4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
4K3BA 3Q6BA 4BZAA 3EFCA 3MC8A 2QCZA 3NJTA 2V9HA 2QDFA 3MC9A 4N75A 4C00A 2VH2A 4N74A 4K3CA 4C4VA 4C4VB 4PK1A 2MHJA 2VH1A 3OG5A 4XGAB 2X8XX 4QAYA
chains in the Genus database with same CATH superfamily
3TCAA 2RDGA 2BF8B 2KDYA 3AA7A 2WP9B 2K8HA 1YN3A 4XC2A 2IY1B 4ACFA 3IAM1 4BBNF 2Y0HA 4HVBA 4AYMC 1IP9A 3Q3OC 3CSTA 5DPTA 4YSYB 2LGYA 3JTYA 4FZLA 2KVRA 1KLVA 4LNIA 3NG0A 2Z0DB 3NHEB 3U4EG 2LMCA 2QC8A 4B95A 3RD2A 3VXWA 3SYBA 2RPVA 2ZCCA 1WGRA 3HVDA 4RM8A 4GGQA 3W1SA 3VE2A 4G75A 2DYOA 4KV2A 1IZNA 1ET6A 2FIDA 1XEEA 2LJ5A 4OZAA 3RNEC 1GG3A 2ZJDA 4NPNA 1FFUA 2WXRA 4O3WA 1EF5A 3U52E 3UI3A 2JRIB 1WMHA 2N0SB 2XEWA 1P4TA 2WXMA 1SE3A 4AJWA 3DWNA 2GB1A 1VCBA 1WJNA 1GB4A 1V8CA 3EHVA 1ZPSA 3VY8X 1FXTB 3SFEB 1UWMA 3ZUNA 2PE6B 2KLCA 3AB5A 3RNCC 3AE5B 3R2TA 4US9A 4FN2A 4C7ZA 4ARCA 5AZGA 2R2OA 2D07B 1OSMA 2E6XA 6PRNA 4A6QA 3AULA 4FSOA 4CTDA 2R8AA 1ZOYB 2M1MA 4JGHB 4GDKA 1GJZA 1N62A 3ENEA 1F52A 3OAWA 3HM6X 4G0NB 2OEDA 2FGRA 5E6JA 2V0GA 3ZLZA 1QILA 3L16A 4XX5A 2I1JA 4K7SA 1BH3A 1NI3A 3VTUA 2X9KA 1L4DB 4MH0E 2WS3B 4XNKA 5DL7A 3QJZA 5G26A 1YN4A 2CJNA 1WH3A 1IBXA 1NBFC 2VH1A 3T20A 3P4PB 1KM7A 1NI2A 4DK5A 1XXGA 4IM0A 3SY7A 2LRWA 3L08A 2FCNA 2W82A 3AE3B 4FMSA 3ABVB 4MELA 1JQ4A 3W1SC 2CHXA 3VUWA 1SIFA 4GMVA 2QHOA 2WXNA 3N3KB 3TJPA 3UGBB 3VZUX 4LK0M 4H2AA 1YQ4B 2DLBA 3AE2B 3PREA 3TL5A 2GOWA 4GCQA 5EE3A 3G7GA 4RGMA 4AKMA 2JXXA 3DHIC 1L0XB 4FADA 3W1YA 4PYZA 4PUXA 3KYCD 2B3AA 4WWOA 2QCZA 3ZDTA 2QIEB 1Q9GA 2ASQA 3ONSA 4ZYNA 2WXKA 5FR6A 3T8MA 3W5UB 3Q14C 1D4BA 4FHKA 3TIXA 2DNFA 4KKIA 4AP4C 3M95A 3B2GA 3LK3A 3MHSD 1E54A 2C7HA 4OVVA 3N32A 2F1VA 2LD9A 4KDIC 2Y0LA 5FK9C 2F1CX 4W9CA 1IUEA 3L17A 2YVCA 2VZKB 2IGDA 1OFFA 4YTMB 2XE5A 3O65B 2D5GA 3FKYA 1LQBA 1TIFA 3EC8A 2M56B 2XMXA 2RPQA 2PLPA 3OWEB 1T1LA 3WCQA 4HRSA 1AW7A 2PMVA 1WYGA 4FQEA 2ZZPB 2MBOA 2BGFA 1HXTA 1WXSA 3NVVA 4JLCA 4BOZB 2MQJA 1T0YA 4RGOS 2XBBC 1LM8B 3TBLD 2MJEA 4Q2JA 1WXMA 3E56A 1JWBD 5E6PA 5BO4B 3IHPC 4JX1C 2W54A 2XE3A 2YEPB 2KT7A 2R2QA 3POUA 3VR9B 5KAIO 4ZHOA 5HKHA 1BUIC 2RMMA 3WALA 2PJHA 2YPVA 3I57A 4F8CB 3EECA 2FE8A 4GSWA 1I4GA 4I6NB 1JWMD 3IT4B 1ZGUB 3AEDB 5JXVA 2LWPA 4BFRA 3AA6B 3A1QB 2FNJB 1EO6A 1SB3C 5GV0A 1SE4A 2KDIA 3NVYA 5ADXK 3AE9B 3AU4A 4HJKA 1TT5B 1VRAB 5C2TB 1I4PA 2KX3A 3D32A 2KXPB 3MFGA 4G76A 3JSVA 4XE0A 5J17A 4HROA 4CHKA 5DPSA 3WANA 3DHHC 4FLHA 1Q5WB 2INPE 3IT6B 4HXDA 5IKCM 2V9HA 1FCCC 1FNUA 4HEA1 2DENB 4LNFA 4EUTA 2MP2B 3I63C 3PLVA 4MM3B 2PVGC 3ZGZA 2HE7A 4U9CA 3H7PB 4XYCA 2V4LA 1Z5SB 1VD2A 3DWGC 2G3QB 2XK5A 5LNK1 1E6EB 1B9RA 3IAS1 3GOEA 1WX9A 4WURA 2Z8LA 4NJ7A 1ORMA 4EZLA 1N63A 2JZ3B 1Y56A 3VRBB 1JWSD 1P98A 2MLBA 3T24A 3UAQA 2KHWB 2YLMA 1RFAA 2BW2A 1Q9FA 1PGBA 4FRTA 3NY5A 4KIKB 3KZIO 4MH8A 1FNVA 5IYUA 3N9YC 1XCTL 2GMIC 2WX1A 3RT3B 1WYWB 3VQIA 2EMSA 3GZNI 2Y5CA 1HXUA 3AA1A 2KDFB 2W81C 1F1HA 2BKFA 5L83A 1ZHXA 2V4IB 5CHFA 1ZHZA 1EWCA 1JROA 1MHHE 1LGRA 2OOBB 1TY2A 1TBEA 4LSIA 2K22A 1H4RA 2IO3B 1PDXA 1K52A 2LVOA 4EOYA 2JT4B 2A5UA 1R4MI 1QJ9A 4YL8A 3AN1A 2VH2A 1EUVB 1P1AA 1GAQB 3BIID 2MA9B 1WZ3A 2OMFA 1QT9A 3AA0B 1WY8A 4NY0A 1BXWA 4WJPA 1ZHWA 5HHDG 1OQYA 3MJWA 1MG8A 2INCC 3DA4A 3B2FA 4LJPB 3V6CB 3Q3MC 1PFDA 3SFDB 2AL6A 4EKUA 3DBLB 1YQ3B 3RMKC 2RDBC 5JDPA 2L05A 4MSQB 2DHZA 3CMMB 5D6JB 4AUIA 1STEA 2R4OA 1OTRB 3T0SA 3TZGA 1VJKA 3U7ZA 2BYTA 2O2VB 1ZHYA 2JUOA 1RAXA 4HPMB 3H1UA 3EGRA 5GTHO 2UYZB 4DHJB 3MC9A 2IJ0A 1FXAA 5AFUK 1HXYD 5G3AA 4P6VF 3BRYA 2W9NA 3RZFA 2J0KA 3AEBB 1UWXA 2IDYA 1WIAA 2KVZA 3AA6A 1CQVA 3JCUO 2REXA 1NEKB 4Z3TA 4KR4A 2WNMA 3A9KB 3DBHB 3ML9A 2JY6A 1A70A 5CTRC 4RLBA 3T9LA 3ETRA 3VH3B 4BKSA 2B76B 1GFPA 1Q10A 5H92C 3SYSA 2DZMA 2LHEA 1F9JA 4WAFA 1JRPA 2KACA 2O4VA 1YNTE 3A0BO 4NJ6A 1SXTA 2Y5BB 3Q8AA 3FC4A 2SAKA 3A4SC 1V86A 1J7AA 3KH0A 4DXAB 1T0SC 5J18A 3EUB2 2D3GA 2IO1B 2LZ6A 4FT6A 1KJTA 4IG7B 2WX0A 4YTPB 4UDUC 4IWOA 3GE3C 4M00A 1ACCA 2N2MA 1WRIA 2I1KA 3P42A 3A4RA 2NS5A 4K81A 1WGYA 1NVID 2AEHA 4W9LA 4YT0B 1QOBA 3R7QA 2DBYA 3BZDB 1MG4A 1OQQA 3BVMA 2R89A 5B66O 2IZVB 2ZVNA 2WU2B 5GMVA 1BXTA 4GB9A 1P0RA 5TISO 4LDTD 5DPRA 3PV1A 2XG6A 3N1XC 4P7IA 3AAAA 2L52A 4O3YA 2O6VB 3ZW3A 3AA0A 3PQUA 3J9CA 3C8YA 4W9DA 4QQ1A 4OZCA 