4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
2QCZA 2VH1A 2X8XX 4XGAB 3OG5A 3MC9A 4C00A 4K3BA 3EFCA 2V9HA 3Q6BA 4BZAA 4PK1A 4C4VB 4N74A 4K3CA 2QDFA 2MHJA 3MC8A 3NJTA 4QAYA 2VH2A 4N75A 4C4VA
chains in the Genus database with same CATH superfamily
1KF6B 1V8CA 4DXAB 3PPAA 2KJ6A 2IPKD 1C76A 1SGHA 3MFGA 4FOZA 4K3BA 3BZDB 1MPEA 3MP9A 1M4VA 4FMSA 2KFKA 3EA6A 1UWXA 2B3AA 1XCQL 1LQBA 2MRPA 5C3JB 3O0EA 1XEEA 3BVMA 1WI0A 5ADXK 2Z0EB 1JALA 3DHGC 4KV2A 2MJEA 3Q8FA 4N6EB 3HW9A 4PYZA 2BWES 1L2NA 4A3OA 1GC6A 5C2TB 3CSTA 1AW7A 5JXVA 1HXXA 3AA7A 2YVCA 3UQAA 2R61A 4WWPA 3P4QB 3JTYA 4WJOA 4AS1A 3SHQA 3DA3A 2NR2A 5H8YE 5JHBA 5D2MB 1YNTE 2IO0B 2DX5B 1Q9GA 8PRNA 4CTDA 4EZJA 3ETRA 2GBNA 2MW5A 3ZTDA 3RNGC 4OVZA 3NS1A 4FZNA 2M8SA 1KRHA 5G55A 3HVDA 2DAFA 1ZHWA 1E8YA 2AWTA 4JWUC 2Y0HA 3L13A 4B0EA 2C7NB 3AE1B 4TQ0A 2R4OA 3ZGZA 4ANWA 2KMCA 2EKEC 1A5RA 4AUQC 2B76B 4K81A 2VRRB 3QK0A 2DYMA 3ZDMC 3MC0B 2IGGA 3LK3A 2KZ7B 3OLMD 3QRCA 1EU3A 2MWSB 2AQ2B 3QIJA 2YPVA 4XX5A 3CMMB 4KZCA 3AAAB 1WX7A 3AXCA 1U4AA 4N74A 1FCLA 2CHXA 2WXNA 4ACFA 4FESA 3CF6E 1GFQA 2LGYA 4WAAA 1HTQA 3L54A 1FPYA 2JQYA 2M19A 2V4IB 6PRNA 2Y3AA 3DBSA 4MT5A 1SF0A 3AE9B 2IYDB 5AUKA 3LXFA 3N3KB 1BXWA 2D3BA 5G5GA 1SIJA 1IYFA 5E6NA 2Z59B 1T0YA 4JE3B 2PPHA 4ZHOA 4BKGA 1JROA 1Y56A 3W5UB 5HI1A 2KXPB 2KMMA 2RDHA 1FRDA 3B9JA 1JW9D 4JIOU 2KD0A 3E9SA 3PVLA 3ZXVA 4BBNC 2KXJA 2KQSA 4DXGA 3PZDA 3L4PA 4PR7A 1PGXA 1YOVB 2O6VA 4O49A 1XLOA 2ZPNA 3AU5A 4P7IA 2JYTA 4HPMB 2JU6X 2LGDA 3M3JA 2KKCA 1TIFA 2Y5BB 3PORA 2BS3B 3HK0A 4DHZE 2PKOA 2KC1A 3AM9A 3HOEA 4W9LA 4AYDC 1C3TA 1BUIC 3NSGA 1N61A 4BZAA 2LVQA 4ICVA 3WANA 3PRMB 3N9YC 2ON8A 5KHOA 2EELA 3UU2A 3U8ZA 3QX1A 1P7FA 4PYUA 4LSEA 1FFUA 3MJWA 4NQLB 4BKTA 4KKIA 2FAZA 1BT0A 4TKNA 3DBLI 1E10A 3A9KA 2X27X 1GFNA 1WM2A 1R4MI 2MBEA 2KC0A 2XTRA 2BW2A 1Q0WB 2R4LA 2WDRB 1EF1A 2M06A 3RMKC 1SB3C 1WIAA 3N20C 3DVGY 2KWDA 1L4DB 3QJZA 5KAFO 4LSIA 1SE9A 3P42A 4KZ0A 1G6JA 3UAQA 1C9FA 1QOGA 1IUEA 2GLSA 2J4UP 2AL6A 1RFAA 1OFFA 4RGTA 4DWFA 4X57B 5GV0A 3Q3MC 1WYGA 2MHLA 1J8CA 2V1YA 4AZLA 5KAIO 2BBCA 3AA7B 4B61A 2JWUA 2PVGC 3B1LX 4II3B 3NOBA 4CO7A 3L16A 1D5ZC 2VZKD 2N7DA 2GBJA 3RULA 2R2OA 2NPTB 3ZLZA 2PMVA 3A9JB 2K6DB 2LI5A 2LASA 4O3XB 4XWWA 4M8MA 2W54A 1VDVA 3ZRCA 1WJNA 2L52A 2J0JA 4XWTA 3DPDA 4OZCA 2LUEA 4LNKA 1RLFA 1QJ8A 3VQIA 4M02A 1C4AA 3OG5A 1HXTA 4HPPA 1YJJA 3PS6A 4MJSA 2KAJA 3APFA 3BVGA 3PLUA 3DCGA 2JQRB 1QF6A 5L95C 1ZPSA 2UU7A 2ZNVB 3ZDTA 1WGRA 3UIPB 2NBWB 2FUHB 1ZHTA 1YQBA 1B9RA 3V8UA 5DCNA 1N5XA 4URKA 1WXAA 2EMTA 3PGRA 4GMVA 1E6EB 5IA7A 1GB1A 4MELA 3I3TB 2WXHA 4XE0A 3WA0A 2CHWA 4B95A 2OJRA 3FILA 3RPFC 4ZRPA 4LNIA 3R8BA 3ECIA 2BS2B 2KDEB 1UF0A 3MC8A 4HPLB 2K8CA 4EZLA 1D5MC 4O3WA 5JHAA 3VVWB 3U2SC 2IY0B 3KZIO 1EM7A 4IC7B 1D4BA 3OJ4B 4NY0A 1DOYA 1WRIA 2Z8LA 2MBQA 2BS4B 2KQ7A 3NZSA 2ZVNA 4IM0A 4HLEA 3TEYA 4DHZB 3NHEB 1J7BA 2N1WA 1GFMA 4YL8A 3BS0A 2WXLA 4BUMX 3P1MA 2MJ3A 3VY8X 1WY8A 1HXYD 2N0SB 3AEGB 3VR9B 4OHJA 4FUVA 4C56C 1NI2A 5DL5A 2JZZA 1QQRA 3VTVA 2KMAA 4RGOS 1BH3A 5KHQA 1IBXA 2D11A 5LXIB 4FJZA 3D32A 2L0FA 3DBRB 3AE2B 3NUHB 3A0BO 5HKHA 4E71A 1WJUA 5D3DA 5E6JA 4MACA 3V6CB 2KDFB 2UWQA 4RLBA 2LRUA 3R3MA 2KHWB 4HROA 5G38A 1FNVA 4ZHPA 1ZP0B 2G3QB 5AFUL 2GRIA 1I42A 3EECA 2D5GA 4JCHA 5B5EO 2ZCBA 4RH6A 1DYQA 5JZEB 3WCQA 1RM6C 