4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
4N74A 2QDFA 2X8XX 2VH2A 4K3CA 2V9HA 2MHJA 4C4VB 4C4VA 4PK1A 4C00A 3Q6BA 4QAYA 3OG5A 3MC8A 2VH1A 3EFCA 3NJTA 4N75A 2QCZA 4BZAA 3MC9A 4K3BA 4XGAB
chains in the Genus database with same CATH superfamily
5KAIO 5AFUK 2FAZA 4HDQA 2JZZA 4FOZA 2R61A 3Q3MC 2JVCA 5D3DA 2R89A 2KTRB 4RMAA 2KNBA 3QRAA 2G3QB 2MRPA 5FVNA 2J1NA 4GLSC 2WVPA 1EM7A 3LYYA 3AB5A 1F0ZA 4HWIB 1KH0A 1WXSA 5PRNA 1SE2A 3NZ3A 2G4SA 1FCLA 3A9KB 2RDGA 3PLUA 2BYTA 4NNJB 1PYWD 3FC4A 1D5ZC 1R7SA 2KC0A 2OHFA 1FO4A 2C60A 4ZHPA 2BYVE 3KZIO 2WXKA 1K8RB 4WWOA 5FR6A 1WR6E 2XEWA 2DZJA 1NVID 3TIXA 3DHHC 1FFUA 1UGMA 2KANA 2LASA 1GG3A 3SDLC 4QQ1A 1CJEA 1FRDA 2FCSA 1J7CA 4E1SA 2M06A 3RNFC 4PS8A 2BVCA 1WX9A 2LRWA 3E56A 5BMGA 3P1MA 5GV0A 2D11A 2LGYA 2KZRA 2XTRA 2PJHA 4N74A 3UU2A 3AA1B 1SGHA 3LJ3A 3QHTA 2X9KA 3EECA 2B3AA 3HK0A 4US8A 3WCQA 1FD6A 3GP7A 4C56C 4G76A 3LK42 4ZRIA 2XE2A 3NS8A 4G11A 4XC2A 1JWMD 1HZ6A 1VRAB 5H8YE 3ZW3A 2DAJA 3OJ4B 1MG4A 3AA7B 3KUDB 3IBEA 5JZEB 2V4LA 5KHQA 2ZW0A 1TYGB 3AEGB 1SXTA 2WDVB 3BIID 4OVUA 3LK2A 4URKA 2C5LC 4Z3TA 1KLGD 1E8ZA 4OVVA 4KDIC 2XE5A 3EC8A 3AV8A 3I9V1 4WJPA 2IO0B 5CHFA 1L6UA 2KDFB 4IUMB 3A1QA 3VUYA 2MBOA 2YNKA 2KFKA 4PYZA 1WJ6A 2K39A 4PK1A 4W9CA 4JWSC 1F52A 2KQ7A 3WANA 1OEYJ 4UB6O 5IAAC 3CF6E 3AULA 1PUTA 5E6PA 3ALBA 2QCZA 2CJNA 3SEBA 1N62A 2QIEB 3AN1A 5DCNA 3ZTCA 1IGCA 1RM6C 5LXIB 3LK3A 2MW5A 3N1ZC 3QX1A 1ZUD2 5BO4B 3NUHB 1I4GA 3DBLI 2KDYA 1TY2A 3V6EB 2RSUA 5L95C 2D07B 4ACFA 2J52A 1YOVB 4C7ZA 2INPE 1SB3C 1P3QU 3V8UA 3KWLA 1SIJA 4IOIE 2KN4A 1GFMA 1YJ1A 2K3UA 4HROA 2DYMA 3PREA 5TR5A 1VD2A 5EE3A 2BQQA 4JE3B 2ZNVB 2YEPB 2MX2A 2WQYB 1LXDA 2PVOD 5FK9C 4BZAA 4HJGE 4YXDB 2Q5WD 1L4DB 3LK2B 1H6S1 2LXCA 3MHSD 2DZMA 5JHAA 2KOXA 4HLEA 3B1LX 2BTEA 1RFKA 3Q3NC 2HJ8A 4LNFA 4YTNB 1PFDA 1Q1OA 1WSPA 2N7EA 1R4MB 3QIJA 1G90A 2DX5B 4IDIA 4KZCA 1C3TA 2R88A 4CTDA 1LFDA 4E74A 4GGQA 2J4XA 3TEYA 3VZWX 1ZHTA 2CU3A 4B6WA 3TEWA 1HZ5A 1BUIC 1ROEA 2KO3A 4I6NB 3Q2AC 2WXGA 3PV1A 1XLOA 1YN4A 3DHGC 4K7SA 1C78A 3HUIA 1NYQA 3IXSA 3VTWA 1GFNA 1K53A 2WXRA 2MQJA 1UNSA 2NS5A 3RFZB 3BZDB 1H8CA 3KQ4A 1YIWA 2EMSA 1VR9A 3AECB 3VY9X 2M1MA 1YQ3B 4PJ0O 3HOLA 3QCAA 3NJTA 3VDZA 1ZPSA 5DL5A 1PGBA 1ESFA 1QJPA 3N9YC 3WALA 2MSED 4A6QA 2IYDB 3C19A 2K9XA 1DOXA 5D6JB 1TY0A 4NJ6A 2GLSA 2M4NA 1EF1A 3V05A 4WIPA 2X27X 1T0RC 3B2FA 1JRPA 2MP2A 1ZHYA 5HG2A 2WXNA 5B66O 1PGXA 5TSSA 3SZVA 4A9AA 3O13A 1P98A 1V1PB 3B9JA 4RNAA 3AA7A 3D32A 3QK0A 3ZIMA 3HM3A 2JMMA 2AWTA 3IFWB 4O3XB 2R2OA 4KSKC 2IBIB 2K22A 4JGHB 3PO0A 3RI7C 2GBJA 4YT0B 3AAEB 3RNAC 2KDMA 1EF5A 2LWPA 5DPRA 1RYJA 3W5VB 3WAPA 2FUHB 3L10B 5BYQA 3PHWB 2L0TA 3P42A 2NBWB 3BK2A 2WXMA 1L6VA 2KT7A 4FRXA 2J53A 4W9HA 2N7DA 4HXDA 3VFKA 2I2YA 3PVLA 1E7VA 2M19A 3U8ZA 4G75A 2MHJA 4AJWA 3JYUA 1QKZA 2MBHA 4W9DA 4PUXA 3AA1A 1U4AA 3QJZA 2QHOA 2SAKA 3HM6X 4ANXA 2BB6A 1XCQL 1UD7A 1SSNA 3VTUA 2Z0EB 3DVGX 4F1SA 2V3PA 3AE3B 3A1QB 1MM4A 1OGWA 1YX6B 4XNLA 4RCOA 1T6BX 2KVZA 4DQOC 1JWSD 1WGRA 1VLBA 3X23A 2R2QA 2JXXA 3OJ3A 4IM0A 1NYRA 3S2AA 2X38A 3A4RA 3GZNB 4FRTA 2YVCA 2BWES 1YN5A 2J0MA 2K6DB 2RDHA 3P2BA 1E10A 2Y0KA 5IN7A 4NAMA 2W3SA 4LK0M 4MACA 1TS3A 2WXHA 4LNOA 3RPFC 3TSSA 5EDSA 1V81A 2K6QA 1WF9A 1DOIA 1JALA 2O2VA 3AEBB 4ASWC 4YWGG 3U7ZA 1SJED 2F1TA 3UPGA 4FUVA 4NQKE 1JCKB 1WX7A 2KJRA 4ZHOA 2FBWB 2WDQB 4FJZA 2HTHA 3RNBC 2W3RA 3L54A 1UF0A 3CWIA 1YS5A 4E3CA 4FA6A 1JWUD 1BXTA 2ASQA 2YEPF 2CJOA 4MH8A 1Q9GA 3POQA 4DHJD 2XBBC 2DYBA 3UF8A 4AYMC 3FYXA 2VH1A 3R8BA 4IW0A 2ZLDA 4C80A 1XT9B 3MC0B 4A55A 4B9KA 2NR2A 4CHKA 2I1KA 3DA3A 4OHJA 3AA6B 2KLCA 3ZJUA 2WYQA 3VR8B 4AKMA 5AZHA 4W9JA 2CHWA 3TCAA 1ZP0B 1WJ4A 4JLCA 3EFCA 4II3B 2KTRA 1XO3A 4LSHA 1UBQA 4DHZE 3SFEB 3Q69A 4EZJA 2CHZA 5GTIO 1KF6B 3LB8C 1E8YA 3PGEA 3A4SC 2J42A 3AE2B 2KTFA 3SU8X 4LNNA 3BY4B 4L1BA 5AFUL 1A70A 2A5UA 1FPYA 4MELA 4TV3A 1N5XA 2GBRA 1TT5B 5E6NA 4FSOA 4U9CA 1E7PB 3KH0A 1FXIA 2BWFA 1PHOA 1T16A 2PORA 1MM5A 2C7HA 1NEKB 2JT4B 4FZLA 3HOEA 1C79A 2OMFA 2DBYA 2J0KA 2KAJA 3P4RB 2ZVNA 2VZKB 2MBEA 4HRSA 1WXMA 3DBHB 3RN9C 3TZGA 1KRHA 3Q8EA 2M8SA 1V1PA 1ZHZA 1A5RA 3WAOA 1GFPA 1V97A 4NJ7A 4N58A 4WJNA 2XE1A 2L8JA 2N9KA 4IWQA 3GE8C 4E1TA 3RMKC 4WH4A 3N20C 3AAEA 4G50A 