2EKEC 4I6PA 4GXBA 2WQYB 4W9GA 2Y5PA 1E7VA 2XTQA 3AEEB 1QKZA 1JMLA 4XGAB 2N7JA 2BPSA 2GLSA 3RN9C 4TQ1A 2KNBA 1WFYA 4AOFA 5L95C 5C1ZA 3V8UA 4LLGM 5IP4D 4JCHA 5AEKB 1QJPA 4DXGA 4AJYB 2G4SA 1WGDA 2ZNVC 2GRIA 1L7YA 3GZNB 4YWGG 4HJGE 3MTNB 2ZVOA 4RCOA 1XF5L 1EU4A 4JQWC 1N5WA 3EA6A 4XWWA 2N4FA 2M0AA 4NQLB 2KLGA 1JALA 1XCQL 4XZ4A 4ZOHC 1WRDB 2IPKD 5AFUL 3CF6E 4HKQA 1MJDA 3TEXA 2JVCA 3O13A 4MM3A 2HJ8A 3DPDA 4FOZA 5IA7A 1UUPA 2E3TA 1SSNA 4FZMA 4RMAA 4IC7B 4J3OD 4PS3A 3IBEA 2K6QA 3SHQA 4FZNA 2KC0A 1DOXA 3MJ5A 2CJOA 1C77A 3PSEB 2KJRA 1R4NI 3Q8CA 3IXSA 1GNUA 2JWUA 4CO7A 5D7GA 1YN5A 2EMTA 4QAYA 1CZPA 3BK2A 3MC0B 1C1YB 3VDZA 3P2BA 2Y3AA 1YJ1A 4BKGA 2LHFA 1L6VA 2ONQA 2XE2A 4WWMA 2JQRB 3V60A 4MGKE 2ZCBA 3QHTA 1WMHB 1I35A 2WWZA 2D3AA 2TSSA 2W55A 1FEHA 4RJXA 4JFBA 3DVNU 1R7SA 1WJ4A 3SZDA 4HKZE 1XLQA 2K5PA 2YEPF 3B9JA 4BUMX 2AWTA 2LUMA 3RYTA 4K3CA 4IDIA 2V3NA 3LB8C 1I4HA 4F1SA 1L4ZB 4MDKE 4BKSD 1TTNA 3C5OA 3OG5A 2PTLA 4KVGB 3AXCA 4PJ0O 2Z0EB 1E7PB 4P1BC 2DX5B 1YS5A 2CHZA 2WGSA 4TUUA 4XNLA 4CYEA 1NENB 2OJRA 1TKGA 2ACZB 2MNHA 2KWUB 1UGJA 5AUIA 3QIJA 2DYBA 5BYQA 1CMXB 4W9HA 4W9FA 3H8HA 5H8YE 4NJCA 3C0RB 4C4VB 4KGRA 2MJ3A 2ICIA 3CWIA 4BOSC 2VRRB 1JWUD 4ANVA 3TSSA 1VLBA 4IKGA 4RF0A 1D5MC 1C4CA 5T5FA 1Z2MA 4M02A 3ZJTA 2HTHA 1OPFA 2WU5B 2K6DB 3VUXA 2KC2A 3Q3NC 4MSMB 1T3QA 1YMHE 3PZDA 2D2QA 3JYUA 2NBUA 3P63A 3HUIA 5KAFO 1TJEA 1QQRA 2Y7SA 1L0VB 4K7UA 1IPGA 4WQMA 3TEYA 1WX7A 2WXLA 3FYXA 1ZKHA 2JYTA 2KC1A 2NPTB 3AAEB 4BKTA 5H2FO 1WJUA 1LO5D 3N20C 4F7ZA 2JRHA 3OLMD 1DGJA 3DBRI 4XDDA 4AS1A 3VUYA 3HWBA 1RRBA 4LNNA 2IGGA 1FRRA 3K9OB 4L2YA 3RNFC 3DBSA 2LJIA 4AYID 1SEBD 2KN4A 3DOWA 3HOLA 4YTNB 4TMAB 2M0XA 1ZXHA 1THQA 1FNWA 4HDQA 4LJOB 1JW9D 4C56C 1FRDA 4IWPA 2KMAA 2C5LC 5EE0A 3M62B 2NVUI 3WI4A 5FR3A 1PHOA 4N9F4 4PYUA 1UNSA 2N9KA 1V1OA 3VZWX 1V80A 4S17A 4EZJA 3BVGA 1J0GA 3U8ZA 4PK1A 3R66C 2R4PA 3PGEA 1P3QU 2RR9A 4RH6A 4RJWA 1KTKA 4MJSA 3UQBA 1E8ZA 3RZWC 1QF6A 2L00B 4A3OA 3AAEA 5AZHA 3KYDD 3C19A 1TS4A 2OHFA 1MFWA 1GFNA 2N7DA 2DAJA 2GBKA 2BYFA 3W2DA 5G39A 2PE9A 2KTRB 2Y0KA 2KJHB 2K39A 4EFOA 4L1BA 1K50A 1F0ZA 3AAAB 4RGNA 4S0RA 2ZW1A 1XLOA 2KAJA 1AN8A 1KFYB 3HM3A 4FESA 1HZ6A 2SEBD 1V6EA 2CR5A 3MP9A 1FMAD 3I3TB 4A90A 1TS3A 3LDZE 2LASA 2KXPA 1QOGA 2WXFA 2JF5A 4B9KA 2A4ZA 4FJZA 4II3B 4JWSC 4P1CC 1HE8A 3DA3A 5E6NA 5C3JB 2INDC 4OZBA 2LFUA 1HEZE 3A1QA 3APCA 3H9DA 4PS7A 5G38A 2ZEQA 4WIPA 4DDID 3L0WB 1GC7A 2QTKA 3PT2B 3T3OA 1XD3B 2J0JA 3NS1A 4W9KA 3U7DA 3LXFA 1H6S1 2RSUA 5GXGB 5BMHA 4TKNA 1XLNA 2D10A 3DDCB 1XT9B 1N60A 1OEYA 1V1PB 1IZNB 2DWQA 4TV3A 3VTVA 4F4BA 3QQ8B 4II2B 2QEJC 1WGHA 2WXOA 2NBVB 2KN5A 2PORA 1L5PA 4K1RB 3KWLA 5I4DA 2HDEA 4HPLB 1PYWD 2KZ7B 3AV8A 5HI1A 1AWDA 2FAZA 4HLEA 3AEFB 4KGTA 2G4DB 3N30A 2BS3B 3VFKA 5DPWA 4MGZE 4USAA 2J4XA 1WZ0A 2L8JA 4D5UA 2LGXA 2QDFA 3LK41 5JZEB 1S3SG 4ZYSA 4O3ZA 1TZOA 2KFKA 2ON8A 4FHJA 4DHZE 2X27X 3ZDMC 2XN9C 4KGSA 1C4PA 4R3DA 1WE6A 4XWTA 3ZQ4A 2KD0A 1ZXIA 5D94A 3ZJUA 3ALBA 1IYFA 3PRZA 3SU8X 1EWYC 2RDHA 1N6ZA 1C79A 2K8BA 1AARA 4GN1A 1NDDA 2KWCA 1WGGA 3AEGB 1YQBA 3PRNA 2BYVE 4GU2A 4IW0A 4E3CA 4LDTB 5DCNA 3QARA 1YOVB 3I5JC 2LEKA 2ZFGA 2KX0A 3AM9A 2LFIA 3OJ4B 3PLUA 3U30A 1RM6C 2G9HD 3Q6BA 5IO9A 4TQ0A 2R4LA 2AX5A 2C7NB 3V05A 1D3ZA 2ZW0A 3GB1A 3AMZA 3B0AA 3QC8B 3WAOA 1V5TA 3P1MA 1WM2A 4GCPA 1SE9A 2MBBB 4YXDB 2FCMA 3ZO5B 1DYQA 5JHBA 1BMLC 3PZ8A 3RULA 2WXJA 2AXTO 3AA1B 1JRUA 1V81A 2Z59B 4BAXA 2FIFA 3LK2B 1TS5A 2LGSA 1F2RC 4O1NA 2DZIA 3VZTX 2JXTA 1E8XA 3NUHB 3DCGA 1GFQA 1J19A 3R8BA 3BS0A 4KSKC 2G1EA 4ZRQA 1C78A 2IY0B 1HZ5A 2N1VA 3UQAA 2NMQA 2GI9A 1TGZB 4C80A 2V3SA 1VZ6A 5C23A 2J7QB 3BK1A 5FVNA 2CHWA 2L7RA 3RPFC 1C76A 5G5GA 2C7MB 1KF6B 4B0MA 3Q8BA 2UU7A 2BWES 4NZLB 2NPTA 3Q3JA 2ERVA 4GDLB 3IVFA 1PUTA 3ZTCA 2LGDA 2VZKD 2WJQA 2LGIA 3O0EA 5IOIA 3HVZA 1UGMA 1Y8RC 1EM7A 2J42A 3PZ7A 2WXPA 2KANA 1UBIA 2XTRA 4MGIE 1MPEA 2N1WA 3H7PA 2JWZA 1KH0A 2M19A 4HK2A 1UH6A 2JZPA 2WHIA 3AI5A 3NSGA 2BS2B 4G3XB 1ROEA 3UF8A 3MHZA 4EEWA 4PT5A 1TKYA 3RNAC 2LXAA 3H6NA 1F2RI 4C69X 1F77A 4WAAA 5MPOA 3VVWB 3PRMB 1RFKA 1YD8U 3UU2A 3JSVB 1NYRA 3V62A 2MX2A 3ZRCA 1E90A 2J0MA 3BVZA 4LCDE 4NQKE 3DQVA 3PVLA 4KZ0A 2KFKB 3ZXVA 1TS2A 2AQ3B 4MT5A 2KZ7A 2KTFA 3KLSX 2ZLDA 