3DWMA 3KUDB 2AQ3B 3PQSA 5EE9A 2WNMA 3PRPB 2JPHA 2KDIA 1XLQA 4HEA1 3SR6A 1L0YB 3PF1A 3R7RA 1WF9A 4HRSA 3M95A 4HJKA 5TISO 1PFDA 1EU4A 1DOXA 1TS5A 4ANXA 1F52A 1WZ0A 4D2KA 1WGYA 5J18A 1C79A 2IGHA 3AE3B 2J42A 1FM0D 5BYRA 2N1VA 3VXWA 2VH2A 4KX6B 3FKYA 5GTIO 2HTHA 2WJRA 2M0AA 2WJQA 3SZDA 3VUWA 2NVUI 3KQ4A 2G45B 1WRDB 3PHWB 3IG3A 1OEYJ 2KVZA 1WWTA 5MPOA 2N9KA 4RCOA 1P9DU 2SAKA 3Q8AA 3DWNA 3ZO5B 3JW0X 1KOTA 4C69X 3QA8A 2M17A 2BB5A 3ZW3A 1TS2A 1IZNB 3SY9A 2KZ7A 2WXQA 1K53A 3V62A 2WXPA 1PGBA 1MG4A 3AE7B 2QCZA 2PW9A 4WAFA 2R8AA 3AAAA 1TY0A 5C1ZA 1SSNA 1D3ZA 2XE3A 5L83A 1YMHE 3R66C 3VDZA 4O4XA 3POQA 4KR8A 3CSFA 2LXCA 3R2IA 2NMQA 4IL6O 2J0MA 2KACA 4KSKC 4RM9A 1XF5L 4WIPA 3TMPB 5DL7A 1P3QU 4US9A 3Q8BA 1D5XC 1TY2A 5DPSA 4AFKA 2FNJB 2L7RA 5DL6A 3ABVB 2RPQA 2WYQA 1PUTA 2MNHA 1N62A 1VJKA 1L6VA 2QSDA 3I9V1 5EDSA 1I35A 3CWIA 2Y5PA 1PDXA 3EFCA 3EFUA 1ORMA 1KLGD 2IWVA 1XLPA 3APDA 1UELA 3TSSA 1ENFA 1XQQA 3AMZA 1FO4A 2ERVA 1TKGA 1XO3A 4GOCA 4YXDB 4FJYA 3VUYA 4W9JA 4ZYSA 2K3UA 3ZNID 2JRHA 1GFPA 4G76A 1V86A 4DQOC 5AUIA 1T0RC 4TQ1A 1JRPA 4GU2A 1K51A 1MM4A 3P4PB 5G3AA 4S0RA 4KRAA 2LD9A 4RL9A 2MH7A 1ZHZA 4GHBA 1TS3A 4Q2JA 3TUOA 2L8JA 4YTNB 2O2VB 3PSEB 5D6JB 4GDLA 5FR6A 1CJEA 4G3XB 2D07B 4NJ6A 2M56B 2WX0A 4DDID 4MH0E 1YQ4B 1FNUA 3H9DA 3SEBA 4YSYB 4IWOA 1TT5B 5H92C 1TZOA 1TS4A 2MBHA 1RFKA 3N32A 5G2NA 5JDPA 4FZLA 1NYQA 4ZYNA 2O6VD 2GI9A 2WS3B 4LNNA 3DVNU 4OZBA 1BT9A 2DLBA 3SFDB 2GE4A 5EE3A 2KOXA 2WXMA 3MJ5A 1ZUD2 1CK1A 2X8XX 2BGFA 1JWSD 4LJOB 4PS7A 2FGRA 1XXGA 2LGIA 3O65B 1C78A 5FR3A 2D3AA 2BTEA 1WE6A 2E3TA 1OTRB 3EHVA 3R2TA 2DWQA 3TEXA 1SBBB 2NCNA 3RD2A 3IT4B 4XNKA 3MHZA 2AL3A 4LJPB 1S1QB 4XYCA 3GS2A 4M0WB 1OGWA 1S5LO 3AECB 3BYYB 2ONQA 2TSSA 3HOLA 2K0PA 3JYUA 2LVOA 2BPSA 3T0SA 2WXGA 5J2RA 4IKGA 1T16A 5D7GA 1JCKB 4REZA 2BYEA 2QDFA 2WXJA 2INCC 3C8YA 4FHKA 2NPTA 3ENEA 3ML8A 3A9JA 2LWPA 3C19A 4IM2A 1HE8A 2KTRB 3VUXA 2M4NA 3Q8CA 4W9HA 1TKYA 2XTQA 2GB1A 3M62B 2JMMA 2N9PC 2DHZA 2L76A 2G9HD 2WXFA 5IO9A 1TTNA 2K8BA 3DWOX 1SJHD 3U30A 3BINA 4LNOA 3EC8A 2INDC 4H2AA 1DGJA 2ZCCA 1OPFA 4ARIA 1IGCA 3WI4A 2GBMA 1FNWA 3PZ7A 4IWQA 4KGSA 1J0GA 2JX5A 1ET9A 5CX3A 4HXDA 4F7ZA 4JQWC 3WI5A 2WHIA 3QRAA 4F1SA 2L05A 4FJVB 1IPGA 1SE2A 5G26A 2V3SA 4OVVA 4L1BA 2RDGA 3Q3NC 4C4VA 4ZRIA 1VLBA 3POUA 4AQ7A 1GNUA 3DBHB 2EMSA 1PYWD 3C5OA 3KVDD 3AN1A 1N6ZA 2H89B 1E0ZA 1ACCA 2J7QB 5T5FA 3RCZA 4FADA 3GP7A 4A3PA 2JZPA 4MGZE 1TYGB 1L5PA 3A4RA 1VRAB 2N9EB 2X9KA 2C9WB 4W9EA 1N63A 2JZ3B 2N2MA 1V80A 3RNAC 4BOSC 1E8WA 1MI0A 2D2QA 5CHVC 3RUIB 1V97A 2CJOA 3P2BA 3PGSA 5GMVA 2KDBA 1VZ7A 3AE4B 2BVCA 4JFBA 3H7PA 1KM7A 1NEKB 4G75A 1RYJA 1ROEA 2CHZA 3IT6B 4J6IA 4IDIA 4W9DA 2LFIA 3QHTA 3BK2A 1WZ3A 1NI3A 2HE7A 1F2RI 4DK5A 2KZRA 1CMXB 2ICIA 2WXKA 3L0WB 4AJYB 2CS4A 1H8CA 2E6XA 4GDLB 3TBLD 5LNK1 5GXGB 1IGDA 1GC7A 4LTUA 1V5OA 3T3OA 2KVRA 4GN1A 4FT6A 3W9CB 4W9KA 2KTFA 4P1BC 4K7WA 1ESFA 3AV8A 5FVNA 5IP4D 3VAWA 4TMAB 3ZIMA 2XE1A 5E6PA 2Y7SA 4B0MA 4TUUA 2PJHA 2JRIB 4MM3B 1UZXB 1WSPA 3K9OB 2CJNA 1YS5A 2C60A 2W3SA 1GAQB 1SE3A 5HHDG 2KO3A 1T1LA 3V6EB 4BAXA 3BIID 1R7SA 5G5HA 3P63A 3DBRI 3GE3C 3AH7A 1P1AA 4AKRB 3ZJUA 4HDOA 1QOFA 1JQ4A 2RGFA 1YJ1A 3LYYA 1TKEA 2FUG1 3MHSD 3H8HA 3TJPA 5LLIA 3V3XA 2I2YA 3HVZA 3HM3A 5BYQA 2MBOA 4W9FA 3BWUD 2G4DB 1THQA 1STEA 4FZMA 4QQ1A 1ZXHA 3U7ZA 