX B;  4OVV A;  3ZDM C;  4GU2 A;  3N3K B;  3RCZ A;  3AEF B;  3VRA B;  4A3O A;  5DPS A;  1WWT A;  1MG8 A;  1H4R A;  3AU5 A;  2JZZ A;  1N61 A;  2K1F A;  5ADX K;  3KUD B;  3GP6 A;  3ZVV A;  1TBE A;  2QJL A;  2AEH A;  2R88 A;  2J0J A;  3WAM A;  2O2V A;  3TMP B;  3P4R B;  2ODJ A;  2L76 A;  1J19 A;  4US8 A;  4RMA A;  4XE0 A;  4TQ1 A;  4FT6 A;  4GGQ A;  3R2I A;  1XLP A;  4LJO B;  2PRN A;  2LHE A;  2LXC A;  3WAO A;  3BII D;  5G2N A;  2DZI A;  4DXF A;  3AAE A;  2YPV A;  1RAX A;  5GMV A;  3NHE B;  1MHX A;  4UDU C;  4TV3 A;  2KJ6 A;  2I1K A;  1Y8R C;  2IDY A;  2KQ4 X;  1I4G A;  5BMH A;  2K22 A;  5FR3 A;  2NS5 A;  3Q14 C;  2D3B A;  1XQQ A;  1L0Y B;  2BQQ A;  1WI0 A;  4LCD E;  2KFK A;  1P7F A;  1RWS A;  5JHB A;  2M8S A;  3LDZ E;  2DWQ A;  2KXJ A;  2KWD A;  4KDI C;  2IY1 B;  4AUQ C;  4JQW C;  3RUI B;  2LGI A;  2Y2X A;  3ZKJ C;  3NVY A;  3AED B;  1JWA D;  4RLB A;  2KLG A;  2ZW1 A;  1FXA A;  5GXG B;  3EC8 A;  3O65 B;  2PVO D;  2ONQ A;  4AKR B;  1ZKH A;  4KSL C;  1WZ3 A;  3T3O A;  3FYX A;  2IO1 B;  3UIO B;  5DPT A;  3VZT X;  3AEG B;  3DBH B;  4USA A;  4KRA A;  3Q69 A;  4Q2J A;  5IA7 A;  2ACZ B;  2QTK A;  2QC8 A;  4FMS A;  2LI5 A;  2XEW A;  4O1N A;  3SEB A;  2EKE C;  3Q3J A;  3H1U A;  4RCO A;  1WRD B;  2KZ7 B;  3PRM B;  3ECI A;  3Q6B A;  2PEA A;  2KFJ A;  3S2A A;  3APF A;  2JU6 X;  1M94 A;  5FR6 A;  1C9F A;  5BYQ A;  4WJO A;  1NDD A;  2K4T A;  2WVP A;  3U30 A;  1BXW A;  4OW0 A;  5BO4 B;  4W9H A;  2IO0 B;  4TUU A;  2L00 B;  1WM3 A;  1BH3 A;  2XN9 C;  3KYC D;  2MBO A;  1N60 A;  4HJK A;  3EGR A;  1T6B X;  2RDH A;  3DQV A;  4FLH A;  2Z0E B;  1D5M C;  1GPX A;  5CHF A;  3PGR A;  4EUT A;  3PRE A;  1ZHX A;  2N9P C;  1ZW7 A;  1LXD A;  2NTS A;  4FBJ B;  1QIL A;  1ZUD 2;  2RR9 A;  4HPL B;  3TIX A;  3P42 A;  1C3T A;  1WZ0 A;  5CTR C;  3JVZ X;  4WQM A;  1F2R I;  2WJR A;  3MP9 A;  4URK A;  1PGX A;  2BPS A;  3PZ8 A;  1PHO A;  2GBJ A;  3Q8B A;  1QF6 A;  1Q1O A;  3CST A;  4ZRJ A;  2ASQ A;  4N59 A;  3U4E G;  2D07 B;  2JQY A;  1JWS D;  4IDI A;  1V6E A;  2HTM E;  3PSE B;  2OED A;  2WWZ A;  2ZW0 A;  1E7U A;  1YD8 U;  4RGM A;  3BYT B;  4YXD B;  1FXI A;  2Z8L A;  3VH3 B;  4B9K A;  1WMH A;  2UWQ A;  3LB8 C;  2MBB B;  3AH7 A;  2BBC A;  5EE0 A;  2WXQ A;  3FIL B;  3L54 A;  4C00 A;  1LM8 B;  3R3M A;  2XE3 A;  1XCT L;  3UQB A;  1OPF A;  1OQR A;  3EUB 2;  2VZK B;  3HW9 A;  2HJ8 