3P4SB 4AYDC 5TSSA 3BINA 4LNKA 3KQ4A 2YNKA 3BYYB 2KFJA 4AWJA 3KUDB 5JHAA 2MEKA 4DBGA 1M94A 3IG3A 2FUG1 4XDCA 2IBIB 1QOFA 1WE7A 1YIWA 3M63B 3SD5A 5EE9A 1ZP0B 1J7BA 4OHJA 2BKRB 3VHTC 2DZJA 1BT0A 2M06A 3H7SA 3Q2AC 3A9KA 2BB6A 5EDSA 5G2NA 2WDQB 4K7WA 3A9JB 3P4RB 2JZZA 4ICUA 3ZNID 1MHXA 4OVUA 2AQ2B 2FGQX 5KHOA 1GB1A 1Q1OA 4IM3A 2WYQA 2PKOA 4MGYE 4ZRPA 5BYRA 2DYMA 1E9MA 3A2SX 2WXGA 3QRCA 1P7EA 3DWOX 3FAHA 3A0HO 3ECIA 4DHZB 4M01A 2FCQA 3P4QB 2O2VA 1LXDA 4L23A 1UZXB 2N9LA 3R3MA 3VRAB 5AZFA 1HQRD 1MPFA 1DOYA 3FILA 2QILA 4G50A 2ZNVB 5E6OA 3S2AA 1GFMA 2O6VD 3Q3FA 1TKEA 3NZUA 4JIOU 1WGKA 2M8SA 3DZMA 5T8IA 1K53A 4GDLA 4PS8A 2KWDA 1WXVA 3RNGC 3V61A 3BY4B 2KQSA 1DOIA 1FPYA 4O4XA 1WXAA 2BQQA 2PPHA 3VAWA 1YJIA 4WWNA 1V97A 3PHWB 1E5WA 4LSHA 3AU5A 2KDBA 2WDTB 2PIAA 3PF1A 3URYA 1YJJA 3GE8C 1YX6B 3NZSA 2MRPA 4D65A 4MJSB 2L83A 5LLIA 2W3SA 3LYYA 1D6EC 1T0QC 1P7FA 3DHGC 3LK2A 2D3BA 4OVZA 1G90A 3AE1B 1E0ZA 4N74A 1OGWA 1WX8A 1SF0A 1E7UA 2JU6X 4AYEC 3WA0A 4LSEA 2BB5A 1FXIA 3RUIB 3BYTB 1SJED 3TMPB 2WDRB 4ZHPA 4K3BA 3PGUA 2K9XA 4ICVA 3UINB 2LVQA 3MC8A 3AH7A 3X0WA 4GHBA 3POXA 2DZKA 3R2IA 1KOTA 1I4QA 1JWAD 2BWFA 2QJLA 4MACA 4FJYA 4M0WA 2WVPA 4OW0A 2I38A 1JCKB 1ZW7A 4ZRKA 3ZNZB 1E8YA 1WM3A 1TYGB 1UBQA 3KVFB 3VTWA 2KDMA 1V9JA 2I2YA 1HA5A 2JSVX 4FUVA 2KYWA 3V3XA 1VZ7A 2BYEA 2R4NA 2M07A 2MBHA 4FBJB 1GUAB 4WJNA 3DBHI 4WQOB 1A5RA 5LXIB 4IL6O 3PRPB 4B6WA 5HG2A 4I6LB 4AFKA 3UIOB 5LXHA 1T5XD 5D2MB 3BRZA 2BVCA 1CK1A 1GFOA 1KRHA 4X57B 4RLCA 1V49A 1QZEA 2WXIA 3VR8B 4ASWC 4O4UA 1N61A 3PORA 1I42A 2M17A 3RFZB 4A20A 1QJ8A 4REZA 4ZRIA 1H8CA 4C4VA 3AECB 3TUOA 1MI0A 1HXXA 2L0TA 3GP6A 2BT6A 4UB8O 2R61A 4G11A 3GP7A 3L10B 3ZJVA 4AYNA 1UELA 3V6EB 1G6JA 2AL3A 3A9JA 3IFWB 1SE2A 3APFA 4NAWA 5TR5A 1EF1A 3POQA 3DBLI 5IAAC 5B5EO 1T6BX 3TEZA 4NAWB 1FO4A 4B61A 1P9DU 2NR2A 4HWIB 1PGAA 1SIJA 4DDGD 5DL5A 4WJQA 3X23A 4UB6O 2PRNA 2J4UP 4J6IA 2NCNA 1C9FA 3WAPA 3AE8B 1ZE3D 1V5OA 3VY9X 2K4TA 4ARIA 2M4NA 5G5HA 2KJ6A 3HRDD 1I4XA 4E1SA 4E74A 2Y2XA 2PW9A 2BTEA 2NTSA 4N75A 1T0RC 2ODJA 3Q8FA 3L13A 1LFDA 3CIRB 3HK0A 3NS8A 2HTME 1FCLA 2N7EA 1K8RB 2WXHA 2MH7A 3T3NA 3AA7B 3SDLC 4YSXB 2J52A 5IN7A 3DVGX 3HIZA 1FIQA 4HPPA 1GC6A 2IGHA 4DQOC 2DAFA 2MSED 3PHXB 2KOXA 3DVGY 4M0WB 2JQYA 1HTOA 2FBWB 4GCSA 2GBJA 4TSSA 2CU1A 3WU2O 3JW0X 4A9AA 2KO3A 3SR6A 1RLFA 4W9EA 1NYQA 3APDA 2W80C 3LK3B 4FULA 4BVUC 1WWTA 2JMMA 2PEAA 1WF9A 4FRXA 1KLGD 3LJ3A 4A55A 1SJHD 2LRUA 5DL8A 4ITKA 2QSDA 3B08A 4LNOA 1V2YA 1RWSA 2V1YA 4AUQC 4RL9A 3AEAB 1BT9A 3EMNX 2K25A 2KDEB 3AE7B 3SY9A 2LXCA 2MBEA 2KMMA 1L0YB 2K0LA 1L6UA 1T16A 4KRAA 4ZDVA 3ZNGC 4C7YA 5KHQA 3Q8EA 2EELA 2UWQA 2XK5B 4CQNA 3ZKJC 3AE6B 4P16A 2ZPYA 2HJ1A 2L32A 2MW5A 4N59A 2KXJA 3L4PA 4DWFA 4KX6B 5BYSA 4RNAA 2WDVB 3E9SA 3ZYYX 3SZVA 2JX5A 4HDOA 4B0EA 2HD5B 2IO0B 2BS4B 5BMIA 1YX5B 1WXQA 7PRNA 3KWVA 3DWMA 4US8A 1IGCA 2H88B 2OJWA 1VZ8A 5EE2A 3N1YC 1MM4A 3PPAA 4WWPA 1QLBB 5DL6A 2QMTA 2KQ4X 2W3RA 4D64A 1KLUD 4JPSA 3RNBC 3RBHA 4AZLA 4M8NA 2L1AA 4NAMA 2J53A 4AKRB 1C3TA 4IOIE 3JVZX 2WLBA 4GF4A 4D2KA 1ZDXA 1C4AA 2N9PC 1I4RA 4A8XC 3NVZA 5CHWA 1EU3A 3ZXRA 3KVDD 4M8MA 5E79O 3WAMA 1J8CA 1E8WA 1RYJA 4O3XB 4ANXA 2N2LA 2GBRA 2MJDA 3QX1A 1SBBB 2K8CA 4RGTA 1FM0D 3QWZB 3ZNHB 3TEWA 3OJ3A 2RD0A 4A3PA 4ANWA 1OEYJ 2K3UA 2MBQA 1HTQA 4PR7A 2CKHB 1PRNA 2BBCA 3HW9A 1XLPA 3NOBA 1V1PA 3ML8A 4KSLC 2IO2B 4KKJA 2CU3A 3W9CB 3QAQA 5D5DA 2XNAC 1GPXA 3EFUA 5HFYA 2MHLA 4WJOA 1SGHA 2MHJA 2KKCA 2N9XA 1TY0A 1S5LO 2XE1A 2D3CA 1D5ZC 2MWSB 1ISNA 1GOZA 1E10A 2KK8A 4HCPB 2FUHB 2LVPA 5GTIO 5ADXL 4URKA 4N6EB 3DBRB 4ZRJA 3VE1A 2IYDB 3M3JA 1MM5A 1R4MB 4JWUC 3PTFC 3UIPB 5JH5C 1WR6E 2J1NA 2INNE 3ZTDA 4LSFA 3U2SC 5D3IB 3AE4B 4YSZB 3K19A 3QRAA 2KWVB 2X8XX 3PO0A 2WXQA 3RCZA 2IWWA 2H89B 4AKRA 4W9JA 4FXCA 2ZPNA 5AUKA 4KDLB 1WI0A 2WJRA 4C00A 4GIVA 4EE2A 4FA6A 3BWUD 1WSPA 2RGFA 3KUCB 4W9IA 3K9PB 2KTRA 4LTUA 4NNJB 8PRNA 3QCAA 2C9WB 4RFBA 1QOAA 2Q5WD 5PRNA 3QK0A 2FCSA 4MEMA 3W5VB 4KZCA 3WIMA 3HHMA 2F1TA 3NJTA 4WH4A 1ZHTA 1Q0WB 3KW5B 3SEBA 4O49A 3ZVVA 1OQRA 2V3PA 4FJVB 3A33B 1FFVA 2CS4A 5FKAC 1FD6A 1U4AA 3UPGA 1TZ1A 2D11A 4HCNB 2NTTA 3ZIMA 5D3DA 4AQ7A 1PQSA 3GS2A 1B1ZA 4GOCA 3EFCA 5J2RA 2PVOD 1D5XC 3QA8A 4ANUA 3HOEA 3DVNV 2K0PA 