3L13A 2MHLA 4II2B 2L52A 3UAQA 2KMAA 4AYNA 1L2NA 2ZPNA 5G2NA 1ZGUB 4FESA 1JWAD 3R7RA 2JQRB 2JZ3B 1I4HA 1P1AA 2M0AA 2PIAA 1JRUA 4DXAB 4CQNA 4FMSA 1ACCA 2E6XA 3NOBA 2RPQA 1HA5A 3ABVB 2IGDA 3AI5A 3RUIB 1C76A 1S5LO 2JYTA 3T3OA 2N1VA 2AXTO 3JSVB 4FJYA 3IHPC 4OZBA 5ADXL 2WWZA 3P4QB 4WAFA 3NZUA 2YLMA 1ZKHA 3ZO5B 4LJPB 1AWDA 3TBLD 2CU1A 3RD2A 4BUMX 3NY5A 2ICIA 3X0WA 5IKCM 1EU3A 4O3YA 2LUEA 5BMHA 2ERVA 1V2YA 4IL6O 3TEZA 4YL8A 4MGYE 2KK8A 4EUTA 3PPAA 1YJJA 3IAS1 3DHIC 1I4RA 3EGRA 2LHEA 2WX0A 5D7GA 4MEMA 2KX0A 5E6JA 3C5OA 3DQVA 1QZEA 1HXUA 2K0LA 3SYSA 2WXQA 4XDCA 3Q8BA 4WWNA 4PYUA 1B9RA 5HI1A 5LNK1 1HXXA 1KFYB 2I1JA 3ZLZA 1QOGA 3AE7B 1RAXA 2KACA 4PR7A 3VE2A 1GFQA 1Q0WB 2KMMA 3DPDA 3DBRB 2O6VB 2PTLA 6PRNA 3WI5A 2V1YA 3HVDA 3LXFA 3P4SB 4K3BA 2LHDA 4P6VF 1L7YA 4RLBA 1WE7A 1XF5L 4YSXB 2VH2A 1GC6A 4RLCA 4IM3A 3RYTA 1TZOA 4YSZB 5G26A 3ZUNA 2W80C 1NENB 3ZJTA 5IP4D 3PGSA 2GE4A 4JIOU 2L76A 2LUMA 3O0EA 2NCNA 3SY7A 1L0VB 2RD0A 3DWOX 3KYCD 4A90A 1RWSA 1B1ZA 3EA6A 4JQWC 3DWMA 2HJ1A 4ICUA 2YPVA 1JWBD 1RLFA 2RR9A 3DWNA 3ONSA 4ZDVA 4HDOA 1OPFA 5IO9A 3MTNB 3Q8AA 1STEA 3RNCC 1E90A 4FLHA 2G9HD 3AAAB 1UELA 5EE1A 2ZNVC 5EE9A 3ZNHB 1TKGA 3SD5A 4ZYSA 4MSMB 5J17A 4JCHA 4JPSA 5JDPA 1V9JA 5BYSA 4IC7B 3R3MA 2M56B 1WE6A 1SBBB 4XZ4A 1WMHA 3ZRCA 4I6LB 4KRAA 5C3JB 3AA6A 1MHXA 5DL8A 2GMIC 4KDLB 2N9EB 2D5GA 1TBEA 3C0RB 3U52E 5GMVA 2RDBC 1D4BA 3EUB2 4TQ1A 1WZ3A 2MWSB 2N2LA 2K4TA 2Z8LA 3PZ7A 2Y5PA 2W55A 1XQQA 2L83A 2KWDA 3SR6A 1E7UA 3AMZA 3AAAA 3KVFB 3SZDA 4CO7A 2LD9A 4NY0A 2DYOA 3Q8CA 1FM0D 2INDC 5FKAC 1VZ6A 1C1YB 1PQSA 3SYBA 1QF6A 4MJSB 2V9HA 2PE9A 2QC8A 1IPGA 1D5XC 3BS0A 4GMVA 1CQVA 2GBKA 1IZNB 1D5MC 4E71A 5D3IB 2MBQA 3PQUA 3AH7A 4OW0A 2KVRA 1F77A 1YMHE 3BVZA 1N60A 4XGAB 2V4IB 4RL9A 4IWOA 3POXA 1FRRA 1DOYA 1SEBD 2IPKD 1PDXA 1GUAB 2IO3B 1FNWA 4BKGA 4M8NA 2ZVOA 4MGKE 3QQ8B 2N9LA 3V61A 1TTNA 3NS1A 3IT6B 1V86A 4DDGD 3B2GA 4FN2A 2QSDA 2DENB 5LLIA 1XCTL 1LO5D 2IWWA 1XLQA 4X57B 3PSEB 1IBXB 3AEFB 5CTRC 1N61A 2IO2B 4MGZE 2D3GA 4W9GA 3ZTDA 1XD3B 1IUEA 1FIQA 2PLPA 1L0YB 2G45B 3TMPB 5G39A 1F2RC 5BYRA 3ENEA 4A8XC 4O3ZA 1EO6A 2JSVX 5ADXK 2W82A 1FCCC 2LGSA 2LFIA 4EZLA 3N30A 4NQLB 5J18A 1V5TA 3I3TB 4A20A 2WDRB 2LGDA 3OWEB 3RULA 1P4TA 1Z2MA 2D2QA 3T24A 4ICVA 4DWFA 1R4MI 1ZHWA 2JU6X 1IZNA 3VZTX 3BVGA 5HKHA 2FCMA 3BYTB 3UQBA 2ZW1A 3GE3C 5KAFO 4AJYB 1FFVA 3PZ8A 2B76B 4IKGA 4YSYB 2W81C 2LXAA 3VZUX 5C2TB 4O4UA 2PMVA 3L0WB 2UWQA 4LJOB 4P1CC 1HTOA 4GDKA 2K0PA 1Y8RC 1Y56A 3HVZA 4DXGA 3AEEB 4XDDA 2FUG1 2W54A 1TKYA 3L16A 4RH6A 3ZXVA 4C7YA 4LNKA 4ARCA 5AZFA 5L83A 2ZZPB 1QOAA 2KDEB 1JQ4A 3ECIA 4BOZB 4MSQB 3BRZA 2KQSA 2WHIA 4B61A 3VXWA 2QTKA 4WWPA 2MEKA 3IAM1 3PT2B 3WIMA 2N9XA 1V80A 4AOFA 3NSGA 3V3XA 4O49A 4C00A 3JVZX 4JFBA 1QILA 5AEKB 5HHDG 3Q8FA 3H7PB 4MJSA 2KC2A 1UUPA 4WQOB 3CSTA 4LCDE 4FQEA 3PGRA 3K9PB 2LGXA 1V6EA 2JY6A 1C4PA 3ZNID 2MP2B 2NBUA 3NG0A 5FR3A 2OJRA 3SHQA 1F2RI 2BBCA 4XWTA 1E5WA 2BGFA 2L3ZA 3DVNV 2KWUB 1MPFA 1Q9FA 1EUVB 3BK1A 4FHJA 1K51A 2IZVB 1QQRA 1WJUA 1T0YA 1N63A 4GDKB 2MJEA 4CYEA 2KFJA 1MJDA 3T8MA 3DBHI 4M8MA 4J6IA 4GCSA 2K25A 3CMMB 1GPXA 2XN9C 3MJ5A 3R2IA 1TS2A 2NTSA 4AQ7A 1PRNA 2AQ2B 3AE1B 2LVQA 2C7NB 3RT3B 2ZEQA 1VCBA 3ZXRA 1ZDXA 3W1SA 2BKRB 1LM8B 2DNFA 3H8HA 3VR9B 4GHBA 3QARA 1ZW7A 3FILB 3NVWA 4AKRB 4HCNB 3HIZA 3ZJVA 4HKQA 4QAYA 4HEA1 1ORMA 4TMAB 4KKJA 1XLNA 3TJPA 3RCZA 2XMXA 1BMLC 4MGIE 3PS6A 1JROA 2RPVA 3AE8B 2INCC 1FXTB 4ZRKA 1S1QB 5JHBA 2WX1A 3VUXA 1E6EB 2DZKA 1WGDA 4DBGA 3DOWA 1WGKA 2O4VA 3KWVA 3G7GA 4TUUA 3WA0A 2J0JA 4L2YA 4AWJA 1I4XA 2LGIA 4JWUC 1I4QA 3AE9B 4NZLB 2CKHB 3VUWA 4M01A 1S3SG 4G3XB 1F1HA 2DWQA 3RBHA 2Y2XA 1WY8A 4K81A 4XYCA 4ZOHC 3E9SA 3RNEC 2KDBA 2M0XA 3PQSA 1P7EA 3RZWC 2LZ6A 1V49A 2W9NA 2K8CA 1QJ9A 1V8CA 1UWMA 1YN3A 5MPOA 4J3OD 3ZNZB 4D5UA 2PW9A 4K7UA 1C9FA 2F1VA 3ZGZA 3H7SA 4KGTA 3PORA 5DL7A 3N3KB 3ZNGC 2QDFA 3PF1A 2KWVB 2KXPA 4GU2A 3BVMA 1E8XA 3V60A 1Z5SB 3M62B 2WU2B 1T0SC 1V1OA 1WGGA 4FADA 3VE1A 2MJ3A 2GRIA 3APDA 1KOTA 2O6VD 3J9CA 2LMCA 4HK2A 2WXOA 3ZKJC 1GB4A 1SE3A 1BT0A 4H2AA 2NPTB 5JH5C 1LQBA 1ZOYB 2WJRA 4M0WB 2LJ5A 5G38A 1WXVA 2ZCBA 5D2MB 1J7AA 3BWUD 3ZDMC 4D64A 3M63B 3W1YA 3FAHA 2AL3A 5D5DA 2EKEC 4KR8A 1MI0A 3L4PA 4NJCA 4F7ZA 1HTQA 