A;  4A20 A;  3L10 B;  1NYR A;  2N2M A;  2QHO A;  4C56 C;  2AYO B;  4LNF A;  3GOE A;  3NVV A;  5J18 A;  2DYM A;  3NS8 A;  2AQ2 B;  4GB9 A;  2CR5 A;  1JAL A;  4P6V F;  2VZK D;  3I9V 1;  3ZYY X;  1WRI A;  2L05 A;  2NTT A;  1V1P A;  1SBB B;  4EEW A;  5D3D A;  2ZVO A;  2L3Z A;  3Q8C A;  2MA9 B;  4DDG D;  3UU2 A;  1TTN A;  1XF5 L;  3P1M A;  3QAR A;  3ZW3 A;  2MQJ A;  5BMI A;  2IYD B;  2E3T A;  3GZN I;  3NVZ A;  2KC0 A;  2OJW A;  3EFC A;  4C4V A;  5KHQ A;  2KQ7 A;  1C77 A;  3DBR B;  3LK3 A;  3ZUN A;  2R4N A;  2XMX A;  3AE4 B;  4C7Y A;  1WXM A;  2Y5B B;  3QRA A;  2W82 A;  3TEX A;  2LUE A;  2QIE B;  1EF1 A;  3B0A A;  5B5E O;  3AN1 A;  4MEL A;  1L4Z B;  1GNU A;  4A55 A;  1FFU A;  2LXA A;  2SAK A;  3KW5 B;  4NPN A;  1H6S 1;  3SDL C;  3MHS D;  2GBM A;  3KH0 A;  4NY0 A;  4ZRI A;  4FJV B;  1V97 A;  3AA6 A;  2N0S B;  3ENE A;  1IP9 A;  2V0G A;  4P1C C;  3PGE A;  4MGI E;  3O13 A;  3HRD D;  5IO9 A;  1XLN A;  4HXD A;  1SE3 A;  4J6I A;  2R61 A;  5DPW A;  4NQK E;  1XO3 A;  4DK5 A;  1WR6 E;  4C80 A;  4ANW A;  1CJE A;  1SIJ A;  4BOZ B;  1ESF A;  4EE2 A;  5KAF O;  2K39 A;  3WI4 A;  3ML8 A;  1ZDX A;  2AL3 A;  4EZK A;  3VUW A;  3SFD B;  4FQE A;  1WGR A;  1Z2M A;  2FAZ A;  2O6V B;  1HXU A;  2J4U P;  1GC7 A;  1L2N A;  2V3P A;  3QQ8 B;  1L5P A;  4WWM A;  3IHP C;  2GLS A;  3HWB A;  1GFM A;  4XWT A;  1VD2 A;  3K9O B;  1D3Z A;  2ZFG A;  4G3X B;  4FUV A;  4WJP A;  4FUL A;  2O6V D;  4K3C A;  2LGY A;  2KC1 A;  2B76 B;  3APD A;  5AUK A;  4KSK C;  3VHT C;  2E6X A;  1GC6 A;  2X9K A;  2V1Y A;  3Q8A A;  1NEK B;  4B0M A;  4MSM B;  4NNJ B;  4WWP A;  5TSS A;  3A4R A;  5AZF A;  3VDZ A;  3W1Y A;  3ZXV A;  1OQQ A;  1K52 A;  2BWF A;  4KZ0 A;  4L2Y A;  1TIF A;  2N4F A;  3DBH I;  2V3S A;  2DX5 B;  5G39 A;  2WXG A;  4HJG E;  4PYZ A;  3PLU A;  1NI3 A;  4JX1 C;  2D3C A;  2X38 A;  1WJ6 A;  2L8J A;  3OJ3 A;  3BVM A;  1EUV B;  1E6E B;  2J52 A;  4REZ A;  3AA0 A;  2V4L A;  2R2O A;  3BZD B;  1E54 A;  1G6J A;  3PHW B;  2MBH A;  1ACC A;  4E1T A;  5H2F O;  4P1B C;  3Q3M C;  2RDG A;  4YSY B;  5IAA C;  4L1B A;  2LVQ A;  4YWG G;  1YMH E;  2C9W B;  4G11 A;  2KAC A;  3ZNG C;  5JH5 C;  1GOZ A;  1E9M A;  3AE6 B;  1KRH A;  3WI5 A;  4LDT B;  3AA7 A;  2IO2 B;  4ARC A;  4WWN A;  1ZHT A;  2MJE A;  2LUM A;  2RSU A;  3DA4 A;  2GBR A;  3KZI O;  2DBY A;  1GB4 A;  2GB1 A;  1Q9F A;  2Y0L A;  1RLF A;  1FD6 