3X23A 1I4HA 1K52A 3KW5B 1IZNA 1TBEA 2NS5A 1P4TA 3DHIC 2K8HA 2NTTA 4FRXA 3N1XC 2KDYA 4EZKA 2QILA 4A8XC 4AP4C 3SYSA 2K39A 3M63B 2KYWA 3EGRA 5EE2A 3O13A 4NPNA 3VH4B 2L00B 3A33B 3NY5A 2ZPYA 4F4BA 1MPFA 2YNKA 2DBYA 3AEDB 3Q8EA 2M1MA 3Q3JA 1UBQA 2JT4B 4FSPA 4MGKE 3NVVA 3ZNGC 3H6NA 3RZFA 1NBFC 2BKRB 5CHFA 1FCCC 5H2FO 3FAHA 1L7YA 4QAYA 1Q9FA 1C1YB 2LFUA 2DZMA 4FXCA 5HG2A 3VHTC 1N60A 4AYEC 1TGZB 4KDIC 4W9GA 1WR6E 2JYEA 2JXTA 4RJXA 1L6UA 4C4VB 1RRBA 4NAWB 4XC2A 3ALBA 4OVUA 3WU2O 3PREA 3I63C 2ZZPB 1UH6A 4CYEA 1WFYA 2F1CX 1J7AA 4KGRA 2HD5B 1RAXA 2LJIA 5IOIA 2KLCA 1GOZA 4AYNA 4YSXB 2O2VA 2R4PA 4RM8A 4C00A 2HJ1A 2V0GA 3B08A 3P4SB 2JSVX 2IWWA 4NZLB 3DA4A 4HJGE 2FIFA 4OW0A 2Y0KA 3N30A 3H7PB 2V3NA 3QWZB 1XCTL 4B6WA 3KH0A 5IYUA 5J17A 3BYTB 3AEEB 3ZKJC 4USAA 1WXVA 4G0NB 3QC8B 3GP6A 1D6EC 4CQNA 4D65A 5TR5A 1SEBD 4UB6O 1HQRD 3VZUX 2IGDA 4N75A 5C23A 4DHJB 2ASQA 2H88B 4OZAA 4MEMA 4MSMB 4IM3A 3TEWA 5G39A 3GOEA 3AA0B 3N1ZC 1HTOA 3AU4A 1YIWA 4D5UA 4W9IA 2KN4A 4WJQA 4O4UA 2XE2A 3I5JC 3QCAA 4M0WA 1GG3A 2HTME 4FRTA 2YEPB 2V3PA 2J52A 2J1NA 4LSFA 2FCSA 4ARCA 4K7UA 3AE8B 2NBUA 4JX1C 4HKQA 1Z2MA 1FFVA 1XLNA 1L0VB 1V1PB 2LGSA 3TEZA 1QLBB 2PEAA 4IWPA 1TZ1A 2D3CA 4A90A 1SIFA 1OQRA 2CKHB 3H1UA 2KTRA 4WWNA 2N9XA 3K9PB 3AA1A 2GMIC 4CHKA 1WYWB 1I4XA 4G11A 3Q3FA 2ZEQA 4PS3A 5GTHO 2WVPA 4XGAB 3GZNB 5ADXL 4PS8A 1V6EA 3KWVA 3G7GA 2PE9A 4HWIB 3EUB2 4ITKA 3VTUA 2FIDA 2N7JA 4LK0M 1ZE3D 1PRNA 4NNJB 5LXHA 4DDGD 3A4SC 4XNLA 3ML9A 2M0XA 3RNEC 1J19A 4O1NA 5D5DA 2KT7A 2FBWB 1HZ5A 4NJCA 3POXA 1UBIA 4GGQA 2N2LA 3EMNX 1J7CA 2OEDA 4A55A 4WJPA 4GDKB 2C7HA 2OJWA 3TIXA 5DL8A 2R88A 1P7EA 3LK2B 1AWDA 4US8A 3UIOB 3AB5A 3VZTX 4E74A 1FXAA 2G1EA 4WH4A 1WJ6A 3UI3A 2ZVOA 2LMCA 2Q5WD 4E3CA 1LFDA 1LXDA 2BQQA 3W5VB 4I6PA 1GB4A 1L4ZB 2WGSA 2KANA 1GUAB 4YWGG 3DZMA 3PGUA 4HK2A 2KNBA 4ANUA 2PRNA 3MTNB 3P4RB 4LNFA 1FD6A 2BF8B 4ZOHC 3PO0A 3ZVVA 1VZ6A 3WAMA 2K6QA 1ZW7A 2KFJA 1PHOA 1E8XA 2ZFGA 2C7MB 2W81C 4K1RB 1UUPA 3AI5A 2BWFA 1CZPA 3Q69A 3IAS1 2ZNVC 1ZDVA 3DBHI 3OAWA 1ZGUB 1T0QC 4FULA 2Z0DB 3RNCC 4ZDVA 2LRWA 3UPGA 3NS8A 4GSWA 1EF5A 4WWOA 1Q10A 3HWBA 4S17A 3PGEA 4W9CA 1SE4A 4I6NB 4PUXA 4LSHA 3PHXB 4Z3TA 4JPSA 5AZFA 4PT5A 1GFOA 2FE8A 3RNBC 1LM8B 1ZOYB 1WH3A 1F2RC 3HIZA 2IO2B 3UINB 3JSVB 1QJPA 1MM5A 2XK5B 1ZKHA 3APCA 4NJ7A 1ISNA 4RF1A 2WU5B 1UNSA 1WM3A 1XD3B 4MM3A 2INPE 3ZNHB 3PRZA 2INNE 3DDCB 3TCAA 1JWMD 2MP2B 2G4SA 5AZHA 2QHOA 1SXTA 5IN7A 2LJ5A 2MEKA 3BRYA 4AKRA 1CQVA 2L83A 4LDTB 3ZNZB 3AAEB 1WGGA 4II2B 2WP9B 4YSZB 2M07A 3NJTA 3DOWA 3KVFB 1HEZE 2DENB 2LGXA 3PRNA 1ET6A 2J4XA 3PV1A 2LXAA 2R4NA 4IOIE 5D94A 1SJED 4N9F4 1JWBD 3FYXA 3NVYA 3BVZA 2WU2B 3AE6B 1P98A 4WURA 5CTRC 3KYCD 4FA6A 1QJ9A 2J0KA 1WGKA 4XDDA 4GCSA 2IBIB 4KIKA 4AJWA 2GBKA 2JF5A 5IAAC 3WAPA 3AA1B 2Y0LA 3IHPC 3IBEA 3Q14C 4WWMA 4PK1A 1N5WA 3IFWB 4ANVA 3VR8B 2VZKB 3KYDD 5HFYA 4U9CA 2DNFA 1L0XB 3C0RB 2W82A 2R89A 3OWEB 3DVGX 4KSLC 2D3GA 2XEWA 4FQEA 4FHJA 4P1CC 7PRNA 3PLVA 4E1SA 1WE7A 3T9LA 3ZXRA 5I4DA 1E7UA 2K4TA 2I1JA 1I4GA 5FKAC 4FBJB 2V9HA 5AEKB 2LHEA 2N9LA 3N1YC 3JCUO 2DZIA 2OOBB 1H6S1 1R4NB 4NQKE 2KWCA 3Q3OC 3L10B 1ZHXA 1FRRA 4GB9A 3B2FA 4NAWA 2WDVB 2JY6A 2RD0A 4GIVA 2K5PA 1NYRA 3HM6X 4HCNB 3VY9X 3ZYYX 1YN3A 2QC8A 3IAM1 1C4CA 2AQ1B 1B1ZA 5BO4B 4F8CB 2R2QA 2KN5A 2MLBA 4BKSA 2ZW0A 5FK9C 