3AA0A 3AEDB 1KLUD 4HPPA 2QEJC 5E6OA 1GJZA 3SY9A 3AM9A 2IDYA 3JTYA 1JMLA 4DDID 4BKTA 1WWTA 4GB9A 2JRHA 3RNGC 5DL6A 3K19A 4ANWA 4FHKA 1L0XB 4B0MA 2LFUA 3Q6BA 1SE4A 4K1RB 2RMMA 2GB1A 2LVOA 3T3NA 2PKOA 2PE6B 3IT4B 2LRUA 2KXJA 3AE4B 2G1EA 3R2TA 4FXCA 4ZYNA 3VH3B 4ARIA 3GP6A 4R3DA 2J7QB 3CIRB 4GN1A 1I42A 3NVYA 4RM9A 1BT9A 3MFGA 1TJEA 1RRBA 3VY8X 4KIKA 2ODJA 3LK3B 2I38A 4OVZA 4B95A 2L0FA 2CR5A 4I6PA 4IM2A 1T1LA 3KUCB 4AKRA 2LVPA 3A0BO 3OLMD 4LNIA 3T20A 3A2SX 3AU5A 3Q3FA 2QJLA 3DWGC 3DA4A 4AUQC 4TQ0A 1ZHXA 1GOZA 2JQYA 4RJXA 4XWWA 4M0WA 3AEAB 5BMIA 4C4VA 2OJWA 3NHEB 4LSFA 1N5WA 4LSIA 1XEEA 1I35A 4XE0A 1OFFA 3C8YA 4D2KA 2BYFA 4KGSA 1DYQA 2EMTA 3A9JB 3TL5A 1E9MA 2MA9B 2AX5A 5T8IA 4S0RA 4DHZB 2WDTB 1IP9A 4BFRA 1P9DU 1YJIA 1THQA 1NDDA 1D3ZA 4RGNA 4ANVA 1YNTE 4KZ0A 2R8AA 2WNMA 3FILA 4M00A 4AS1A 2XG6A 4PT5A 1MHHE 2AQ3B 3PRPB 4MM3B 1E8WA 4MT5A 1K52A 1VZ7A 3APCA 1HXYD 1M4VA 2R4PA 1C77A 4FZNA 1VJKA 4KSLC 4YTMB 2JF5A 1WZ0A 5B5EO 4BKSA 3MP9A 5C1ZA 2AQ1B 2A4ZA 1TGZB 4RJWA 3GZNI 4DXFA 1IGDA 4BVUC 4P16A 3V6CB 4LDTD 1H4RA 3IG3A 2MNHA 3GOEA 4C4VB 2BW2A 2QILA 3DZMA 2PVGC 3NVZA 2GI9A 3M95A 4IWPA 2JWZA 2Y3AA 4O4XA 2KHWB 4KGRA 3Q3JA 4BBNC 2EKIA 4WURA 1J19A 3PRZA 1R4NI 4AZLA 2CS4A 3PRMB 1OQQA 4EZKA 1EWYC 2JRIB 1Q5WB 3I57A 4N75A 2V0GA 4FZMA 1HXTA 3FKYA 1C4AA 2IO1B 1QT9A 3KW5B 4M02A 4EEWA 4AP4C 3MJWA 1OTRB 5IOIA 1AARA 2Y0HA 4W9FA 4DHJB 1P7FA 1ZXHA 3EFUA 1MVKA 4FULA 1X1MA 5G5GA 2D10A 1LGRA 2IWVA 1AYFA 3Q3OC 1XLPA 3DBLB 2M07A 4GIVA 3KLSX 1HEZE 4F4BA 2ZJDA 2N2MA 3ZQ4A 3B08A 4N9F4 2BB5A 4EOYA 1UBIA 5DPTA 2KZ7A 3LDZE 2NTTA 4HVBA 4ZRQA 3W5UB 3HW9A 3PHXB 2WXLA 3QC8B 2UYZB 3QAQA 4XX5A 4N59A 1TKEA 2JWUA 3DBRI 1QJ8A 2MBBB 2VRRB 3M3JA 3R66C 4RGMA 2BS2B 3WI4A 4HKZE 4LLGM 1C4CA 1WYGA 5CHVC 8PRNA 2BS3B 1XXGA 1UGJA 2M17A 4LDTB 1IYFA 1D6EC 3POUA 3I5JC 1WFYA 1TS4A 4WWMA 4YTPB 3VHTC 2N4FA 4KIKB 1ISNA 2O2VB 3PRNA 1WMHB 4K7WA 1GAQB 2QMTA 1FXAA 4W9KA 1ZE3D 3ZYYX 2J4UP 3H6NA 4WJOA 2FCQA 1ET6A 4C69X 4TKNA 2MCNB 4UB8O 5KHOA 3MHZA 2KLGA 5G3AA 1BH3A 1J7BA 2Z59B 1K50A 3L08A 5IA7A 1HE8A 1TS5A 1OEYA 2LI5A 2X8XX 3H7PA 1QOFA 2O6VA 1J0GA 4WQMA 4WAAA 1E0ZA 3KUZA 4GXBA 3H1UA 2ZFGA 4BOSC 4AFKA 2NVUI 1MFWA 1EU4A 2N0SB 1SJHD 1OQYA 2L05A 5AUIA 2KQ4X 2ZCCA 3ML8A 4S17A 1VZ8A 3VAWA 4USAA 4L23A 2WLBA 2XNAC 5E79O 3HWBA 4A3OA 2ZPYA 4AYEC 2EELA 2FGRA 2OEDA 3GS2A 4IG7B 3WAMA 3AE5B 2DZIA 3MC8A 2MH7A 2Y5BB 4W9IA 1NI2A 2PPHA 3DBSA 4GCQA 2JXTA 4FBJB 1OSMA 3A9KA 3SFDB 1VDVA 4RM8A 4REZA 2NBVB 4AUIA 2TSSA 5C23A 4NAWB 2PRNA 4EKUA 3QRCA 2Y7SA 4WJQA 1R4NB 4P1BC 2DLBA 2XK5B 4HPMB 3VQIA 1YX5B 5DPSA 2FCNA 1SF0A 2WXFA 4NAWA 3NRZA 2DAFA 2KX3A 2KC1A 5G55A 3EHVA 2BYEA 3BINA 1IBXA 5D94A 2JYEA 4RGOS 3HHMA 3QWZB 2K1FA 2OOBB 1OQRA 4ITKA 3W1SC 4GF4A 2JX5A 1GNUA 3VTVA 4HCPB 1DGJA 2KDIA 4KV2A 3UIPB 3AA0B 3RZFA 2INNE 1QOBA 1YD8U 3P4PB 2BS4B 2L32A 5HFYA 3URYA 4ZRJA 3VRBB 3BRYA 1FNUA 2WP9B 2KJHB 1NBFC 2KZ7B 4XNKA 1UH6A 2WS3B 4JX1C 2XTQA 1AN8A 5H2FO 2K8BA 2N7JA 2N9PC 4GDLA 2WXIA 4ANUA 3T0SA 1J8CA 3ML9A 7PRNA 3APFA 4LSEA 2WXPA 2E3TA 4GDLB 2KD0A 3V62A 3T9LA 4UDUC 4NPNA 4Q2JA 1ENFA 4K3CA 4OZCA 2VZKD 3VH4B 1N6ZA 3KYDD 3UIOB 2HTME 1JW9D 4KKIA 1KM7A 4AYID 3CSFA 1WIAA 2REXA 4D65A 1WRIA 3PLVA 2KKCA 1L5PA 1YQBA 5I4DA 1GFOA 1ZDVA 1BXWA 3UI3A 3N1YC 2BT6A 3JCUO 2C7MB 4TSSA 3DDCB 3Q14C 2IGHA 5AZGA 1WM2A 2N1WA 2C9WB 3KVDD 2LJIA 3BYYB 2BPSA 5EE2A 1KLVA 2D3CA 3H9DA 2KWCA 2K8HA 1WH3A 1M94A 1WXAA 1GC7A 4RF0A 4PS3A 4G0NB 2JZPA 3A9JA 2Y5CA 5LXHA 1WXQA 3NVVA 3A33B 3JSVA 4N6EB 4A3PA 4KR4A 3K9OB 1UZXB 1AW7A 3ZVVA 3W2DA 2HD5B 1FNVA 3A0HO 1F9JA 2IJ0A 4MM3A 2K5PA 2V3SA 2ON8A 4OZAA 2LHFA 2IY1B 1EWCA 3VRAB 3B0AA 2FNJB 1E54A 3WU2O 2G4DB 1WM3A 1QLBB 3PZDA 4RGTA 3HRDD 2AL6A 5EE0A 5GTHO 2ACZB 4KX6B 2D3AA 1FMAD 1T0QC 2Z0DB 1L4ZB 5CHWA 3DCGA 3OAWA 3OG5A 4FJVB 3U30A 3EMNX 5G5HA 3ZDTA 2WJQA 2V3NA 3NZSA 1TIFA 2KMCA 5H92C 2Y0LA 2FIDA 1ZXIA 5CX3A 2BKFA 3UINB 3VVWB 1Q10A 1MPEA 1ET9A 5AUKA 1I4PA 2NPTA 3QA8A 4HJKA 3ZRFA 5GXGB 1WJNA 2KN5A 2JPHA 4LTUA 4FSPA 4RF1A 2L00B 2IY0B 2NMQA 4EE2A 2JUOA 2FGQX 4O3WA 3TEXA 1NI3A 2KFKB 2MJDA 2L1AA 1WI0A 3IVFA 4F8CB 1CK1A 4KVGB 2HDEA 3DVGY 3P63A 4BBNF 3UQAA 2AYOB 2GBMA 1RFAA 1G6JA 1WRDB 1WR1A 2R4LA 3N32A 2R4NA 3JW0X 4BAXA 