2KZRA 2LI5A 2X38A 1K51A 2R88A 1X1MA 1XQQA 2K1FA 1MVKA 3PGRA 3CSFA 1IBXB 1I7HA 1AYFA 1ZUD2 3Q69A 2L0FA 3PS6A 3KUZA 2G45B 4JL9A 5CHVC 2L3ZA 1PGXA 2IWVA 4BZAA 3PQSA 2JYEA 4KIKA 2AQ1B 5EE1A 2NBWB 3PGSA 1IGDA 2LUEA 4RF1A 4E71A 1L2NA 2N9EB 4E1TA 3RI7C 3VH4B 4DHJD 4IUMB 3L54A 1UD7A 1CJEA 4IM2A 3WI5A 4EZKA 2O6VA 2L76A 3FILB 1J7CA 3I9V1 2EKIA 5G55A 4JE3B 1UF0A 3ZRFA 1WR1A 4GDKB 2AYOB 5CX3A 1ET9A 3NRZA 4BBNC 2LHDA 1ESFA 2GE4A 2MCNB 1M4VA 1VDVA 1ENFA 2MP2A 2JPHA 4IWQA 3B1LX 3LK42 1R4NB 1XO3A 3R7RA 3N1ZC 1N5XA 2GBNA 4FSPA 2KQ7A 4RM9A 4N58A 2KMCA 1VR9A 4DXFA 2GBMA 3NZ3A 4GLSC 2C60A 3NVWA 4KR8A 5BMGA 1S1QB 1ZDVA 1WJ6A
chains in the Genus database with same CATH topology
4K3BA 3Q6BA 4BZAA 3EFCA 3MC8A 2QCZA 3NJTA 2V9HA 2QDFA 3MC9A 4N75A 4C00A 2VH2A 4N74A 4K3CA 4C4VA 4C4VB 4PK1A 2MHJA 2VH1A 3OG5A 4XGAB 2X8XX 4QAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3B A;  3Q6B A;  4BZA A;  3EFC A;  3MC8 A;  2QCZ A;  3NJT A;  2V9H A;  2QDF A;  3MC9 A;  4N75 A;  4C00 A;  2VH2 A;  4N74 A;  4K3C A;  4C4V A;  4C4V B;  4PK1 A;  2MHJ A;  2VH1 A;  3OG5 A;  4XGA B;  2X8X X;  4QAY A; 
#chains in the Genus database with same CATH topology
 3TCA A;  2RDG A;  2BF8 B;  2KDY A;  3AA7 A;  2WP9 B;  2K8H A;  1YN3 A;  4XC2 A;  2IY1 B;  4ACF A;  3IAM 1;  4BBN F;  2Y0H A;  4HVB A;  4AYM C;  1IP9 A;  3Q3O C;  3CST A;  5DPT A;  4YSY B;  2LGY A;  3JTY A;  4FZL A;  2KVR A;  1KLV A;  4LNI A;  3NG0 A;  2Z0D B;  3NHE B;  3U4E G;  2LMC A;  2QC8 A;  4B95 A;  3RD2 A;  3VXW A;  3SYB A;  2RPV A;  2ZCC A;  1WGR A;  3HVD A;  4RM8 A;  4GGQ A;  3W1S A;  3VE2 A;  4G75 A;  2DYO A;  4KV2 A;  1IZN A;  1ET6 A;  2FID A;  1XEE A;  2LJ5 A;  4OZA A;  3RNE C;  1GG3 A;  2ZJD A;  4NPN A;  1FFU A;  2WXR A;  4O3W A;  1EF5 A;  3U52 E;  3UI3 A;  2JRI B;  1WMH A;  2N0S B;  2XEW A;  1P4T A;  2WXM A;  1SE3 A;  4AJW A;  3DWN A;  2GB1 A;  1VCB A;  1WJN A;  1GB4 A;  1V8C A;  3EHV A;  1ZPS A;  3VY8 X;  1FXT B;  3SFE B;  1UWM A;  3ZUN A;  2PE6 B;  2KLC A;  3AB5 A;  3RNC C;  3AE5 B;  3R2T A;  4US9 A;  4FN2 A;  4C7Z A;  4ARC A;  5AZG A;  2R2O A;  2D07 B;  1OSM A;  2E6X A;  6PRN A;  4A6Q A;  3AUL A;  4FSO A;  4CTD A;  2R8A A;  1ZOY B;  2M1M A;  4JGH B;  4GDK A;  1GJZ A;  1N62 A;  3ENE A;  1F52 A;  3OAW A;  3HM6 X;  4G0N B;  2OED A;  2FGR A;  5E6J A;  2V0G A;  3ZLZ A;  1QIL A;  3L16 A;  4XX5 A;  2I1J A;  4K7S A;  1BH3 A;  1NI3 A;  3VTU A;  2X9K A;  1L4D B;  4MH0 E;  2WS3 B;  4XNK A;  5DL7 A;  3QJZ A;  5G26 A;  1YN4 A;  2CJN A;  1WH3 A;  1IBX A;  1NBF C;  2VH1 A;  3T20 A;  3P4P B;  1KM7 A;  1NI2 A;  4DK5 A;  1XXG A;  4IM0 A;  3SY7 A;  2LRW A;  3L08 A;  2FCN A;  2W82 A;  3AE3 B;  4FMS A;  3ABV B;  4MEL A;  1JQ4 A;  3W1S C;  2CHX A;  3VUW A;  1SIF A;  4GMV A;  2QHO A;  2WXN A;  3N3K B;  3TJP A;  3UGB B;  3VZU X;  4LK0 M;  4H2A A;  1YQ4 B;  2DLB A;  3AE2 B;  3PRE A;  3TL5 A;  2GOW A;  4GCQ A;  5EE3 A;  3G7G A;  4RGM A;  4AKM A;  2JXX A;  3DHI C;  1L0X B;  4FAD A;  3W1Y A;  4PYZ A;  4PUX A;  3KYC D;  2B3A A;  4WWO A;  2QCZ A;  3ZDT A;  2QIE B;  1Q9G A;  2ASQ A;  3ONS A;  4ZYN A;  2WXK A;  5FR6 A;  3T8M A;  3W5U B;  3Q14 C;  1D4B A;  4FHK A;  3TIX A;  2DNF A;  4KKI A;  4AP4 C;  3M95 A;  3B2G A;  3LK3 A;  3MHS D;  1E54 A;  2C7H A;  4OVV A;  3N32 A;  2F1V A;  2LD9 A;  4KDI C;  2Y0L A;  5FK9 C;  2F1C X;  4W9C A;  1IUE A;  3L17 A;  2YVC A;  2VZK B;  2IGD A;  1OFF A;  4YTM B;  2XE5 A;  3O65 B;  2D5G A;  3FKY A;  1LQB A;  1TIF A;  3EC8 A;  2M56 B;  2XMX A;  2RPQ A;  2PLP A;  3OWE B;  1T1L A;  3WCQ A;  4HRS A;  1AW7 A;  2PMV A;  1WYG A;  4FQE A;  2ZZP B;  2MBO A;  2BGF A;  1HXT A;  1WXS A;  3NVV A;  4JLC A;  4BOZ B;  2MQJ A;  1T0Y A;  4RGO S;  2XBB C;  1LM8 B;  3TBL D;  2MJE A;  4Q2J A;  1WXM A;  3E56 A;  1JWB D;  5E6P A;  5BO4 B;  3IHP C;  4JX1 C;  2W54 A;  2XE3 A;  2YEP B;  2KT7 A;  2R2Q A;  3POU A;  3VR9 B;  5KAI O;  4ZHO A;  5HKH A;  1BUI C;  2RMM A;  3WAL A;  2PJH A;  2YPV A;  3I57 A;  4F8C B;  3EEC A;  2FE8 A;  4GSW A;  1I4G A;  4I6N B;  1JWM D;  3IT4 B;  1ZGU B;  3AED B;  5JXV A;  2LWP A;  4BFR A;  3AA6 B;  3A1Q B;  2FNJ B;  1EO6 A;  1SB3 C;  5GV0 A;  1SE4 A;  2KDI A;  3NVY A;  5ADX K;  3AE9 B;  