A;  3V60 A;  3P4Q B;  4LDT D;  2L1A A;  2LVO A;  2AQ1 B;  3Q3O C;  4XDD A;  2RPQ A;  4D65 A;  1UF0 A;  2KYW A;  5HI1 A;  2WS3 B;  4US9 A;  2XK5 B;  4AUI A;  4S17 A;  4F1S A;  4PS7 A;  3UGB B;  3H7S A;  2B3A A;  4G76 A;  4JWS C;  1Y56 A;  2YVC A;  2K0P A;  2I1J A;  3JW0 X;  3X0W A;  1KOT A;  4XWW A;  4ACF A;  4FRT A;  2XTR A;  1V8C A;  2J4X A;  4AQ7 A;  2WJQ A;  3DPD A;  1D5Z C;  2QDF A;  1YIW A;  3KWV A;  3R66 C;  3DHG C;  2DYB A;  3EA6 A;  1FMA D;  3T20 A;  3RMK C;  3DCG A;  3A9K A;  6PRN A;  4ZYN A;  1IGC A;  4IL6 O;  1NYQ A;  1QJ8 A;  1UBQ A;  3PS6 A;  1NI2 A;  2IGD A;  3DZM A;  4MJS B;  2KDE B;  4A90 A;  2VH2 A;  3AAA A;  3U7Z A;  3RNC C;  1HZ6 A;  3PTF C;  2LGS A;  3KVF B;  2R8A A;  1XT9 B;  2IO3 B;  3C5O A;  1HTO A;  3MHZ A;  2JXT A;  5E6J A;  1HXT A;  3VTW A;  3LK2 B;  3PZD A;  3A9J B;  4S0R A;  4A9A A;  4A6Q A;  4HPM B;  4WAF A;  2CJN A;  4N9F 4;  4I6N B;  4G75 A;  3U2S C;  2KN5 A;  2JSV X;  2D2Q A;  1VZ7 A;  1VZ6 A;  4MT5 A;  2KMC A;  4MM3 A;  5BMG A;  2RGF A;  3EFU A;  1ZXI A;  2XE2 A;  3ONS A;  1OSM A;  2J42 A;  3DBR I;  5G38 A;  3W1S A;  1N5W A;  3HVZ A;  3JTY A;  2DZM A;  3HVD A;  2DYO A;  2D3G A;  3V6E B;  5T5F A;  3NSG A;  3DVN V;  3M3J A;  1WGD A;  2KTR B;  1QJ9 A;  3EMN X;  1JWB D;  3NZS A;  2PVG C;  4KIK A;  1WY8 A;  2V3N A;  1I4P A;  3CMM B;  2IZV B;  3A2S X;  3QK0 A;  3OG5 A;  2C7M B;  4U9C A;  2MWS B;  3URY A;  2K25 A;  4TKN A;  2K9X A;  2W80 C;  4TQ0 A;  3KYD D;  2KD0 A;  1T0Q C;  2XTQ A;  4RFB A;  4F7Z A;  1GAQ B;  1E5W A;  2MHJ A;  3WAN A;  3AE9 B;  1JWM D;  1IUE A;  3N20 C;  1SGH A;  2CKH B;  1XD3 B;  5DCN A;  2AWT A;  1E0Z A;  2XG6 A;  1IZN B;  2WXH A;  4DDI D;  3MC8 A;  4N6E B;  3RI7 C;  2BKF A;  2AQ3 B;  2F1C X;  3A1Q B;  3SD5 A;  5B66 O;  3PVL A;  2KWU B;  3VE2 A;  2ZCB A;  1K50 A;  5D7G A;  1N63 A;  3QAQ A;  1YN5 A;  4FA6 A;  3EHV A;  1CMX B;  3POQ A;  5KAI O;  3JSV B;  3GS2 A;  1ZHZ A;  1C79 A;  3OAW A;  4Z3T A;  1ROE A;  2REX A;  2FIF A;  1OEY J;  2KN4 A;  2MSE D;  1F77 A;  3DVG Y;  4HK2 A;  3FKY A;  2N7D A;  4FSO A;  4O4X A;  4CHK A;  3PGU A;  3TBL D;  4AYN A;  1P4T A;  1ZHW A;  3POU A;  4F8C B;  2KXP A;  3L13 A;  3H6N A;  2ZCC A;  2M06 A;  4P7I A;  2BB5 A;  2LAS A;  4HKQ A;  3C8Y A;  1YJI A;  3IVF A;  4BAX A;  1L0X B;  4KKI A;  1YN3 A;  2MH7 A;  5C1Z A;  1WJ4 A;  5JHA A;  2GE4 A;  4WIP A;  1SEB