2RGFA 1YQ4B 4RFBA 5J2RA 1KTKA 3MC9A 5TISO 1WGYA 2F1CX 4GCPA 3TUOA 2GBNA 1V5OA 1CZPA 2XE3A 2MLBA 3AXCA 4P7IA 4GOCA 2FE8A 2GOWA 3AU4A 4BKSD 1MG8A 2CHXA 2WXJA 4US9A 2H89B 4JL9A 4W9EA 1GB1A 4B0EA 5IYUA 1HQRD 3DVNU 1SE9A 3U7DA 2XK5A 4FT6A 1CMXB 2FIFA 1KJTA 3R7QA 3PTFC 1T5XD 3U4EG 2LEKA 2SEBD 3N1XC 4EFOA 2UU7A 3PGUA 1WX8A 5T5FA 3ETRA 1P0RA 2WU5B 3L17A 1T3QA 2BF8B 4MDKE 4W9LA 1WGHA 4AYDC 4DK5A 2HE7A 4ZRPA 2L7RA 4PS7A 2IGGA 3LK41 1I7HA 2KXPB 4O1NA 1TZ1A 1FEHA 2ONQA 4MH0E 3O65B 2H88B 2R4OA 3GB1A 3I63C 3AE6B 4HPLB 2AEHA 3W9CB 1UWXA 5JXVA 3U2SC 2DHZA 2D3BA 1WYWB 2KJ6A 3UGBB 2WGSA 1SIFA 2KYWA 5DPWA 2PEAA 1PGAA 4GSWA
chains in the Genus database with same CATH topology
4N74A 2QDFA 2X8XX 2VH2A 4K3CA 2V9HA 2MHJA 4C4VB 4C4VA 4PK1A 4C00A 3Q6BA 4QAYA 3OG5A 3MC8A 2VH1A 3EFCA 3NJTA 4N75A 2QCZA 4BZAA 3MC9A 4K3BA 4XGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N74 A;  2QDF A;  2X8X X;  2VH2 A;  4K3C A;  2V9H A;  2MHJ A;  4C4V B;  4C4V A;  4PK1 A;  4C00 A;  3Q6B A;  4QAY A;  3OG5 A;  3MC8 A;  2VH1 A;  3EFC A;  3NJT A;  4N75 A;  2QCZ A;  4BZA A;  3MC9 A;  4K3B A;  4XGA B; 
#chains in the Genus database with same CATH topology
 5KAI O;  5AFU K;  2FAZ A;  4HDQ A;  2JZZ A;  4FOZ A;  2R61 A;  3Q3M C;  2JVC A;  5D3D A;  2R89 A;  2KTR B;  4RMA A;  2KNB A;  3QRA A;  2G3Q B;  2MRP A;  5FVN A;  2J1N A;  4GLS C;  2WVP A;  1EM7 A;  3LYY A;  3AB5 A;  1F0Z A;  4HWI B;  1KH0 A;  1WXS A;  5PRN A;  1SE2 A;  3NZ3 A;  2G4S A;  1FCL A;  3A9K B;  2RDG A;  3PLU A;  2BYT A;  4NNJ B;  1PYW D;  3FC4 A;  1D5Z C;  1R7S A;  2KC0 A;  2OHF A;  1FO4 A;  2C60 A;  4ZHP A;  2BYV E;  3KZI O;  2WXK A;  1K8R B;  4WWO A;  5FR6 A;  1WR6 E;  2XEW A;  2DZJ A;  1NVI D;  3TIX A;  3DHH C;  1FFU A;  1UGM A;  2KAN A;  2LAS A;  1GG3 A;  3SDL C;  4QQ1 A;  1CJE A;  1FRD A;  2FCS A;  1J7C A;  4E1S A;  2M06 A;  3RNF C;  4PS8 A;  2BVC A;  1WX9 A;  2LRW A;  3E56 A;  5BMG A;  3P1M A;  5GV0 A;  2D11 A;  2LGY A;  2KZR A;  2XTR A;  2PJH A;  4N74 A;  3UU2 A;  3AA1 B;  1SGH A;  3LJ3 A;  3QHT A;  2X9K A;  3EEC A;  2B3A A;  3HK0 A;  4US8 A;  3WCQ A;  1FD6 A;  3GP7 A;  4C56 C;  4G76 A;  3LK4 2;  4ZRI A;  2XE2 A;  3NS8 A;  4G11 A;  4XC2 A;  1JWM D;  1HZ6 A;  1VRA B;  5H8Y E;  3ZW3 A;  2DAJ A;  3OJ4 B;  1MG4 A;  3AA7 B;  3KUD B;  3IBE A;  5JZE B;  2V4L A;  5KHQ A;  2ZW0 A;  1TYG B;  3AEG B;  1SXT A;  2WDV B;  3BII D;  4OVU A;  3LK2 A;  4URK A;  2C5L C;  4Z3T A;  1KLG D;  1E8Z A;  4OVV A;  4KDI C;  2XE5 A;  3EC8 A;  3AV8 A;  3I9V 1;  4WJP A;  2IO0 B;  5CHF A;  1L6U A;  2KDF B;  4IUM B;  3A1Q A;  3VUY A;  2MBO A;  2YNK A;  2KFK A;  4PYZ A;  1WJ6 A;  2K39 A;  4PK1 A;  4W9C A;  4JWS C;  1F52 A;  2KQ7 A;  3WAN A;  1OEY J;  4UB6 O;  5IAA C;  3CF6 E;  3AUL A;  1PUT A;  5E6P A;  3ALB A;  2QCZ A;  2CJN A;  3SEB A;  1N62 A;  2QIE B;  3AN1 A;  5DCN A;  3ZTC A;  1IGC A;  1RM6 C;  5LXI B;  3LK3 A;  2MW5 A;  3N1Z C;  3QX1 A;  1ZUD 2;  5BO4 B;  3NUH B;  1I4G A;  3DBL I;  2KDY A;  1TY2 A;  3V6E B;  2RSU A;  5L95 C;  2D07 B;  4ACF A;  2J52 A;  1YOV B;  4C7Z A;  2INP E;  1SB3 C;  1P3Q U;  3V8U A;  3KWL A;  1SIJ A;  4IOI E;  2KN4 A;  1GFM A;  1YJ1 A;  2K3U A;  4HRO A;  2DYM A;  3PRE A;  5TR5 A;  1VD2 A;  5EE3 A;  2BQQ A;  4JE3 B;  2ZNV B;  2YEP B;  2MX2 A;  2WQY B;  1LXD A;  2PVO D;  5FK9 C;  4BZA A;  4HJG E;  4YXD B;  2Q5W D;  1L4D B;  3LK2 B;  1H6S 1;  2LXC A;  3MHS D;  2DZM A;  5JHA A;  2KOX A;  4HLE A;  3B1L X;  2BTE A;  1RFK A;  3Q3N C;  2HJ8 A;  4LNF A;  4YTN B;  1PFD A;  1Q1O A;  1WSP A;  2N7E A;  1R4M B;  3QIJ A;  1G90 A;  2DX5 B;  4IDI A;  4KZC A;  1C3T A;  2R88 A;  4CTD A;  1LFD A;  4E74 A;  4GGQ A;  2J4X A;  3TEY A;  3VZW X;  1ZHT A;  2CU3 A;  4B6W A;  3TEW A;  1HZ5 A;  1BUI C;  1ROE A;  2KO3 A;  4I6N B;  3Q2A C;  2WXG A;  3PV1 A;  1XLO A;  1YN4 A;  3DHG C;  4K7S A;  1C78 A;  3HUI A;  1NYQ A;  3IXS A;  3VTW A;  1GFN A;  1K53 A;  2WXR A;  2MQJ A;  1UNS A;  2NS5 A;  3RFZ B;  3BZD B;  1H8C A;  3KQ4 A;  1YIW A;  2EMS A;  1VR9 A;  3AEC B;  3VY9 X;  2M1M A;  1YQ3 B;  4PJ0 O;  3HOL A;  3QCA A;  3NJT A;  3VDZ A;  1ZPS A;  5DL5 A;  1PGB A;  1ESF A;  1QJP A;  3N9Y C;  3WAL A;  2MSE D;  4A6Q A;  2IYD