3J9CA 3BK1A 3W1SA 1WMHA 4LCDE 4A6QA 2IO1B 3A1QA 1T6BX 4KR4A 4JLCA 4KKJA 2XN9C 3DWGC 1VD2A 3IXSA 1WJ4A 2UYZB 2WX1A 3W2DA 1FXIA 4R3DA 4UDUC 4YT0B 1E8ZA 2FCMA 2MCNB 2LZ6A 3I57A 2W55A 4MSQB 2YLMA 4RLCA 3RT3B 2REXA 1T3QA 4RGMA 2WXOA 5DPTA 3RFZB 5BMHA 5BMIA 2D10A 1JMLA 1JRUA 1K8RB 1E54A 1GJZA 1HXUA 1V5TA 3AA6B 1K50A 2AXTO 2DYBA 1Y8RC 2AYOB 3PZ8A 1KLVA 5JH5C 2FGQX 3AA0A 1E5WA 1YQ3B 5CHWA 2MX2A 2PIAA 2WDTB 2XG6A 1QT9A 4O3YA 2KK8A 5T8IA 4HVBA 4EFOA 2WQYB 3NG0A 3VRBB 1JWAD 2XMXA 1KTKA 3PTFC 2DYOA 3R7QA 3KLSX 1X1MA 2PVOD 1V1OA 3HUIA 3RN9C 2ZJDA 4L23A 3RYTA 1OSMA 4FSOA 1T0SC 2MSED 1AYFA 4RFBA 2W3RA 4M00A 3UF8A 4ZRJA 2KC2A 1V1PA 2FCNA 4TSSA 2W9NA 2Y5CA 1NENB 2SEBD 4MGYE 2K0LA 4WQOB 4IUMB 1BXTA 4E1TA 4LDTD 4MH8A 1P0RA 4K3CA 2L32A 2MBBB 4A20A 1G90A 4GLSC 1OEYA 4M8NA 4XDCA 3T8MA 2RPVA 2LUMA 2KFKB 2VH1A 2ZLDA 2KWUB 3AE5B 3LK42 1NVID 2V4LA 1MG8A 4N58A 3GE8C 3IVFA 2ODJA 2JUOA 4KIKB 1QOAA 4AWJA 4GDKA 5DPWA 3LK2A 2N7EA 3HRDD 4GF4A 2QJLA 2MA9B 3SD5A 4PJ0O 1QZEA 1T5XD 3PT2B 4J3OD 2IO3B 3BRZA 5DPRA 1OQYA 2LVPA 2RMMA 3MC9A 2EKIA 4GXBA 4RF0A 2YEPF 4AYMC 3GZNI 4RNAA 3L17A 4KGTA 2QEJC 1WGDA 4IG7B 4K7SA 3ZUNA 4EKUA 2XNAC 5BYSA 1AN8A 2DAJA 1MJDA 1F9JA 3VTWA 3QQ8B 4YTMB 4AUIA 1JWUD 3RNFC 4FN2A 1NDDA 5E6OA 3TL5A 1FEHA 4XZ4A 2AEHA 1RWSA 2KQ4X 1S3SG 4UB8O 2HJ8A 1MFWA 2MQJA 4AKMA 2LHDA 4KVGB 4KDLB 3LK3B 4JL9A 1AARA 1TJEA 3TZGA 1DOIA 1C77A 4RMAA 3VE1A 1FXTB 1KH0A 1WXSA 1WR1A 3WALA 1PGAA 2WWZA 3S2AA 3LJ3A 2HDEA 4AYID 1WMHB 1I7HA 1M94A 3JVZX 4NAMA 2JXXA 2XBBC 3A1QB 1V49A 2ACZB 4GCPA 4LLGM 2BYTA 1XT9B 3JSVA 1E90A 5BMGA 5PRNA 2JVCA 2XK5A 1EO6A 2QTKA 1QILA 3ZRFA 3WAOA 4N59A 4IW0A 3URYA 2AX5A 4C80A 4YTPB 1EUVB 2QIEB 4DXFA 4I6LB 3SU8X 1VCBA 2MP2A 2DZKA 3DBLB 3NVWA 2RSUA 2O6VB 3QARA 3RZWC 2QMTA 1R4MB 4BBNF 2CU3A 1ZXIA 3ZTCA 1HZ6A 3AAEA 1I4RA 3AULA 3SYBA 4RGNA 2FCQA 4A9AA 1UGJA 1WGHA 3NVZA 3V60A 2MHJA 1BMLC 1FIQA 1C4PA 1WXQA 4D64A 3H7SA 4AOFA 1Q1OA 4TV3A 3VH3B 2PE6B 5D3IB 2NTSA 3U7DA 3W1YA 4P16A 3E56A 1YX6B 2IZVB 1UWMA 2BYFA 2OHFA 3SY7A 1MVKA 2C5LC 1UGMA 3Q2AC 1I4QA 2F1VA 3A2SX 2RDBC 3A9KB 3T3NA 1KJTA 4EE2A 2WXIA 2RR9A 3U4EG 2KX3A 5IKCM 2J53A 1HA5A 2CU1A 2WXRA 3SFEB 1MHXA 2X38A 4EEWA 4GCQA 5E79O 3RI7C 2OMFA 3RBHA 1OQQA 4FLHA 2GBRA 2LHFA 1I4PA 3LDZE 1UD7A 2JWZA 3T20A 3DVNV 1F0ZA 1Q5WB 1IP9A 2WLBA 1H4RA 1V81A 1A70A 4L2YA 2Y2XA 3DHHC 3NZ3A 2BYVE 5B66O 2PORA 1QKZA 2KDMA 1V9JA 3UGBB 2F1TA 1F77A 3NRZA 2KJRA 1WX8A 4MGIE 2K1FA 4EOYA 2GOWA 3QAQA 1V2YA 1Z5SB 4WQMA 3SZVA 3VRAB 2LEKA 2KJHB 3ZJVA 1EWYC 2A5UA 1PQSA 4C7ZA 3VZWX 2KX0A 2I1KA 2IY1B 1EWCA 4G50A 5EE0A 4ZRQA 2K9XA 3SDLC 3VFKA 1YX5B 3CIRB 2BB6A 1YD8U 4BFRA 3OJ3A 3B0AA 2XE5A 4HKZE 1KFYB 2KWVB 1LGRA 1MHHE 4MJSB 1VR9A 5AZGA 2IDYA 3KWLA 2PLPA 3B2GA 1R4NI 1E9MA 3A0HO 4JGHB 1QOBA 3VE2A 1YJIA 1LO5D 3DQVA 3KUZA 3BY4B 2KXPA 1FMAD 4ASWC 4BOZB 2MJDA 1WXMA 3LB8C 2NBVB 3ZQ4A 2L3ZA 1WX9A 4JWSC 4ZRKA 2IJ0A 2A4ZA 2I38A 3AA6A 2L0TA 4BKSD 4O3ZA 3FILB 3T24A 2WDQB 4MDKE 4DBGA 3ONSA 2BKFA 4HDQA 1F1HA 3AEAB 2KLGA 4RJWA 1E7PB 3UQBA 3AEBB 3V61A 1ZHYA 3WIMA 3ZJTA 3KUCB 2ZW1A 2O4VA 2K25A 3NZUA 4B9KA 4BVUC 3U52E 2W80C 1E7VA 2K22A 3AEFB 4WJNA 3W1SC 5EE1A 3HHMA 5AFUK 1VZ8A 2CR5A 4ICUA 2DZJA 3FC4A 4HCPB 3K19A 1YN4A 2N4FA 3Q6BA 1ZDXA 1KLUD 3X0WA 4P6VF 4M01A 3PQUA 3GB1A 1YN5A 4DHJD 4C7YA 3L08A 2BT6A 3LK41 1GPXA 4EUTA 5TSSA 1IBXB 2PTLA 2L1AA 3V05A