D;  1WX9 A;  1PGA A;  1SJE D;  1WXA A;  2X8X X;  3ZLZ A;  4GXB A;  2N9K A;  3ZXR A;  1UD7 A;  3UQA A;  2IGH A;  4NAW B;  1I4R A;  2XNA C;  2YEP F;  3W9C B;  2MBE A;  2D11 A;  3W1S C;  4LLG M;  4QQ1 A;  3KUZ A;  2JX5 A;  1JRP A;  1I35 A;  4LNN A;  3HOL A;  3JCU O;  5D5D A;  1R7S A;  4MGZ E;  2JZ3 B;  1SB3 C;  2WXM A;  2TSS A;  3ZNH B;  2PKO A;  2WLB A;  4KZC A;  2C5L C;  4AYE C;  2V4I B;  5CHV C;  4GLS C;  3GP7 A;  1T0Y A;  2KMM A;  2JMM A;  1TJE A;  4W9C A;  2WDT B;  3E56 A;  3PT2 B;  2Y0K A;  4PT5 A;  3N9Y C;  1H8C A;  2FGR A;  1MFW A;  3SU8 X;  4FZL A;  2K6Q A;  1TT5 B;  1HZ5 A;  3ZRF A;  5TR5 A;  1V2Y A;  3IT4 B;  4WJN A;  4GCS A;  3PQS A;  1VDV A;  2D3A A;  4IOI E;  4DXG A;  4GCP A;  1KLG D;  3ALB A;  2BF8 B;  4F4B A;  3IFW B;  2OHF A;  4GCQ A;  2N9L A;  1T3Q A;  4OVZ A;  4AKR A;  4BKS D;  4PUX A;  1R4M B;  1ZOY B;  2EMS A;  3D32 A;  3VVW B;  1TS5 A;  4M02 A;  3LK4 2;  5L83 A;  4WH4 A;  3LXF A;  3WAL A;  4A3P A;  1FM0 D;  2BKR B;  2FCM A;  2XE1 A;  3RNF C;  2CHX A;  1DOI A;  4FSP A;  2KMA A;  4WQO B;  1E10 A;  2KZ7 A;  1EF5 A;  2DLB A;  2EMT A;  1YX6 B;  3MJ5 A;  1PDX A;  3AB5 A;  4XC2 A;  1L7Y A;  2LVP A;  4PS8 A;  3V05 A;  3QRC A;  1T0R C;  2MJD A;  4XDC A;  1T5X D;  4DHZ E;  2N2L A;  5T8I A;  4HPP A;  2FCS A;  4KGS A;  3EEC A;  3QWZ B;  1C4C A;  4AJW A;  3APC A;  2OOB B;  3J9C A;  3SYS A;  2CJO A;  2FE8 A;  2BB6 A;  4IM0 A;  1WX8 A;  5DPR A;  4ZRK A;  3V3X A;  5AUI A;  1SE2 A;  1KJT A;  1HA5 A;  2K8B A;  1CK1 A;  4NAM A;  4DXA B;  4ICV A;  4IC7 B;  4E3C A;  4HDO A;  1V5T A;  2Z59 B;  3SR6 A;  1R4N B;  4RL9 A;  2DHZ A;  1EO6 A;  1ENF A;  1GFN A;  4N58 A;  1D4B A;  2J1N A;  1C78 A;  4II2 B;  2IGG A;  4ZDV A;  1ET6 A;  2Y5P A;  1K51 A;  5JZE B;  3T9L A;  4XNK A;  3RNA C;  1OEY A;  2KX0 A;  1SE9 A;  2NBV B;  2R4P A;  2LJI A;  1VZ8 A;  2XBB C;  5PRN A;  4C7Z A;  4WUR A;  3AA1 A;  1RFK A;  4FES A;  1MM5 A;  2JY6 A;  5IOI A;  2WHI A;  1GUA B;  2ICI A;  4NJ6 A;  3NZ3 A;  2FBW B;  1WH3 A;  1C76 A;  4HWI B;  3CSF A;  3WIM A;  1Q10 A;  4GSW A;  4IWO A;  5G55 A;  5AZH A;  4II3 B;  5J17 A;  3H7P B;  3BVZ A;  5D6J B;  1V9J A;  2MP2 B;  5LXI B;  3FIL A;  3SY9 A;  2INC C;  4LNO A;  4MGK E;  2MW5 A;  4AP4 C;  5GV0 A;  3V8U A;  1MPF A;  2BW2 A;  2LEK A;  2MX2 A;  3DHH C;  3VRB B;  2M0A A;  1UEL A;  2RDB C;  3B9J A;  4KV2 A;  1FO4 A;  3HM6 