B;  3C19 A;  2K9X A;  1DOX A;  5D6J B;  1TY0 A;  4NJ6 A;  2GLS A;  2M4N A;  1EF1 A;  3V05 A;  4WIP A;  2X27 X;  1T0R C;  3B2F A;  1JRP A;  2MP2 A;  1ZHY A;  5HG2 A;  2WXN A;  5B66 O;  1PGX A;  5TSS A;  3SZV A;  4A9A A;  3O13 A;  1P98 A;  1V1P B;  3B9J A;  4RNA A;  3AA7 A;  3D32 A;  3QK0 A;  3ZIM A;  3HM3 A;  2JMM A;  2AWT A;  3IFW B;  4O3X B;  2R2O A;  4KSK C;  2IBI B;  2K22 A;  4JGH B;  3PO0 A;  3RI7 C;  2GBJ A;  4YT0 B;  3AAE B;  3RNA C;  2KDM A;  1EF5 A;  2LWP A;  5DPR A;  1RYJ A;  3W5V B;  3WAP A;  2FUH B;  3L10 B;  5BYQ A;  3PHW B;  2L0T A;  3P42 A;  2NBW B;  3BK2 A;  2WXM A;  1L6V A;  2KT7 A;  4FRX A;  2J53 A;  4W9H A;  2N7D A;  4HXD A;  3VFK A;  2I2Y A;  3PVL A;  1E7V A;  2M19 A;  3U8Z A;  4G75 A;  2MHJ A;  4AJW A;  3JYU A;  1QKZ A;  2MBH A;  4W9D A;  4PUX A;  3AA1 A;  1U4A A;  3QJZ A;  2QHO A;  2SAK A;  3HM6 X;  4ANX A;  2BB6 A;  1XCQ L;  1UD7 A;  1SSN A;  3VTU A;  2Z0E B;  3DVG X;  4F1S A;  2V3P A;  3AE3 B;  3A1Q B;  1MM4 A;  1OGW A;  1YX6 B;  4XNL A;  4RCO A;  1T6B X;  2KVZ A;  4DQO C;  1JWS D;  1WGR A;  1VLB A;  3X23 A;  2R2Q A;  2JXX A;  3OJ3 A;  4IM0 A;  1NYR A;  3S2A A;  2X38 A;  3A4R A;  3GZN B;  4FRT A;  2YVC A;  2BWE S;  1YN5 A;  2J0M A;  2K6D B;  2RDH A;  3P2B A;  1E10 A;  2Y0K A;  5IN7 A;  4NAM A;  2W3S A;  4LK0 M;  4MAC A;  1TS3 A;  2WXH A;  4LNO A;  3RPF C;  3TSS A;  5EDS A;  1V81 A;  2K6Q A;  1WF9 A;  1DOI A;  1JAL A;  2O2V A;  3AEB B;  4ASW C;  4YWG G;  3U7Z A;  1SJE D;  2F1T A;  3UPG A;  4FUV A;  4NQK E;  1JCK B;  1WX7 A;  2KJR A;  4ZHO A;  2FBW B;  2WDQ B;  4FJZ A;  2HTH A;  3RNB C;  2W3R A;  3L54 A;  1UF0 A;  3CWI A;  1YS5 A;  4E3C A;  4FA6 A;  1JWU D;  1BXT A;  2ASQ A;  2YEP F;  2CJO A;  4MH8 A;  1Q9G A;  3POQ A;  4DHJ D;  2XBB C;  2DYB A;  3UF8 A;  4AYM C;  3FYX A;  2VH1 A;  3R8B A;  4IW0 A;  2ZLD A;  4C80 A;  1XT9 B;  3MC0 B;  4A55 A;  4B9K A;  2NR2 A;  4CHK A;  2I1K A;  3DA3 A;  4OHJ A;  3AA6 B;  2KLC A;  3ZJU A;  2WYQ A;  3VR8 B;  4AKM A;  5AZH A;  4W9J A;  2CHW A;  3TCA A;  1ZP0 B;  1WJ4 A;  4JLC A;  3EFC A;  4II3 B;  2KTR A;  1XO3 A;  4LSH A;  1UBQ A;  4DHZ E;  3SFE B;  3Q69 A;  4EZJ A;  2CHZ A;  5GTI O;  1KF6 B;  3LB8 C;  1E8Y A;  3PGE A;  3A4S C;  2J42 A;  3AE2 B;  2KTF A;  3SU8 X;  4LNN A;  3BY4 B;  4L1B A;  5AFU L;  1A70 A;  2A5U A;  1FPY A;  4MEL A;  4TV3 A;  1N5X A;  2GBR A;  1TT5 B;  5E6N A;  4FSO A;  4U9C A;  1E7P B;  3KH0 A;  1FXI A;  2BWF A;  1PHO A;  1T16 A;  2POR A;  1MM5 A;  2C7H A;  1NEK B;  2JT4 B;  4FZL A;  3HOE A;  1C79 A;  2OMF A;  2DBY A;  2J0K A;  2KAJ A;  3P4R B;  2ZVN A;  2VZK B;  2MBE A;  4HRS A;  1WXM A;  3DBH B;  3RN9 C;  3TZG A;  1KRH A;  3Q8E A;  2M8S A;  1V1P A;  1ZHZ A;  1A5R A;  3WAO A;  1GFP A;  1V97 A;  4NJ7 A;  4N58 A;  4WJN A;  2XE1 A;  2L8J A;  2N9K A;  4IWQ A;  3GE8 C;  4E1T A;  3RMK C;  4WH4 A;  3N20 C;  3AAE A;  4G50 A;  3L13 A;  2MHL A;  4II2 B;  2L52 A;  3UAQ A;  2KMA A;  4AYN A;  1L2N A;  2ZPN A;  5G2N A;  1ZGU B;  4FES A;  1JWA D;  3R7R A;  2JQR B;  2JZ3 B;  1I4H A;  1P1A A;  2M0A A;  2PIA A;  1JRU A;  4DXA B;  4CQN A;  4FMS A;  1ACC A;  2E6X A;  3NOB A;  2RPQ A;  1HA5 A;  3ABV B;  2IGD A;  3AI5 A;  3RUI B;  1C76 A;  1S5L O;  2JYT A;  3T3O A;  2N1V A;  2AXT O;  3JSV B;  4FJY A;  3IHP C;  4OZB A;  5ADX L;  2WWZ A;  3P4Q B;  4WAF A;  3NZU A;  2YLM A;  1ZKH A;  3ZO5 B;  4LJP B;  1AWD A;  3TBL D;  2CU1 A;  3RD2 A;  4BUM X;  3NY5 A;  2ICI A;  3X0W A;  5IKC M;  1EU3 A;  4O3Y A;  2LUE A;  5BMH A;  2ERV A;  1V2Y A;  4IL6 O;  3TEZ A;  4YL8 A;  4MGY E;  2KK8 A;  4EUT A;  3PPA A;  1YJJ A;  3IAS 1;  3DHI C;  1I4R A;  3EGR A;  2LHE A;  2WX0 A;  5D7G A;  4MEM A;  2KX0 A;  5E6J A;  3C5O A;  3DQV A;  1QZE A;  1HXU A;  2K0L A;  3SYS A;  2WXQ A;  4XDC A;  3Q8B A;  4WWN A;  4PYU A;  1B9R A;  5HI1 A;  5LNK 1;  1HXX A;  1KFY B;  2I1J A;  3ZLZ A;  1QOG A;  3AE7 B;  1RAX A;  2KAC A;  4PR7 A;  3VE2 A;  1GFQ A;  1Q0W B;  2KMM A;  3DPD A;  3DBR B;  2O6V B;  2PTL A;  6PRN A;  3WI5 A;  2V1Y A;  3HVD A;  3LXF A;  3P4S B;  4K3B A;  2LHD A;  4P6V F;  1L7Y A;  4RLB A;  1WE7 A;  1XF5 L;  4YSX B;  2VH2 A;  1GC6 A;  4RLC A;  4IM3 A;  3RYT A;  1TZO A;  4YSZ B;  5G26 A;  