chains in the Genus database with same CATH topology
2QCZA 2VH1A 2X8XX 4XGAB 3OG5A 3MC9A 4C00A 4K3BA 3EFCA 2V9HA 3Q6BA 4BZAA 4PK1A 4C4VB 4N74A 4K3CA 2QDFA 2MHJA 3MC8A 3NJTA 4QAYA 2VH2A 4N75A 4C4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCZ A;  2VH1 A;  2X8X X;  4XGA B;  3OG5 A;  3MC9 A;  4C00 A;  4K3B A;  3EFC A;  2V9H A;  3Q6B A;  4BZA A;  4PK1 A;  4C4V B;  4N74 A;  4K3C A;  2QDF A;  2MHJ A;  3MC8 A;  3NJT A;  4QAY A;  2VH2 A;  4N75 A;  4C4V A; 
#chains in the Genus database with same CATH topology
 1KF6 B;  1V8C A;  4DXA B;  3PPA A;  2KJ6 A;  2IPK D;  1C76 A;  1SGH A;  3MFG A;  4FOZ A;  4K3B A;  3BZD B;  1MPE A;  3MP9 A;  1M4V A;  4FMS A;  2KFK A;  3EA6 A;  1UWX A;  2B3A A;  1XCQ L;  1LQB A;  2MRP A;  5C3J B;  3O0E A;  1XEE A;  3BVM A;  1WI0 A;  5ADX K;  2Z0E B;  1JAL A;  3DHG C;  4KV2 A;  2MJE A;  3Q8F A;  4N6E B;  3HW9 A;  4PYZ A;  2BWE S;  1L2N A;  4A3O A;  1GC6 A;  5C2T B;  3CST A;  1AW7 A;  5JXV A;  1HXX A;  3AA7 A;  2YVC A;  3UQA A;  2R61 A;  4WWP A;  3P4Q B;  3JTY A;  4WJO A;  4AS1 A;  3SHQ A;  3DA3 A;  2NR2 A;  5H8Y E;  5JHB A;  5D2M B;  1YNT E;  2IO0 B;  2DX5 B;  1Q9G A;  8PRN A;  4CTD A;  4EZJ A;  3ETR A;  2GBN A;  2MW5 A;  3ZTD A;  3RNG C;  4OVZ A;  3NS1 A;  4FZN A;  2M8S A;  1KRH A;  5G55 A;  3HVD A;  2DAF A;  1ZHW A;  1E8Y A;  2AWT A;  4JWU C;  2Y0H A;  3L13 A;  4B0E A;  2C7N B;  3AE1 B;  4TQ0 A;  2R4O A;  3ZGZ A;  4ANW A;  2KMC A;  2EKE C;  1A5R A;  4AUQ C;  2B76 B;  4K81 A;  2VRR B;  3QK0 A;  2DYM A;  3ZDM C;  3MC0 B;  2IGG A;  3LK3 A;  2KZ7 B;  3OLM D;  3QRC A;  1EU3 A;  2MWS B;  2AQ2 B;  3QIJ A;  2YPV A;  4XX5 A;  3CMM B;  4KZC A;  3AAA B;  1WX7 A;  3AXC A;  1U4A A;  4N74 A;  1FCL A;  2CHX A;  2WXN A;  4ACF A;  4FES A;  3CF6 E;  1GFQ A;  2LGY A;  4WAA A;  1HTQ A;  3L54 A;  1FPY A;  2JQY A;  2M19 A;  2V4I B;  6PRN A;  2Y3A A;  3DBS A;  4MT5 A;  1SF0 A;  3AE9 B;  2IYD B;  5AUK A;  3LXF A;  3N3K B;  1BXW A;  2D3B A;  5G5G A;  1SIJ A;  1IYF A;  5E6N A;  2Z59 B;  1T0Y A;  4JE3 B;  2PPH A;  4ZHO A;  4BKG A;  1JRO A;  1Y56 A;  3W5U B;  5HI1 A;  2KXP B;  2KMM A;  2RDH A;  1FRD A;  3B9J A;  1JW9 D;  4JIO U;  2KD0 A;  3E9S A;  3PVL A;  3ZXV A;  4BBN C;  2KXJ A;  2KQS A;  4DXG A;  3PZD A;  3L4P A;  4PR7 A;  1PGX A;  1YOV B;  2O6V A;  4O49 A;  1XLO A;  2ZPN A;  3AU5 A;  4P7I A;  2JYT A;  4HPM B;  2JU6 X;  2LGD A;  3M3J A;  2KKC A;  1TIF A;  2Y5B B;  3POR A;  2BS3 B;  3HK0 A;  4DHZ E;  2PKO A;  2KC1 A;  3AM9 A;  3HOE A;  4W9L A;  4AYD C;  1C3T A;  1BUI C;  3NSG A;  1N61 A;  4BZA A;  2LVQ A;  4ICV A;  3WAN A;  3PRM B;  3N9Y C;  2ON8 A;  5KHO A;  2EEL A;  3UU2 A;  3U8Z A;  3QX1 A;  1P7F A;  4PYU A;  4LSE A;  1FFU A;  3MJW A;  4NQL B;  4BKT A;  4KKI A;  2FAZ A;  1BT0 A;  4TKN A;  3DBL I;  1E10 A;  3A9K A;  2X27 X;  1GFN A;  1WM2 A;  1R4M I;  2MBE A;  2KC0 A;  2XTR A;  2BW2 A;  1Q0W B;  2R4L A;  2WDR B;  1EF1 A;  2M06 A;  3RMK C;  1SB3 C;  1WIA A;  3N20 C;  3DVG Y;  2KWD A;  1L4D B;  3QJZ A;  5KAF O;  4LSI A;  1SE9 A;  3P42 A;  4KZ0 A;  1G6J A;  3UAQ A;  1C9F A;  1QOG A;  1IUE A;  2GLS A;  2J4U P;  2AL6 A;  1RFA A;  1OFF A;  4RGT A;  4DWF A;  4X57 B;  5GV0 A;  3Q3M C;  1WYG A;  2MHL A;  1J8C A;  2V1Y A;  4AZL A;  5KAI