X;  1CQV A;  2CU3 A;  4ANV A;  4LSH A;  2MNH A;  4PK1 A;  3PPA A;  4MDK E;  1THQ A;  2DZK A;  5C3J B;  1MI0 A;  4K1R B;  1FPY A;  5FKA C;  1PRN A;  4D64 A;  2PW9 A;  3TEZ A;  2AX5 A;  3N1Y C;  1BT9 A;  3IAM 1;  5CX3 A;  1HXX A;  3ZDT A;  3POX A;  4EFO A;  5EE9 A;  3VTV A;  4MH8 A;  1AWD A;  2IND C;  3SYB A;  1HEZ E;  3NY5 A;  3VXW A;  3NG0 A;  4FHJ A;  5G26 A;  3DWO X;  1CZP A;  3AEB B;  1HQR D;  3BRZ A;  4AKM A;  1AN8 A;  1GG3 A;  4JL9 A;  4O49 A;  2LWP A;  4IM3 A;  5E6O A;  2KDY A;  5BYR A;  4ICU A;  3TSS A;  1SF0 A;  2INP E;  2WX0 A;  3DWN A;  1Q0W B;  3DOW A;  2J7Q B;  3A0H O;  2C60 A;  4X57 B;  1E8Y A;  4JPS A;  3CF6 E;  4HKZ E;  3P63 A;  2W9N A;  4M01 A;  3G7G A;  3SZD A;  4OZA A;  1DOX A;  2AXT O;  1OGW A;  4GDK B;  5AZG A;  2ZVN A;  4TSS A;  3TEY A;  1FNV A;  2JT4 B;  1QLB B;  2KZR A;  1S3S G;  3KVD D;  2PJH A;  4LSF A;  3UPG A;  4B61 A;  4HEA 1;  2O6V A;  4IG7 B;  4EOY A;  2WDR B;  2DZJ A;  5TIS O;  1F52 A;  3PZ7 A;  3VAW A;  1GFO A;  1WYW B;  3V62 A;  2C7N B;  2FUG 1;  1ORM A;  1D5X C;  4YTP B;  1AW7 A;  1PYW D;  4AOF A;  3NZU A;  2GRI A;  4FZM A;  1YNT E;  2M4N A;  4LJP B;  1QJP A;  4M0W B;  1MJD A;  4D5U A;  1F0Z A;  3ABV B;  3DDC B;  1LGR A;  3AEA B;  5JXV A;  3ZTD A;  4ZOH C;  2C7H A;  2M56 B;  4W9K A;  1R4M I;  4BBN F;  3X23 A;  1V49 A;  1T16 A;  1TKG A;  4N74 A;  1MM4 A;  3VE1 A;  2KAJ A;  1V5O A;  4XX5 A;  1L0V B;  2MHL A;  4E1S A;  1STE A;  1UNS A;  1AAR A;  3NRZ A;  1L6U A;  4I6L B;  1Q9G A;  4W9I A;  4DHJ B;  5G5H A;  5HFY A;  1VJK A;  2Y0H A;  2Y3A A;  1A70 A;  2L52 A;  3PRN A;  4KX6 B;  1WR1 A;  3ZNI D;  2D10 A;  3W5U B;  5D94 A;  4DHJ D;  1HE8 A;  2QSD A;  3AI5 A;  2FCN A;  4GOC A;  4ITK A;  4JFB A;  3I5J C;  2AL6 A;  2JQR B;  3WCQ A;  1SXT A;  3HOE A;  2GMI C;  3PO0 A;  1IBX B;  1OTR B;  1QOG A;  4LNI A;  1R4N I;  4XGA B;  1XEE A;  2K8C A;  2W3S A;  3HUI A;  5EE2 A;  1WIA A;  2J0M A;  3K9P B;  4OVU A;  3TL5 A;  3VUX A;  3SHQ A;  4JWU C;  5L95 C;  4GMV A;  4O3X B;  4OZB A;  3AV8 A;  3PF1 A; 
#chains in the Genus database with same CATH homology
 2X8X X;  4QAY A;  3NJT A;  4N75 A;  3OG5 A;  3Q6B A;  4C4V B;  3EFC A;  4C4V A;  2V9H A;  3MC8 A;  4K3C A;  4N74 A;  2VH1 A;  4XGA B;  4C00 A;  4PK1 A;  2VH2 A;  2MHJ A;  4BZA A;  3MC9 A;  4K3B A;  2QCZ A;  2QDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...