3ZUN A;  2W80 C;  1NEN B;  3ZJT A;  5IP4 D;  3PGS A;  2GE4 A;  4JIO U;  2L76 A;  2LUM A;  3O0E A;  2NCN A;  3SY7 A;  1L0V B;  2RD0 A;  3DWO X;  3KYC D;  4A90 A;  1RWS A;  1B1Z A;  3EA6 A;  4JQW C;  3DWM A;  2HJ1 A;  4ICU A;  2YPV A;  1JWB D;  1RLF A;  2RR9 A;  3DWN A;  3ONS A;  4ZDV A;  4HDO A;  1OPF A;  5IO9 A;  3MTN B;  3Q8A A;  1STE A;  3RNC C;  1E90 A;  4FLH A;  2G9H D;  3AAA B;  1UEL A;  5EE1 A;  2ZNV C;  5EE9 A;  3ZNH B;  1TKG A;  3SD5 A;  4ZYS A;  4MSM B;  5J17 A;  4JCH A;  4JPS A;  5JDP A;  1V9J A;  5BYS A;  4IC7 B;  3R3M A;  2M56 B;  1WE6 A;  1SBB B;  4XZ4 A;  1WMH A;  3ZRC A;  4I6L B;  4KRA A;  5C3J B;  3AA6 A;  1MHX A;  5DL8 A;  2GMI C;  4KDL B;  2N9E B;  2D5G A;  1TBE A;  3C0R B;  3U52 E;  5GMV A;  2RDB C;  1D4B A;  3EUB 2;  4TQ1 A;  1WZ3 A;  2MWS B;  2N2L A;  2K4T A;  2Z8L A;  3PZ7 A;  2Y5P A;  2W55 A;  1XQQ A;  2L83 A;  2KWD A;  3SR6 A;  1E7U A;  3AMZ A;  3AAA A;  3KVF B;  3SZD A;  4CO7 A;  2LD9 A;  4NY0 A;  2DYO A;  3Q8C A;  1FM0 D;  2IND C;  5FKA C;  1VZ6 A;  1C1Y B;  1PQS A;  3SYB A;  1QF6 A;  4MJS B;  2V9H A;  2PE9 A;  2QC8 A;  1IPG A;  1D5X C;  3BS0 A;  4GMV A;  1CQV A;  2GBK A;  1IZN B;  1D5M C;  4E71 A;  5D3I B;  2MBQ A;  3PQU A;  3AH7 A;  4OW0 A;  2KVR A;  1F77 A;  1YMH E;  3BVZ A;  1N60 A;  4XGA B;  2V4I B;  4RL9 A;  4IWO A;  3POX A;  1FRR A;  1DOY A;  1SEB D;  2IPK D;  1PDX A;  1GUA B;  2IO3 B;  1FNW A;  4BKG A;  4M8N A;  2ZVO A;  4MGK E;  3QQ8 B;  2N9L A;  3V61 A;  1TTN A;  3NS1 A;  3IT6 B;  1V86 A;  4DDG D;  3B2G A;  4FN2 A;  2QSD A;  2DEN B;  5LLI A;  1XCT L;  1LO5 D;  2IWW A;  1XLQ A;  4X57 B;  3PSE B;  1IBX B;  3AEF B;  5CTR C;  1N61 A;  2IO2 B;  4MGZ E;  2D3G A;  4W9G A;  3ZTD A;  1XD3 B;  1IUE A;  1FIQ A;  2PLP A;  1L0Y B;  2G45 B;  3TMP B;  5G39 A;  1F2R C;  5BYR A;  3ENE A;  4A8X C;  4O3Z A;  1EO6 A;  2JSV X;  5ADX K;  2W82 A;  1FCC C;  2LGS A;  2LFI A;  4EZL A;  3N30 A;  4NQL B;  5J18 A;  1V5T A;  3I3T B;  4A20 A;  2WDR B;  2LGD A;  3OWE B;  3RUL A;  1P4T A;  1Z2M A;  2D2Q A;  3T24 A;  4ICV A;  4DWF A;  1R4M I;  1ZHW A;  2JU6 X;  1IZN A;  3VZT X;  3BVG A;  5HKH A;  2FCM A;  3BYT B;  3UQB A;  2ZW1 A;  3GE3 C;  5KAF O;  4AJY B;  1FFV A;  3PZ8 A;  2B76 B;  4IKG A;  4YSY B;  2W81 C;  2LXA A;  3VZU X;  5C2T B;  4O4U A;  2PMV A;  3L0W B;  2UWQ A;  4LJO B;  4P1C C;  1HTO A;  4GDK A;  2K0P A;  1Y8R C;  1Y56 A;  3HVZ A;  4DXG A;  3AEE B;  4XDD A;  2FUG 1;  2W54 A;  1TKY A;  3L16 A;  4RH6 A;  3ZXV A;  4C7Y A;  4LNK A;  4ARC A;  5AZF A;  5L83 A;  2ZZP B;  1QOA A;  2KDE B;  1JQ4 A;  3ECI A;  4BOZ B;  4MSQ B;  3BRZ A;  2KQS A;  2WHI A;  4B61 A;  3VXW A;  2QTK A;  4WWP A;  2MEK A;  3IAM 1;  3PT2 B;  3WIM A;  2N9X A;  1V80 A;  4AOF A;  3NSG A;  3V3X A;  4O49 A;  4C00 A;  3JVZ X;  4JFB A;  1QIL A;  5AEK B;  5HHD G;  3Q8F A;  3H7P B;  4MJS A;  2KC2 A;  1UUP A;  4WQO B;  3CST A;  4LCD E;  4FQE A;  3PGR A;  3K9P B;  2LGX A;  1V6E A;  2JY6 A;  1C4P A;  3ZNI D;  2MP2 B;  2NBU A;  3NG0 A;  5FR3 A;  2OJR A;  3SHQ A;  1F2R I;  2BBC A;  4XWT A;  1E5W A;  2BGF A;  2L3Z A;  3DVN V;  2KWU B;  1MPF A;  1Q9F A;  1EUV B;  3BK1 A;  4FHJ A;  1K51 A;  2IZV B;  1QQR A;  1WJU A;  1T0Y A;  1N63 A;  4GDK B;  2MJE A;  4CYE A;  2KFJ A;  1MJD A;  3T8M A;  3DBH I;  4M8M A;  4J6I A;  4GCS A;  2K25 A;  3CMM B;  1GPX A;  2XN9 C;  3MJ5 A;  3R2I A;  1TS2 A;  2NTS A;  4AQ7 A;  1PRN A;  2AQ2 B;  3AE1 B;  2LVQ A;  2C7N B;  3RT3 B;  2ZEQ A;  1VCB A;  3ZXR A;  1ZDX A;  3W1S A;  2BKR B;  1LM8 B;  2DNF A;  3H8H A;  3VR9 B;  4GHB A;  3QAR A;  1ZW7 A;  3FIL B;  3NVW A;  4AKR B;  4HCN B;  3HIZ A;  3ZJV A;  4HKQ A;  4QAY A;  4HEA 1;  1ORM A;  4TMA B;  4KKJ A;  1XLN A;  3TJP A;  3RCZ A;  2XMX A;  1BML C;  4MGI E;  3PS6 A;  1JRO A;  2RPV A;  3AE8 B;  2INC C;  1FXT B;  4ZRK A;  1S1Q B;  5JHB A;  2WX1 A;  3VUX A;  1E6E B;  2DZK A;  1WGD A;  4DBG A;  3DOW A;  1WGK A;  2O4V A;  3KWV A;  3G7G A;  4TUU A;  3WA0 A;  2J0J A;  4L2Y A;  4AWJ A;  1I4X A;  2LGI A;  4JWU C;  1I4Q A;  3AE9 B;  4NZL B;  2CKH B;  3VUW A;  4M01 A;  1S3S G;  4G3X B;  1F1H A;  2DWQ A;  3RBH A;  2Y2X A;  1WY8 A;  4K81 A;  4XYC A;  4ZOH C;  3E9S A;  3RNE C;  2KDB A;  2M0X