O;  2BBC A;  3AA7 B;  4B61 A;  2JWU A;  2PVG C;  3B1L X;  4II3 B;  3NOB A;  4CO7 A;  3L16 A;  1D5Z C;  2VZK D;  2N7D A;  2GBJ A;  3RUL A;  2R2O A;  2NPT B;  3ZLZ A;  2PMV A;  3A9J B;  2K6D B;  2LI5 A;  2LAS A;  4O3X B;  4XWW A;  4M8M A;  2W54 A;  1VDV A;  3ZRC A;  1WJN A;  2L52 A;  2J0J A;  4XWT A;  3DPD A;  4OZC A;  2LUE A;  4LNK A;  1RLF A;  1QJ8 A;  3VQI A;  4M02 A;  1C4A A;  3OG5 A;  1HXT A;  4HPP A;  1YJJ A;  3PS6 A;  4MJS A;  2KAJ A;  3APF A;  3BVG A;  3PLU A;  3DCG A;  2JQR B;  1QF6 A;  5L95 C;  1ZPS A;  2UU7 A;  2ZNV B;  3ZDT A;  1WGR A;  3UIP B;  2NBW B;  2FUH B;  1ZHT A;  1YQB A;  1B9R A;  3V8U A;  5DCN A;  1N5X A;  4URK A;  1WXA A;  2EMT A;  3PGR A;  4GMV A;  1E6E B;  5IA7 A;  1GB1 A;  4MEL A;  3I3T B;  2WXH A;  4XE0 A;  3WA0 A;  2CHW A;  4B95 A;  2OJR A;  3FIL A;  3RPF C;  4ZRP A;  4LNI A;  3R8B A;  3ECI A;  2BS2 B;  2KDE B;  1UF0 A;  3MC8 A;  4HPL B;  2K8C A;  4EZL A;  1D5M C;  4O3W A;  5JHA A;  3VVW B;  3U2S C;  2IY0 B;  3KZI O;  1EM7 A;  4IC7 B;  1D4B A;  3OJ4 B;  4NY0 A;  1DOY A;  1WRI A;  2Z8L A;  2MBQ A;  2BS4 B;  2KQ7 A;  3NZS A;  2ZVN A;  4IM0 A;  4HLE A;  3TEY A;  4DHZ B;  3NHE B;  1J7B A;  2N1W A;  1GFM A;  4YL8 A;  3BS0 A;  2WXL A;  4BUM X;  3P1M A;  2MJ3 A;  3VY8 X;  1WY8 A;  1HXY D;  2N0S B;  3AEG B;  3VR9 B;  4OHJ A;  4FUV A;  4C56 C;  1NI2 A;  5DL5 A;  2JZZ A;  1QQR A;  3VTV A;  2KMA A;  4RGO S;  1BH3 A;  5KHQ A;  1IBX A;  2D11 A;  5LXI B;  4FJZ A;  3D32 A;  2L0F A;  3DBR B;  3AE2 B;  3NUH B;  3A0B O;  5HKH A;  4E71 A;  1WJU A;  5D3D A;  5E6J A;  4MAC A;  3V6C B;  2KDF B;  2UWQ A;  4RLB A;  2LRU A;  3R3M A;  2KHW B;  4HRO A;  5G38 A;  1FNV A;  4ZHP A;  1ZP0 B;  2G3Q B;  5AFU L;  2GRI A;  1I42 A;  3EEC A;  2D5G A;  4JCH A;  5B5E O;  2ZCB A;  4RH6 A;  1DYQ A;  5JZE B;  3WCQ A;  1RM6 C;  3DWM A;  3KUD B;  2AQ3 B;  3PQS A;  5EE9 A;  2WNM A;  3PRP B;  2JPH A;  2KDI A;  1XLQ A;  4HEA 1;  3SR6 A;  1L0Y B;  3PF1 A;  3R7R A;  1WF9 A;  4HRS A;  3M95 A;  4HJK A;  5TIS O;  1PFD A;  1EU4 A;  1DOX A;  1TS5 A;  4ANX A;  1F52 A;  1WZ0 A;  4D2K A;  1WGY A;  5J18 A;  1C79 A;  2IGH A;  3AE3 B;  2J42 A;  1FM0 D;  5BYR A;  2N1V A;  3VXW A;  2VH2 A;  4KX6 B;  3FKY A;  5GTI O;  2HTH A;  2WJR A;  2M0A A;  2WJQ A;  3SZD A;  3VUW A;  2NVU I;  3KQ4 A;  2G45 B;  1WRD B;  3PHW B;  3IG3 A;  1OEY J;  2KVZ A;  1WWT A;  5MPO A;  2N9K A;  4RCO A;  1P9D U;  2SAK A;  3Q8A A;  3DWN A;  3ZO5 B;  3JW0 X;  1KOT A;  4C69 X;  3QA8 A;  2M17 A;  2BB5 A;  3ZW3 A;  1TS2 A;  1IZN B;  3SY9 A;  2KZ7 A;  2WXQ A;  1K53 A;  3V62 A;  2WXP A;  1PGB A;  1MG4 A;  3AE7 B;  2QCZ A;  2PW9 A;  4WAF A;  2R8A A;  3AAA A;  1TY0 A;  5C1Z A;  1SSN A;  1D3Z A;  2XE3 A;  5L83 A;  1YMH E;  3R66 C;  3VDZ A;  4O4X A;  3POQ A;  4KR8 A;  3CSF A;  2LXC A;  3R2I A;  2NMQ A;  4IL6 O;  2J0M A;  2KAC A;  4KSK C;  4RM9 A;  1XF5 L;  4WIP A;  3TMP B;  5DL7 A;  1P3Q U;  4US9 A;  3Q8B A;  1D5X C;  1TY2 A;  5DPS A;  4AFK A;  2FNJ B;  2L7R A;  5DL6 A;  3ABV B;  2RPQ A;  2WYQ A;  1PUT A;  2MNH A;  1N62 A;  1VJK A;  1L6V A;  2QSD A;  3I9V 1;  5EDS A;  1I35 A;  3CWI A;  2Y5P A;  1PDX A;  3EFC A;  3EFU A;  1ORM A;  1KLG D;  2IWV A;  1XLP A;  3APD A;  1UEL A;  3TSS A;  1ENF A;  1XQQ A;  3AMZ A;  1FO4 A;  2ERV A;  1TKG A;  1XO3 A;  