3AU4 A;  4HJK A;  1TT5 B;  1VRA B;  5C2T B;  1I4P A;  2KX3 A;  3D32 A;  2KXP B;  3MFG A;  4G76 A;  3JSV A;  4XE0 A;  5J17 A;  4HRO A;  4CHK A;  5DPS A;  3WAN A;  3DHH C;  4FLH A;  1Q5W B;  2INP E;  3IT6 B;  4HXD A;  5IKC M;  2V9H A;  1FCC C;  1FNU A;  4HEA 1;  2DEN B;  4LNF A;  4EUT A;  2MP2 B;  3I63 C;  3PLV A;  4MM3 B;  2PVG C;  3ZGZ A;  2HE7 A;  4U9C A;  3H7P B;  4XYC A;  2V4L A;  1Z5S B;  1VD2 A;  3DWG C;  2G3Q B;  2XK5 A;  5LNK 1;  1E6E B;  1B9R A;  3IAS 1;  3GOE A;  1WX9 A;  4WUR A;  2Z8L A;  4NJ7 A;  1ORM A;  4EZL A;  1N63 A;  2JZ3 B;  1Y56 A;  3VRB B;  1JWS D;  1P98 A;  2MLB A;  3T24 A;  3UAQ A;  2KHW B;  2YLM A;  1RFA A;  2BW2 A;  1Q9F A;  1PGB A;  4FRT A;  3NY5 A;  4KIK B;  3KZI O;  4MH8 A;  1FNV A;  5IYU A;  3N9Y C;  1XCT L;  2GMI C;  2WX1 A;  3RT3 B;  1WYW B;  3VQI A;  2EMS A;  3GZN I;  2Y5C A;  1HXU A;  3AA1 A;  2KDF B;  2W81 C;  1F1H A;  2BKF A;  5L83 A;  1ZHX A;  2V4I B;  5CHF A;  1ZHZ A;  1EWC A;  1JRO A;  1MHH E;  1LGR A;  2OOB B;  1TY2 A;  1TBE A;  4LSI A;  2K22 A;  1H4R A;  2IO3 B;  1PDX A;  1K52 A;  2LVO A;  4EOY A;  2JT4 B;  2A5U A;  1R4M I;  1QJ9 A;  4YL8 A;  3AN1 A;  2VH2 A;  1EUV B;  1P1A A;  1GAQ B;  3BII D;  2MA9 B;  1WZ3 A;  2OMF A;  1QT9 A;  3AA0 B;  1WY8 A;  4NY0 A;  1BXW A;  4WJP A;  1ZHW A;  5HHD G;  1OQY A;  3MJW A;  1MG8 A;  2INC C;  3DA4 A;  3B2F A;  4LJP B;  3V6C B;  3Q3M C;  1PFD A;  3SFD B;  2AL6 A;  4EKU A;  3DBL B;  1YQ3 B;  3RMK C;  2RDB C;  5JDP A;  2L05 A;  4MSQ B;  2DHZ A;  3CMM B;  5D6J B;  4AUI A;  1STE A;  2R4O A;  1OTR B;  3T0S A;  3TZG A;  1VJK A;  3U7Z A;  2BYT A;  2O2V B;  1ZHY A;  2JUO A;  1RAX A;  4HPM B;  3H1U A;  3EGR A;  5GTH O;  2UYZ B;  4DHJ B;  3MC9 A;  2IJ0 A;  1FXA A;  5AFU K;  1HXY D;  5G3A A;  4P6V F;  3BRY A;  2W9N A;  3RZF A;  2J0K A;  3AEB B;  1UWX A;  2IDY A;  1WIA A;  2KVZ A;  3AA6 A;  1CQV A;  3JCU O;  2REX A;  1NEK B;  4Z3T A;  4KR4 A;  2WNM A;  3A9K B;  3DBH B;  3ML9 A;  2JY6 A;  1A70 A;  5CTR C;  4RLB A;  3T9L A;  3ETR A;  3VH3 B;  4BKS A;  2B76 B;  1GFP A;  1Q10 A;  5H92 C;  3SYS A;  2DZM A;  2LHE A;  1F9J A;  4WAF A;  1JRP A;  2KAC A;  2O4V A;  1YNT E;  3A0B O;  4NJ6 A;  1SXT A;  2Y5B B;  3Q8A A;  3FC4 A;  2SAK A;  3A4S C;  1V86 A;  1J7A A;  3KH0 A;  4DXA B;  1T0S C;  5J18 A;  3EUB 2;  2D3G A;  2IO1 B;  2LZ6 A;  4FT6 A;  1KJT A;  4IG7 B;  2WX0 A;  4YTP B;  4UDU C;  4IWO A;  3GE3 C;  4M00 A;  1ACC A;  2N2M A;  1WRI A;  2I1K A;  3P42 A;  3A4R A;  2NS5 A;  4K81 A;  1WGY A;  1NVI D;  2AEH A;  4W9L A;  4YT0 B;  1QOB A;  3R7Q A;  2DBY A;  3BZD B;  1MG4 A;  1OQQ A;  3BVM A;  2R89 A;  5B66 O;  2IZV B;  2ZVN A;  2WU2 B;  5GMV A;  1BXT A;  4GB9 A;  1P0R A;  5TIS O;  4LDT D;  5DPR A;  3PV1 A;  2XG6 A;  3N1X C;  4P7I A;  3AAA A;  2L52 A;  4O3Y A;  2O6V B;  3ZW3 A;  3AA0 A;  3PQU A;  3J9C A;  3C8Y A;  4W9D A;  4QQ1 A;  4OZC A;  2EKE C;  4I6P A;  4GXB A;  2WQY B;  4W9G A;  2Y5P A;  1E7V A;  2XTQ A;  3AEE B;  1QKZ A;  1JML A;  4XGA B;  2N7J A;  2BPS A;  2GLS A;  3RN9 C;  4TQ1 A;  2KNB A;  1WFY A;  4AOF A;  5L95 C;  5C1Z A;  3V8U A;  4LLG M;  5IP4 D;  4JCH A;  5AEK B;  1QJP A;  4DXG A;  4AJY B;  2G4S A;  1WGD A;  2ZNV C;  2GRI A;  1L7Y A;  3GZN B;  4YWG G;  4HJG E;  3MTN B;  2ZVO A;  4RCO A;  1XF5 L;  1EU4 A;  4JQW C;  1N5W A;  3EA6 A;  4XWW A;  2N4F A;  2M0A A;  4NQL B;  2KLG A;  1JAL A;  1XCQ L;  4XZ4 A;  4ZOH C;  1WRD B;  2IPK D;  5AFU L;  3CF6 E;  4HKQ A;  1MJD A;  3TEX A;  2JVC A;  3O13 A;  4MM3 A;  2HJ8 A;  3DPD A;  4FOZ A;  5IA7 A;  1UUP A;  2E3T A;  1SSN A;  4FZM A;  4RMA A;  4IC7 B;  4J3O D;  4PS3 A;  3IBE A;  2K6Q A;  3SHQ A;  4FZN A;  2KC0 A;  1DOX A;  3MJ5 A;  2CJO A;  1C77 A;  3PSE B;  2KJR A;  1R4N I;  3Q8C A;  3IXS A;  1GNU A;  2JWU A;  4CO7 A;  5D7G A;  1YN5 A;  2EMT A;  4QAY A;  1CZP A;  3BK2 A;  3MC0 B;  1C1Y B;  3VDZ A;  3P2B A;  2Y3A A;  1YJ1 A;  4BKG A;  2LHF A;  1L6V A;  2ONQ A;  2XE2 A;  4WWM A;  2JQR B;  3V60 A;  4MGK E;  2ZCB A;  3QHT A;  1WMH B;  1I35 A;  2WWZ A;  2D3A A;  2TSS A;  2W55 A;  1FEH A;  4RJX A;  4JFB A;  3DVN U;  1R7S A;  1WJ4 A;  3SZD A;  4HKZ E;  1XLQ A;  2K5P A;  2YEP F;  3B9J A;  4BUM X;  2AWT A;  2LUM A;  3RYT