A;  3PQS A;  1P7E A;  3RZW C;  2LZ6 A;  1V49 A;  2W9N A;  2K8C A;  1QJ9 A;  1V8C A;  1UWM A;  1YN3 A;  5MPO A;  4J3O D;  3ZNZ B;  4D5U A;  2PW9 A;  4K7U A;  1C9F A;  2F1V A;  3ZGZ A;  3H7S A;  4KGT A;  3POR A;  5DL7 A;  3N3K B;  3ZNG C;  2QDF A;  3PF1 A;  2KWV B;  2KXP A;  4GU2 A;  3BVM A;  1E8X A;  3V60 A;  1Z5S B;  3M62 B;  2WU2 B;  1T0S C;  1V1O A;  1WGG A;  4FAD A;  3VE1 A;  2MJ3 A;  2GRI A;  3APD A;  1KOT A;  2O6V D;  3J9C A;  2LMC A;  4HK2 A;  2WXO A;  3ZKJ C;  1GB4 A;  1SE3 A;  1BT0 A;  4H2A A;  2NPT B;  5JH5 C;  1LQB A;  1ZOY B;  2WJR A;  4M0W B;  2LJ5 A;  5G38 A;  1WXV A;  2ZCB A;  5D2M B;  1J7A A;  3BWU D;  3ZDM C;  4D64 A;  3M63 B;  3W1Y A;  3FAH A;  2AL3 A;  5D5D A;  2EKE C;  4KR8 A;  1MI0 A;  3L4P A;  4NJC A;  4F7Z A;  1HTQ A;  3AA0 A;  3AED B;  1KLU D;  4HPP A;  2QEJ C;  5E6O A;  1GJZ A;  3SY9 A;  3AM9 A;  2IDY A;  3JTY A;  1JML A;  4DDI D;  4BKT A;  1WWT A;  4GB9 A;  2JRH A;  3RNG C;  5DL6 A;  3K19 A;  4ANW A;  4FHK A;  1L0X B;  4B0M A;  2LFU A;  3Q6B A;  1SE4 A;  4K1R B;  2RMM A;  2GB1 A;  2LVO A;  3T3N A;  2PKO A;  2PE6 B;  3IT4 B;  2LRU A;  2KXJ A;  3AE4 B;  2G1E A;  3R2T A;  4FXC A;  4ZYN A;  3VH3 B;  4ARI A;  3GP6 A;  4R3D A;  2J7Q B;  3CIR B;  4GN1 A;  1I42 A;  3NVY A;  4RM9 A;  1BT9 A;  3MFG A;  1TJE A;  1RRB A;  3VY8 X;  4KIK A;  2ODJ A;  3LK3 B;  2I38 A;  4OVZ A;  4B95 A;  2L0F A;  2CR5 A;  4I6P A;  4IM2 A;  1T1L A;  3KUC B;  4AKR A;  2LVP A;  3A0B O;  3OLM D;  4LNI A;  3T20 A;  3A2S X;  3AU5 A;  3Q3F A;  2QJL A;  3DWG C;  3DA4 A;  4AUQ C;  4TQ0 A;  1ZHX A;  1GOZ A;  2JQY A;  4RJX A;  4XWW A;  4M0W A;  3AEA B;  5BMI A;  4C4V A;  2OJW A;  3NHE B;  4LSF A;  1N5W A;  4LSI A;  1XEE A;  1I35 A;  4XE0 A;  1OFF A;  3C8Y A;  4D2K A;  2BYF A;  4KGS A;  1DYQ A;  2EMT A;  3A9J B;  3TL5 A;  1E9M A;  2MA9 B;  2AX5 A;  5T8I A;  4S0R A;  4DHZ B;  2WDT B;  1IP9 A;  4BFR A;  1P9D U;  1YJI A;  1THQ A;  1NDD A;  1D3Z A;  4RGN A;  4ANV A;  1YNT E;  4KZ0 A;  2R8A A;  2WNM A;  3FIL A;  4M00 A;  4AS1 A;  2XG6 A;  4PT5 A;  1MHH E;  2AQ3 B;  3PRP B;  4MM3 B;  1E8W A;  4MT5 A;  1K52 A;  1VZ7 A;  3APC A;  1HXY D;  1M4V A;  2R4P A;  1C77 A;  4FZN A;  1VJK A;  4KSL C;  4YTM B;  2JF5 A;  1WZ0 A;  5B5E O;  4BKS A;  3MP9 A;  5C1Z A;  2AQ1 B;  2A4Z A;  1TGZ B;  4RJW A;  3GZN I;  4DXF A;  1IGD A;  4BVU C;  4P16 A;  3V6C B;  4LDT D;  1H4R A;  3IG3 A;  2MNH A;  3GOE A;  4C4V B;  2BW2 A;  2QIL A;  3DZM A;  2PVG C;  3NVZ A;  2GI9 A;  3M95 A;  4IWP A;  2JWZ A;  2Y3A A;  4O4X A;  2KHW B;  4KGR A;  3Q3J A;  4BBN C;  2EKI A;  4WUR A;  1J19 A;  3PRZ A;  1R4N I;  4AZL A;  2CS4 A;  3PRM B;  1OQQ A;  4EZK A;  1EWY C;  2JRI B;  1Q5W B;  3I57 A;  4N75 A;  2V0G A;  4FZM A;  1HXT A;  3FKY A;  1C4A A;  2IO1 B;  1QT9 A;  3KW5 B;  4M02 A;  4EEW A;  4AP4 C;  3MJW A;  1OTR B;  5IOI A;  1AAR A;  2Y0H A;  4W9F A;  4DHJ B;  1P7F A;  1ZXH A;  3EFU A;  1MVK A;  4FUL A;  1X1M A;  5G5G A;  2D10 A;  1LGR A;  2IWV A;  1AYF A;  3Q3O C;  1XLP A;  3DBL B;  2M07 A;  4GIV A;  3KLS X;  1HEZ E;  4F4B A;  2ZJD A;  2N2M A;  3ZQ4 A;  3B08 A;  4N9F 4;  2BB5 A;  4EOY A;  1UBI A;  5DPT A;  2KZ7 A;  3LDZ E;  2NTT A;  4HVB A;  4ZRQ A;  3W5U B;  3HW9 A;  3PHX B;  2WXL A;  3QC8 B;  2UYZ B;  3QAQ A;  4XX5 A;  4N59 A;  1TKE A;  2JWU A;  3DBR I;  1QJ8 A;  2MBB B;  2VRR B;  3M3J A;  3R66 C;  4RGM A;  2BS2 B;  3WI4 A;  4HKZ E;  4LLG M;  1C4C A;  1WYG A;  5CHV C;  8PRN A;  2BS3 B;  1XXG A;  1UGJ A;  2M17 A;  4LDT B;  1IYF A;  1D6E C;  3POU A;  3I5J C;  1WFY A;  1TS4 A;  4WWM A;  4YTP B;  3VHT C;  2N4F A;  4KIK B;  1ISN A;  2O2V B;  3PRN A;  1WMH B;  4K7W A;  1GAQ B;  2QMT A;  1FXA A;  4W9K A;  1ZE3 D;  3ZYY X;  2J4U P;  3H6N A;  4WJO A;  2FCQ A;  1ET6 A;  4C69 X;  4TKN A;  2MCN B;  4UB8 O;  5KHO A;  3MHZ A;  2KLG A;  5G3A A;  1BH3 A;  1J7B A;  2Z59 B;  1K50 A;  3L08 A;  5IA7 A;  1HE8 A;  1TS5 A;  1OEY A;  2LI5 A;  2X8X X;  3H7P A;  1QOF A;  2O6V A;  1J0G A;  4WQM A;  4WAA A;  1E0Z A;  3KUZ A;  4GXB A;  3H1U A;  2ZFG A;  4BOS C;  4AFK A;  2NVU I;  1MFW A;  1EU4 A;  2N0S B;  1SJH D;  1OQY A;  2L05 A;  5AUI A;  2KQ4 X;  2ZCC A;  3ML8 A;  4S17 A;  1VZ8 A;  3VAW A;  4USA A;  