4GOC A;  4YXD B;  4FJY A;  3VUY A;  4W9J A;  4ZYS A;  2K3U A;  3ZNI D;  2JRH A;  1GFP A;  4G76 A;  1V86 A;  4DQO C;  5AUI A;  1T0R C;  4TQ1 A;  1JRP A;  4GU2 A;  1K51 A;  1MM4 A;  3P4P B;  5G3A A;  4S0R A;  4KRA A;  2LD9 A;  4RL9 A;  2MH7 A;  1ZHZ A;  4GHB A;  1TS3 A;  4Q2J A;  3TUO A;  2L8J A;  4YTN B;  2O2V B;  3PSE B;  5D6J B;  4GDL A;  5FR6 A;  1CJE A;  4G3X B;  2D07 B;  4NJ6 A;  2M56 B;  2WX0 A;  4DDI D;  4MH0 E;  1YQ4 B;  1FNU A;  3H9D A;  3SEB A;  4YSY B;  4IWO A;  1TT5 B;  5H92 C;  1TZO A;  1TS4 A;  2MBH A;  1RFK A;  3N32 A;  5G2N A;  5JDP A;  4FZL A;  1NYQ A;  4ZYN A;  2O6V D;  2GI9 A;  2WS3 B;  4LNN A;  3DVN U;  4OZB A;  1BT9 A;  2DLB A;  3SFD B;  2GE4 A;  5EE3 A;  2KOX A;  2WXM A;  3MJ5 A;  1ZUD 2;  1CK1 A;  2X8X X;  2BGF A;  1JWS D;  4LJO B;  4PS7 A;  2FGR A;  1XXG A;  2LGI A;  3O65 B;  1C78 A;  5FR3 A;  2D3A A;  2BTE A;  1WE6 A;  2E3T A;  1OTR B;  3EHV A;  3R2T A;  2DWQ A;  3TEX A;  1SBB B;  2NCN A;  3RD2 A;  3IT4 B;  4XNK A;  3MHZ A;  2AL3 A;  4LJP B;  1S1Q B;  4XYC A;  3GS2 A;  4M0W B;  1OGW A;  1S5L O;  3AEC B;  3BYY B;  2ONQ A;  2TSS A;  3HOL A;  2K0P A;  3JYU A;  2LVO A;  2BPS A;  3T0S A;  2WXG A;  5J2R A;  4IKG A;  1T16 A;  5D7G A;  1JCK B;  4REZ A;  2BYE A;  2QDF A;  2WXJ A;  2INC C;  3C8Y A;  4FHK A;  2NPT A;  3ENE A;  3ML8 A;  3A9J A;  2LWP A;  3C19 A;  4IM2 A;  1HE8 A;  2KTR B;  3VUX A;  2M4N A;  3Q8C A;  4W9H A;  1TKY A;  2XTQ A;  2GB1 A;  3M62 B;  2JMM A;  2N9P C;  2DHZ A;  2L76 A;  2G9H D;  2WXF A;  5IO9 A;  1TTN A;  2K8B A;  3DWO X;  1SJH D;  3U30 A;  3BIN A;  4LNO A;  3EC8 A;  2IND C;  4H2A A;  1DGJ A;  2ZCC A;  1OPF A;  4ARI A;  1IGC A;  3WI4 A;  2GBM A;  1FNW A;  3PZ7 A;  4IWQ A;  4KGS A;  1J0G A;  2JX5 A;  1ET9 A;  5CX3 A;  4HXD A;  4F7Z A;  4JQW C;  3WI5 A;  2WHI A;  3QRA A;  4F1S A;  2L05 A;  4FJV B;  1IPG A;  1SE2 A;  5G26 A;  2V3S A;  4OVV A;  4L1B A;  2RDG A;  3Q3N C;  4C4V A;  4ZRI A;  1VLB A;  3POU A;  4AQ7 A;  1GNU A;  3DBH B;  2EMS A;  1PYW D;  3C5O A;  3KVD D;  3AN1 A;  1N6Z A;  2H89 B;  1E0Z A;  1ACC A;  2J7Q B;  5T5F A;  3RCZ A;  4FAD A;  3GP7 A;  4A3P A;  2JZP A;  4MGZ E;  1TYG B;  1L5P A;  3A4R A;  1VRA B;  2N9E B;  2X9K A;  2C9W B;  4W9E A;  1N63 A;  2JZ3 B;  2N2M A;  1V80 A;  3RNA C;  4BOS C;  1E8W A;  1MI0 A;  2D2Q A;  5CHV C;  3RUI B;  1V97 A;  2CJO A;  3P2B A;  3PGS A;  5GMV A;  2KDB A;  1VZ7 A;  3AE4 B;  2BVC A;  4JFB A;  3H7P A;  1KM7 A;  1NEK B;  4G75 A;  1RYJ A;  1ROE A;  2CHZ A;  3IT6 B;  4J6I A;  4IDI A;  4W9D A;  2LFI A;  3QHT A;  3BK2 A;  1WZ3 A;  1NI3 A;  2HE7 A;  1F2R I;  4DK5 A;  2KZR A;  1CMX B;  2ICI A;  2WXK A;  3L0W B;  4AJY B;  2CS4 A;  1H8C A;  2E6X A;  4GDL B;  3TBL D;  5LNK 1;  5GXG B;  1IGD A;  1GC7 A;  4LTU A;  1V5O A;  3T3O A;  2KVR A;  4GN1 A;  4FT6 A;  3W9C B;  4W9K A;  2KTF A;  4P1B C;  4K7W A;  1ESF A;  3AV8 A;  5FVN A;  5IP4 D;  3VAW A;  4TMA B;  3ZIM A;  2XE1 A;  5E6P A;  2Y7S A;  4B0M A;  4TUU A;  2PJH A;  2JRI B;  4MM3 B;  1UZX B;  1WSP A;  3K9O B;  2CJN A;  1YS5 A;  2C60 A;  2W3S A;  1GAQ B;  1SE3 A;  5HHD G;  2KO3 A;  1T1L A;  3V6E B;  4BAX A;  3BII D;  1R7S A;  5G5H A;  3P63 A;  3DBR I;  3GE3 C;  3AH7 A;  1P1A A;  4AKR B;  3ZJU A;  4HDO A;  1QOF A;  1JQ4 A;  2RGF A;  1YJ1 A;  3LYY A;  1TKE