A;  4K3C A;  4IDI A;  2V3N A;  3LB8 C;  1I4H A;  4F1S A;  1L4Z B;  4MDK E;  4BKS D;  1TTN A;  3C5O A;  3OG5 A;  2PTL A;  4KVG B;  3AXC A;  4PJ0 O;  2Z0E B;  1E7P B;  4P1B C;  2DX5 B;  1YS5 A;  2CHZ A;  2WGS A;  4TUU A;  4XNL A;  4CYE A;  1NEN B;  2OJR A;  1TKG A;  2ACZ B;  2MNH A;  2KWU B;  1UGJ A;  5AUI A;  3QIJ A;  2DYB A;  5BYQ A;  1CMX B;  4W9H A;  4W9F A;  3H8H A;  5H8Y E;  4NJC A;  3C0R B;  4C4V B;  4KGR A;  2MJ3 A;  2ICI A;  3CWI A;  4BOS C;  2VRR B;  1JWU D;  4ANV A;  3TSS A;  1VLB A;  4IKG A;  4RF0 A;  1D5M C;  1C4C A;  5T5F A;  1Z2M A;  4M02 A;  3ZJT A;  2HTH A;  1OPF A;  2WU5 B;  2K6D B;  3VUX A;  2KC2 A;  3Q3N C;  4MSM B;  1T3Q A;  1YMH E;  3PZD A;  2D2Q A;  3JYU A;  2NBU A;  3P63 A;  3HUI A;  5KAF O;  1TJE A;  1QQR A;  2Y7S A;  1L0V B;  4K7U A;  1IPG A;  4WQM A;  3TEY A;  1WX7 A;  2WXL A;  3FYX A;  1ZKH A;  2JYT A;  2KC1 A;  2NPT B;  3AAE B;  4BKT A;  5H2F O;  1WJU A;  1LO5 D;  3N20 C;  4F7Z A;  2JRH A;  3OLM D;  1DGJ A;  3DBR I;  4XDD A;  4AS1 A;  3VUY A;  3HWB A;  1RRB A;  4LNN A;  2IGG A;  1FRR A;  3K9O B;  4L2Y A;  3RNF C;  3DBS A;  2LJI A;  4AYI D;  1SEB D;  2KN4 A;  3DOW A;  3HOL A;  4YTN B;  4TMA B;  2M0X A;  1ZXH A;  1THQ A;  1FNW A;  4HDQ A;  4LJO B;  1JW9 D;  4C56 C;  1FRD A;  4IWP A;  2KMA A;  2C5L C;  5EE0 A;  3M62 B;  2NVU I;  3WI4 A;  5FR3 A;  1PHO A;  4N9F 4;  4PYU A;  1UNS A;  2N9K A;  1V1O A;  3VZW X;  1V80 A;  4S17 A;  4EZJ A;  3BVG A;  1J0G A;  3U8Z A;  4PK1 A;  3R66 C;  2R4P A;  3PGE A;  1P3Q U;  2RR9 A;  4RH6 A;  4RJW A;  1KTK A;  4MJS A;  3UQB A;  1E8Z A;  3RZW C;  1QF6 A;  2L00 B;  4A3O A;  3AAE A;  5AZH A;  3KYD D;  3C19 A;  1TS4 A;  2OHF A;  1MFW A;  1GFN A;  2N7D A;  2DAJ A;  2GBK A;  2BYF A;  3W2D A;  5G39 A;  2PE9 A;  2KTR B;  2Y0K A;  2KJH B;  2K39 A;  4EFO A;  4L1B A;  1K50 A;  1F0Z A;  3AAA B;  4RGN A;  4S0R A;  2ZW1 A;  1XLO A;  2KAJ A;  1AN8 A;  1KFY B;  3HM3 A;  4FES A;  1HZ6 A;  2SEB D;  1V6E A;  2CR5 A;  3MP9 A;  1FMA D;  3I3T B;  4A90 A;  1TS3 A;  3LDZ E;  2LAS A;  2KXP A;  1QOG A;  2WXF A;  2JF5 A;  4B9K A;  2A4Z A;  4FJZ A;  4II3 B;  4JWS C;  4P1C C;  1HE8 A;  3DA3 A;  5E6N A;  5C3J B;  2IND C;  4OZB A;  2LFU A;  1HEZ E;  3A1Q A;  3APC A;  3H9D A;  4PS7 A;  5G38 A;  2ZEQ A;  4WIP A;  4DDI D;  3L0W B;  1GC7 A;  2QTK A;  3PT2 B;  3T3O A;  1XD3 B;  2J0J A;  3NS1 A;  4W9K A;  3U7D A;  3LXF A;  1H6S 1;  2RSU A;  5GXG B;  5BMH A;  4TKN A;  1XLN A;  2D10 A;  3DDC B;  1XT9 B;  1N60 A;  1OEY A;  1V1P B;  1IZN B;  2DWQ A;  4TV3 A;  3VTV A;  4F4B A;  3QQ8 B;  4II2 B;  2QEJ C;  1WGH A;  2WXO A;  2NBV B;  2KN5 A;  2POR A;  1L5P A;  4K1R B;  3KWL A;  5I4D A;  2HDE A;  4HPL B;  1PYW D;  2KZ7 B;  3AV8 A;  5HI1 A;  1AWD A;  2FAZ A;  4HLE A;  3AEF B;  4KGT A;  2G4D B;  3N30 A;  2BS3 B;  3VFK A;  5DPW A;  4MGZ E;  4USA A;  2J4X A;  1WZ0 A;  2L8J A;  4D5U A;  2LGX A;  2QDF A;  3LK4 1;  5JZE B;  1S3S G;  4ZYS A;  4O3Z A;  1TZO A;  2KFK A;  2ON8 A;  4FHJ A;  4DHZ E;  2X27 X;  3ZDM C;  2XN9 C;  4KGS A;  1C4P A;  4R3D A;  1WE6 A;  4XWT A;  3ZQ4 A;  2KD0 A;  1ZXI A;  5D94 A;  3ZJU A;  3ALB A;  1IYF A;  3PRZ A;  3SU8 X;  1EWY C;  2RDH A;  1N6Z A;  1C79 A;  2K8B A;  1AAR A;  4GN1 A;  1NDD A;  2KWC A;  1WGG A;  3AEG B;  1YQB A;  3PRN A;  2BYV E;  4GU2 A;  4IW0 A;  4E3C A;  4LDT B;  5DCN A;  3QAR A;  1YOV B;  3I5J C;  2LEK A;  2ZFG A;  2KX0 A;  3AM9 A;  2LFI A;  3OJ4 B;  3PLU A;  3U30 A;  1RM6 C;  2G9H D;  3Q6B A;  5IO9 A;  4TQ0 A;  2R4L A;  2AX5 A;  2C7N B;  3V05 A;  1D3Z A;  2ZW0 A;  3GB1 A;  3AMZ A;  3B0A A;  3QC8 B;  3WAO A;  1V5T A;  3P1M A;  1WM2 A;  4GCP A;  1SE9 A;  2MBB B;  4YXD B;  2FCM A;  3ZO5 B;  1DYQ A;  5JHB A;  1BML C;  3PZ8 A;  3RUL A;  2WXJ A;  2AXT O;  3AA1 B;  1JRU A;  1V81 A;  2Z59 B;  4BAX A;  2FIF A;  3LK2 B;  1TS5 A;  2LGS A;  1F2R C;  4O1N A;  2DZI A;  3VZT X;  2JXT A;  1E8X A;  3NUH B;  3DCG A;  1GFQ A;  1J19 A;  3R8B A;  3BS0 A;  4KSK C;  2G1E A;  4ZRQ A;  1C78 A;  2IY0 B;  1HZ5 A;  2N1V A;  3UQA A;  2NMQ A;  2GI9 A;  1TGZ B;  4C80 A;  2V3S A;  1VZ6 A;  5C23 A;  2J7Q B;  3BK1 A;  5FVN A;  2CHW A;  2L7R A;  3RPF C;  1C76 A;  5G5G A;  2C7M B;  1KF6 B;  4B0M