4L23 A;  2WLB A;  2XNA C;  5E79 O;  3HWB A;  4A3O A;  2ZPY A;  4AYE C;  2EEL A;  2FGR A;  2OED A;  3GS2 A;  4IG7 B;  3WAM A;  3AE5 B;  2DZI A;  3MC8 A;  2MH7 A;  2Y5B B;  4W9I A;  1NI2 A;  2PPH A;  3DBS A;  4GCQ A;  2JXT A;  4FBJ B;  1OSM A;  3A9K A;  3SFD B;  1VDV A;  4RM8 A;  4REZ A;  2NBV B;  4AUI A;  2TSS A;  5C23 A;  4NAW B;  2PRN A;  4EKU A;  3QRC A;  2Y7S A;  4WJQ A;  1R4N B;  4P1B C;  2DLB A;  2XK5 B;  4HPM B;  3VQI A;  1YX5 B;  5DPS A;  2FCN A;  1SF0 A;  2WXF A;  4NAW A;  3NRZ A;  2DAF A;  2KX3 A;  2KC1 A;  5G55 A;  3EHV A;  2BYE A;  3BIN A;  1IBX A;  5D94 A;  2JYE A;  4RGO S;  3HHM A;  3QWZ B;  2K1F A;  2OOB B;  1OQR A;  4ITK A;  3W1S C;  4GF4 A;  2JX5 A;  1GNU A;  3VTV A;  4HCP B;  1DGJ A;  2KDI A;  4KV2 A;  3UIP B;  3AA0 B;  3RZF A;  2INN E;  1QOB A;  1YD8 U;  3P4P B;  2BS4 B;  2L32 A;  5HFY A;  3URY A;  4ZRJ A;  3VRB B;  3BRY A;  1FNU A;  2WP9 B;  2KJH B;  1NBF C;  2KZ7 B;  4XNK A;  1UH6 A;  2WS3 B;  4JX1 C;  2XTQ A;  1AN8 A;  5H2F O;  2K8B A;  2N7J A;  2N9P C;  4GDL A;  2WXI A;  4ANU A;  3T0S A;  1J8C A;  3ML9 A;  7PRN A;  3APF A;  4LSE A;  2WXP A;  2E3T A;  4GDL B;  2KD0 A;  3V62 A;  3T9L A;  4UDU C;  4NPN A;  4Q2J A;  1ENF A;  4K3C A;  4OZC A;  2VZK D;  3VH4 B;  1N6Z A;  3KYD D;  3UIO B;  2HTM E;  1JW9 D;  4KKI A;  1KM7 A;  4AYI D;  3CSF A;  1WIA A;  2REX A;  4D65 A;  1WRI A;  3PLV A;  2KKC A;  1L5P A;  1YQB A;  5I4D A;  1GFO A;  1ZDV A;  1BXW A;  3UI3 A;  3N1Y C;  2BT6 A;  3JCU O;  2C7M B;  4TSS A;  3DDC B;  3Q14 C;  2IGH A;  5AZG A;  1WM2 A;  2N1W A;  2C9W B;  3KVD D;  2LJI A;  3BYY B;  2BPS A;  5EE2 A;  1KLV A;  2D3C A;  3H9D A;  2KWC A;  2K8H A;  1WH3 A;  1M94 A;  1WXA A;  1GC7 A;  4RF0 A;  4PS3 A;  4G0N B;  2JZP A;  3A9J A;  2Y5C A;  5LXH A;  1WXQ A;  3NVV A;  3A33 B;  3JSV A;  4N6E B;  4A3P A;  4KR4 A;  3K9O B;  1UZX B;  1AW7 A;  3ZVV A;  3W2D A;  2HD5 B;  1FNV A;  3A0H O;  1F9J A;  2IJ0 A;  4MM3 A;  2K5P A;  2V3S A;  2ON8 A;  4OZA A;  2LHF A;  2IY1 B;  1EWC A;  3VRA B;  3B0A A;  2FNJ B;  1E54 A;  3WU2 O;  2G4D B;  1WM3 A;  1QLB B;  3PZD A;  4RGT A;  3HRD D;  2AL6 A;  5EE0 A;  5GTH O;  2ACZ B;  4KX6 B;  2D3A A;  1FMA D;  1T0Q C;  2Z0D B;  1L4Z B;  5CHW A;  3DCG A;  3OAW A;  3OG5 A;  4FJV B;  3U30 A;  3EMN X;  5G5H A;  3ZDT A;  2WJQ A;  2V3N A;  3NZS A;  1TIF A;  2KMC A;  5H92 C;  2Y0L A;  2FID A;  1ZXI A;  5CX3 A;  2BKF A;  3UIN B;  3VVW B;  1Q10 A;  1MPE A;  1ET9 A;  5AUK A;  1I4P A;  2NPT A;  3QA8 A;  4HJK A;  3ZRF A;  5GXG B;  1WJN A;  2KN5 A;  2JPH A;  4LTU A;  4FSP A;  4RF1 A;  2L00 B;  2IY0 B;  2NMQ A;  4EE2 A;  2JUO A;  2FGQ X;  4O3W A;  3TEX A;  1NI3 A;  2KFK B;  2MJD A;  2L1A A;  1WI0 A;  3IVF A;  4F8C B;  1CK1 A;  4KVG B;  2HDE A;  3DVG Y;  3P63 A;  4BBN F;  3UQA A;  2AYO B;  2GBM A;  1RFA A;  1G6J A;  1WRD B;  1WR1 A;  2R4L A;  3N32 A;  2R4N A;  3JW0 X;  4BAX A;  2RGF A;  1YQ4 B;  4RFB A;  5J2R A;  1KTK A;  3MC9 A;  5TIS O;  1WGY A;  2F1C X;  4GCP A;  3TUO A;  2GBN A;  1V5O A;  1CZP A;  2XE3 A;  2MLB A;  3AXC A;  4P7I A;  4GOC A;  2FE8 A;  2GOW A;  3AU4 A;  4BKS D;  1MG8 A;  2CHX A;  2WXJ A;  4US9 A;  2H89 B;  4JL9 A;  4W9E A;  1GB1 A;  4B0E A;  5IYU A;  1HQR D;  3DVN U;  1SE9 A;  3U7D A;  2XK5 A;  4FT6 A;  1CMX B;  2FIF A;  1KJT A;  3R7Q A;  3PTF C;  1T5X D;  3U4E G;  2LEK A;  2SEB D;  3N1X C;  4EFO A;  2UU7 A;  3PGU A;  1WX8 A;  5T5F A;  3ETR A;  1P0R A;  2WU5 B;  3L17 A;  1T3Q A;  2BF8 B;  4MDK E;  4W9L A;  1WGH A;  4AYD C;  4DK5 A;  2HE7 A;  4ZRP A;  2L7R A;  4PS7 A;  2IGG A;  3LK4 1;  1I7H A;  2KXP B;  4O1N A;  1TZ1 A;  1FEH A;  2ONQ A;  4MH0 E;  3O65 B;  2H88 B;  2R4O A;  3GB1 A;  3I63 C;  3AE6 B;  4HPL B;  2AEH A;  3W9C B;  1UWX A;  5JXV A;  3U2S C;  2DHZ A;  2D3B A;  1WYW B;  2KJ6 A;  3UGB B;  2WGS A;  1SIF A;  2KYW A;  5DPW A;  2PEA A;  1PGA A;  4GSW A; 
#chains in the Genus database with same CATH homology
 4N74 A;  2QDF A;  2X8X X;  2VH2 A;  4K3C A;  2V9H A;  2MHJ A;  4C4V B;  4C4V A;  4PK1 A;  4C00 A;  3Q6B A;  4QAY A;  3OG5 A;  3MC8 A;  2VH1 A;  3EFC A;  3NJT A;  4N75 A;  2QCZ A;  4BZA A;  3MC9 A;  4K3B A;  4XGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...