A;  3Q8B A;  2UU7 A;  2BWE S;  4NZL B;  2NPT A;  3Q3J A;  2ERV A;  4GDL B;  3IVF A;  1PUT A;  3ZTC A;  2LGD A;  2VZK D;  2WJQ A;  2LGI A;  3O0E A;  5IOI A;  3HVZ A;  1UGM A;  1Y8R C;  1EM7 A;  2J42 A;  3PZ7 A;  2WXP A;  2KAN A;  1UBI A;  2XTR A;  4MGI E;  1MPE A;  2N1W A;  3H7P A;  2JWZ A;  1KH0 A;  2M19 A;  4HK2 A;  1UH6 A;  2JZP A;  2WHI A;  3AI5 A;  3NSG A;  2BS2 B;  4G3X B;  1ROE A;  3UF8 A;  3MHZ A;  4EEW A;  4PT5 A;  1TKY A;  3RNA C;  2LXA A;  3H6N A;  1F2R I;  4C69 X;  1F77 A;  4WAA A;  5MPO A;  3VVW B;  3PRM B;  1RFK A;  1YD8 U;  3UU2 A;  3JSV B;  1NYR A;  3V62 A;  2MX2 A;  3ZRC A;  1E90 A;  2J0M A;  3BVZ A;  4LCD E;  4NQK E;  3DQV A;  3PVL A;  4KZ0 A;  2KFK B;  3ZXV A;  1TS2 A;  2AQ3 B;  4MT5 A;  2KZ7 A;  2KTF A;  3KLS X;  2ZLD A;  3P4S B;  4AYD C;  5TSS A;  3BIN A;  4LNK A;  3KQ4 A;  2YNK A;  3BYY B;  2KFJ A;  4AWJ A;  3KUD B;  5JHA A;  2MEK A;  4DBG A;  1M94 A;  3IG3 A;  2FUG 1;  4XDC A;  2IBI B;  1QOF A;  1WE7 A;  1YIW A;  3M63 B;  3SD5 A;  5EE9 A;  1ZP0 B;  1J7B A;  4OHJ A;  2BKR B;  3VHT C;  2DZJ A;  1BT0 A;  2M06 A;  3H7S A;  3Q2A C;  3A9K A;  2BB6 A;  5EDS A;  5G2N A;  2WDQ B;  4K7W A;  3A9J B;  3P4R B;  2JZZ A;  4ICU A;  3ZNI D;  1MHX A;  4OVU A;  2AQ2 B;  2FGQ X;  5KHO A;  1GB1 A;  1Q1O A;  4IM3 A;  2WYQ A;  2PKO A;  4MGY E;  4ZRP A;  5BYR A;  2DYM A;  1E9M A;  3A2S X;  2WXG A;  3QRC A;  1P7E A;  3DWO X;  3FAH A;  3A0H O;  3ECI A;  4DHZ B;  4M01 A;  2FCQ A;  3P4Q B;  2O2V A;  1LXD A;  4L23 A;  1UZX B;  2N9L A;  3R3M A;  3VRA B;  5AZF A;  1HQR D;  1MPF A;  1DOY A;  3FIL A;  2QIL A;  4G50 A;  2ZNV B;  5E6O A;  3S2A A;  1GFM A;  2O6V D;  3Q3F A;  1TKE A;  3NZU A;  4JIO U;  1WGK A;  2M8S A;  3DZM A;  5T8I A;  1K53 A;  4GDL A;  4PS8 A;  2KWD A;  1WXV A;  3RNG C;  3V61 A;  3BY4 B;  2KQS A;  1DOI A;  1FPY A;  4O4X A;  1WXA A;  2BQQ A;  2PPH A;  3VAW A;  1YJI A;  4WWN A;  1V97 A;  3PHW B;  1E5W A;  4LSH A;  3AU5 A;  2KDB A;  2WDT B;  2PIA A;  3PF1 A;  3URY A;  1YJJ A;  3GE8 C;  1YX6 B;  3NZS A;  2MRP A;  4D65 A;  4MJS B;  2L83 A;  5LLI A;  2W3S A;  3LYY A;  1D6E C;  1T0Q C;  1P7F A;  3DHG C;  3LK2 A;  2D3B A;  4OVZ A;  1G90 A;  3AE1 B;  1E0Z A;  4N74 A;  1OGW A;  1WX8 A;  1SF0 A;  1E7U A;  2JU6 X;  4AYE C;  3WA0 A;  4LSE A;  2BB5 A;  1FXI A;  3RUI B;  3BYT B;  1SJE D;  3TMP B;  2WDR B;  4ZHP A;  4K3B A;  3PGU A;  2K9X A;  4ICV A;  3UIN B;  2LVQ A;  3MC8 A;  3AH7 A;  3X0W A;  4GHB A;  3POX A;  2DZK A;  3R2I A;  1KOT A;  1I4Q A;  1JWA D;  2BWF A;  2QJL A;  4MAC A;  4FJY A;  4M0W A;  2WVP A;  4OW0 A;  2I38 A;  1JCK B;  1ZW7 A;  4ZRK A;  3ZNZ B;  1E8Y A;  1WM3 A;  1TYG B;  1UBQ A;  3KVF B;  3VTW A;  2KDM A;  1V9J A;  2I2Y A;  1HA5 A;  2JSV X;  4FUV A;  2KYW A;  3V3X A;  1VZ7 A;  2BYE A;  2R4N A;  2M07 A;  2MBH A;  4FBJ B;  1GUA B;  4WJN A;  3DBH I;  4WQO B;  1A5R A;  5LXI B;  4IL6 O;  3PRP B;  4B6W A;  5HG2 A;  4I6L B;  4AFK A;  3UIO B;  5LXH A;  1T5X D;  5D2M B;  3BRZ A;  2BVC A;  1CK1 A;  1GFO A;  1KRH A;  4X57 B;  4RLC A;  1V49 A;  1QZE A;  2WXI A;  3VR8 B;  4ASW C;  4O4U A;  1N61 A;  3POR A;  1I42 A;  2M17 A;  3RFZ B;  4A20 A;  1QJ8 A;  4REZ A;  4ZRI A;  1H8C A;  4C4V A;  3AEC B;  3TUO A;  1MI0 A;  1HXX A;  2L0T A;  3GP6 A;  2BT6 A;  4UB8 O;  2R61 A;  4G11 A;  3GP7 A;  3L10 B;  3ZJV A;  4AYN A;  1UEL A;  3V6E B;  1G6J A;  2AL3 A;  3A9J A;  3IFW B;  1SE2 A;  3APF A;  4NAW A;  5TR5 A;  1EF1 A;  3POQ A;  3DBL I;  5IAA C;  5B5E O;  1T6B X;  3TEZ A;  4NAW B;  1FO4 A;  4B61 A;  1P9D U;  2NR2 A;  4HWI B;  1PGA A;  1SIJ A;  4DDG D;  5DL5 A;  4WJQ A;  3X23 A;  4UB6 O;  2PRN A;  2J4U P;  4J6I A;  2NCN A;  1C9F A;  3WAP A;  3AE8 B;  1ZE3 D;  1V5O A;  3VY9 X;  2K4T A;  4ARI A;  2M4N A;  5G5H A;  2KJ6 A;  3HRD D;  1I4X A;  4E1S A;  4E74 A;  2Y2X A;  2PW9 A;  2BTE A;  2NTS A;  4N75 A;  1T0R C;  2ODJ A;  3Q8F A;  3L13 A;  1LFD A;  3CIR B;  3HK0 A;  3NS8 A;  2HTM E;  1FCL A;  2N7E A;  1K8R B;  2WXH A;  2MH7 A;  3T3N A;  3AA7 B;  3SDL C;  4YSX B;  2J52 A;  5IN7 A;  3DVG X;  3HIZ A;  1FIQ A;  4HPP A;  1GC6 A;  2IGH A;  4DQO C;  2DAF A;  2MSE D;  3PHX B;  2KOX A;  3DVG Y;  4M0W B;  2JQY A;  1HTO A;  2FBW B;  4GCS A;  2GBJ A;  4TSS A;  2CU1 A;  3WU2 O;  3JW0 X;  4A9A A;  2KO3 A;  3SR6 A;  1RLF A;  4W9E A;  1NYQ A;  3APD A;  2W80 C;  3LK3 B;  4FUL A;  4BVU C;  1WWT A;  2JMM A;  2PEA A;  1WF9 A;  4FRX A;  1KLG D;  3LJ3 A;  4A55 A;  1SJH D;  2LRU A;  5DL8 A;  4ITK A;  2QSD A;  3B08 A;  4LNO A;  1V2Y A;  1RWS A;  2V1Y A;  4AUQ C;  4RL9 A;  3AEA B;  1BT9 A;  3EMN X;  2K25 A;  2KDE B;  3AE7 B;  3SY9 A;  2LXC A;  2MBE A;  2KMM A;  1L0Y B;  2K0L A;  1L6U A;  1T16 A;  4KRA A;  4ZDV A;  3ZNG C;  4C7Y A;  5KHQ A;  3Q8E A;  2EEL A;  2UWQ A;  2XK5 B;  4CQN A;  3ZKJ C;  3AE6 B;  4P16 A;  2ZPY A;  2HJ1 A;  2L32 A;  2MW5 A;  4N59 A;  2KXJ A;  3L4P A;  4DWF A;  4KX6 B;  5BYS A;  4RNA A;  2WDV B;  3E9S A;  3ZYY X;  3SZV A;  2JX5 A;  4HDO A;  4B0E A;  2HD5 B;  2IO0 B;  2BS4 B;  5BMI A;  1YX5 B;  1WXQ A;  7PRN A;  3KWV A;  3DWM A;  4US8 A;  1IGC A;  2H88 B;  2OJW A;  1VZ8 A;  5EE2 A;  3N1Y C;  1MM4 A;  3PPA A;  4WWP A;  1QLB B;  5DL6 A;  2QMT A;  2KQ4 X;  2W3R A;  4D64 A;  1KLU D;  4JPS A;  3RNB C;  3RBH A;  4AZL A;  4M8N A;  2L1A A;  4NAM A;  2J53 A;  4AKR B;  1C3T A;  4IOI E;  3JVZ X;  2WLB A;  4GF4 A;  4D2K A;  1ZDX A;  1C4A A;  2N9P C;  1I4R A;  4A8X C;  3NVZ A;  5CHW A;  1EU3 A;  3ZXR A;  3KVD D;  4M8M A;  5E79 O;  3WAM A;  1J8C A;  1E8W A;  1RYJ A;  4O3X B;  4ANX A;  2N2L A;  2GBR A;  2MJD A;  3QX1 A;  1SBB B;  2K8C A;  4RGT A;  1FM0 D;  3QWZ B;  3ZNH B;  3TEW A;  3OJ3 A;  2RD0 A;  4A3P A;  4ANW A;  1OEY J;  2K3U A;  2MBQ A;  1HTQ A;  4PR7 A;  2CKH B;  1PRN A;  2BBC A;  3HW9 A;  1XLP A;  3NOB A;  1V1P A;  3ML8 A;  4KSL C;  2IO2 B;  4KKJ A;  2CU3 A;  3W9C B;  3QAQ A;  5D5D A;  2XNA C;  1GPX A;  3EFU A;  5HFY A;  2MHL A;  4WJO A;  1SGH A;  2MHJ A;  2KKC A;  2N9X A;  1TY0 A;  1S5L O;  2XE1 A;  2D3C A;  1D5Z C;  2MWS B;  1ISN A;  1GOZ A;  1E10 A;  2KK8 A;  4HCP B;  2FUH B;  2LVP A;  5GTI O;  5ADX L;  4URK A;  4N6E B;  3DBR B;  4ZRJ A;  3VE1 A;  2IYD B;  3M3J A;  1MM5 A;  1R4M B;  4JWU C;  3PTF C;  3UIP B;  5JH5 C;  1WR6 E;  2J1N A;  2INN E;  3ZTD A;  4LSF A;  3U2S C;  5D3I B;  3AE4 B;  4YSZ B;  3K19 A;  3QRA A;  2KWV B;  2X8X X;  3PO0 A;  2WXQ A;  3RCZ A;  2IWW A;  2H89 B;  4AKR A;  4W9J A;  4FXC A;  2ZPN A;  5AUK A;  4KDL B;  1WI0 A;  2WJR A;  4C00 A;  4GIV A;  4EE2 A;  4FA6 A;  3BWU D;  1WSP A;  2RGF A;  3KUC B;  4W9I A;  3K9P B;  2KTR A;  4LTU A;  4NNJ B;  8PRN A;  3QCA A;  2C9W B;  4RFB A;  1QOA A;  2Q5W D;  5PRN A;  3QK0 A;  2FCS A;  4MEM A;  3W5V B;  4KZC A;  3WIM A;  3HHM A;  2F1T A;  3NJT A;  4WH4 A;  1ZHT A;  1Q0W B;  3KW5 B;  3SEB A;  4O49 A;  3ZVV A;  1OQR A;  2V3P A;  4FJV B;  3A33 B;  1FFV A;  2CS4 A;  5FKA C;  1FD6 A;  1U4A A;  3UPG A;  1TZ1 A;  2D11 A;  4HCN B;  2NTT A;  3ZIM A;  5D3D A;  4AQ7 A;  1PQS A;  3GS2 A;  1B1Z A;  4GOC A;  3EFC A;  5J2R A;  2PVO D;  1D5X C;  3QA8 A;  4ANU A;  3HOE A;  3DVN V;  2K0P A;  2KZR A;  2LI5 A;  2X38 A;  1K51 A;  2R88 A;  1X1M A;  1XQQ A;  2K1F A;  1MVK A;  3PGR A;  3CSF A;  1IBX B;  1I7H A;  1AYF A;  1ZUD 2;  3Q69 A;  2L0F A;  3PS6 A;  3KUZ A;  2G45 B;  4JL9 A;  5CHV C;  2L3Z A;  1PGX A;  2IWV A;  4BZA A;  3PQS A;  2JYE A;  4KIK A;  2AQ1 B;  5EE1 A;  2NBW B;  3PGS A;  1IGD A;  2LUE A;  4RF1 A;  4E71 A;  1L2N A;  2N9E B;  4E1T A;  3RI7 C;  3VH4 B;  4DHJ D;  4IUM B;  3L54 A;  1UD7 A;  1CJE A;  4IM2 A;  3WI5 A;  4EZK A;  2O6V A;  2L76 A;  3FIL B;  1J7C A;  3I9V 1;  2EKI A;  5G55 A;  4JE3 B;  1UF0 A;  3ZRF A;  1WR1 A;  4GDK B;  2AYO B;  5CX3 A;  1ET9 A;  3NRZ A;  4BBN C;  2LHD A;  1ESF A;  2GE4 A;  2MCN B;  1M4V A;  1VDV A;  1ENF A;  2MP2 A;  2JPH A;  4IWQ A;  3B1L X;  3LK4 2;  1R4N B;  1XO3 A;  3R7R A;  3N1Z C;  1N5X A;  2GBN A;  4FSP A;  2KQ7 A;  4RM9 A;  4N58 A;  2KMC A;  1VR9 A;  4DXF A;  2GBM A;  3NZ3 A;  4GLS C;  2C60 A;  3NVW A;  4KR8 A;  5BMG A;  1S1Q B;  1ZDV A;  1WJ6 A; 
#chains in the Genus database with same CATH homology
 4K3B A;  3Q6B A;  4BZA A;  3EFC A;  3MC8 A;  2QCZ A;  3NJT A;  2V9H A;  2QDF A;  3MC9 A;  4N75 A;  4C00 A;  2VH2 A;  4N74 A;  4K3C A;  4C4V A;  4C4V B;  4PK1 A;  2MHJ A;  2VH1 A;  3OG5 A;  4XGA B;  2X8X X;  4QAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...