A;  2FUG 1;  3MHS D;  3H8H A;  3TJP A;  5LLI A;  3V3X A;  2I2Y A;  3HVZ A;  3HM3 A;  5BYQ A;  2MBO A;  4W9F A;  3BWU D;  2G4D B;  1THQ A;  1STE A;  4FZM A;  4QQ1 A;  1ZXH A;  3U7Z A;  3X23 A;  1I4H A;  1K52 A;  3KW5 B;  1IZN A;  1TBE A;  2NS5 A;  1P4T A;  3DHI C;  2K8H A;  2NTT A;  4FRX A;  3N1X C;  2KDY A;  4EZK A;  2QIL A;  4A8X C;  4AP4 C;  3SYS A;  2K39 A;  3M63 B;  2KYW A;  3EGR A;  5EE2 A;  3O13 A;  4NPN A;  3VH4 B;  2L00 B;  3A33 B;  3NY5 A;  2ZPY A;  4F4B A;  1MPF A;  2YNK A;  2DBY A;  3AED B;  3Q8E A;  2M1M A;  3Q3J A;  1UBQ A;  2JT4 B;  4FSP A;  4MGK E;  3NVV A;  3ZNG C;  3H6N A;  3RZF A;  1NBF C;  2BKR B;  5CHF A;  1FCC C;  5H2F O;  3FAH A;  1L7Y A;  4QAY A;  1Q9F A;  1C1Y B;  2LFU A;  2DZM A;  4FXC A;  5HG2 A;  3VHT C;  1N60 A;  4AYE C;  1TGZ B;  4KDI C;  4W9G A;  1WR6 E;  2JYE A;  2JXT A;  4RJX A;  1L6U A;  4C4V B;  1RRB A;  4NAW B;  4XC2 A;  3ALB A;  4OVU A;  3WU2 O;  3PRE A;  3I63 C;  2ZZP B;  1UH6 A;  4CYE A;  1WFY A;  2F1C X;  1J7A A;  4KGR A;  2HD5 B;  1RAX A;  2LJI A;  5IOI A;  2KLC A;  1GOZ A;  4AYN A;  4YSX B;  2O2V A;  2R4P A;  4RM8 A;  4C00 A;  2HJ1 A;  2V0G A;  3B08 A;  3P4S B;  2JSV X;  2IWW A;  4NZL B;  3DA4 A;  4HJG E;  2FIF A;  4OW0 A;  2Y0K A;  3N30 A;  3H7P B;  2V3N A;  3QWZ B;  1XCT L;  4B6W A;  3KH0 A;  5IYU A;  5J17 A;  3BYT B;  3AEE B;  3ZKJ C;  4USA A;  1WXV A;  4G0N B;  3QC8 B;  3GP6 A;  1D6E C;  4CQN A;  4D65 A;  5TR5 A;  1SEB D;  4UB6 O;  1HQR D;  3VZU X;  2IGD A;  4N75 A;  5C23 A;  4DHJ B;  2ASQ A;  2H88 B;  4OZA A;  4MEM A;  4MSM B;  4IM3 A;  3TEW A;  5G39 A;  3GOE A;  3AA0 B;  3N1Z C;  1HTO A;  3AU4 A;  1YIW A;  4D5U A;  4W9I A;  2KN4 A;  4WJQ A;  4O4U A;  2XE2 A;  3I5J C;  3QCA A;  4M0W A;  1GG3 A;  2HTM E;  4FRT A;  2YEP B;  2V3P A;  2J52 A;  2J1N A;  4LSF A;  2FCS A;  4ARC A;  4K7U A;  3AE8 B;  2NBU A;  4JX1 C;  4HKQ A;  1Z2M A;  1FFV A;  1XLN A;  1L0V B;  1V1P B;  2LGS A;  3TEZ A;  1QLB B;  2PEA A;  4IWP A;  1TZ1 A;  2D3C A;  4A90 A;  1SIF A;  1OQR A;  2CKH B;  3H1U A;  2KTR A;  4WWN A;  2N9X A;  3K9P B;  3AA1 A;  2GMI C;  4CHK A;  1WYW B;  1I4X A;  4G11 A;  3Q3F A;  2ZEQ A;  4PS3 A;  5GTH O;  2WVP A;  4XGA B;  3GZN B;  5ADX L;  4PS8 A;  1V6E A;  3KWV A;  3G7G A;  2PE9 A;  4HWI B;  3EUB 2;  4ITK A;  3VTU A;  2FID A;  2N7J A;  4LK0 M;  1ZE3 D;  1PRN A;  4NNJ B;  5LXH A;  4DDG D;  3A4S C;  4XNL A;  3ML9 A;  2M0X A;  3RNE C;  1J19 A;  4O1N A;  5D5D A;  2KT7 A;  2FBW B;  1HZ5 A;  4NJC A;  3POX A;  1UBI A;  4GGQ A;  2N2L A;  3EMN X;  1J7C A;  2OED A;  4A55 A;  4WJP A;  4GDK B;  2C7H A;  2OJW A;  3TIX A;  5DL8 A;  2R88 A;  1P7E A;  3LK2 B;  1AWD A;  4US8 A;  3UIO B;  3AB5 A;  3VZT X;  4E74 A;  1FXA A;  2G1E A;  4WH4 A;  1WJ6 A;  3UI3 A;  2ZVO A;  2LMC A;  2Q5W D;  4E3C A;  1LFD A;  1LXD A;  2BQQ A;  3W5V B;  4I6P A;  1GB4 A;  1L4Z B;  2WGS A;  2KAN A;  1GUA B;  4YWG G;  3DZM A;  3PGU A;  4HK2 A;  2KNB A;  4ANU A;  2PRN A;  3MTN B;  3P4R B;  4LNF A;  1FD6 A;  2BF8 B;  4ZOH C;  3PO0 A;  3ZVV A;  1VZ6 A;  3WAM A;  2K6Q A;  1ZW7 A;  2KFJ A;  1PHO A;  1E8X A;  2ZFG A;  2C7M B;  2W81 C;  4K1R B;  1UUP A;  3AI5 A;  2BWF A;  1CZP A;  3Q69 A;  3IAS 1;  2ZNV C;  1ZDV A;  3DBH I;  3OAW A;  1ZGU B;  1T0Q C;  4FUL A;  2Z0D B;  3RNC C;  4ZDV A;  2LRW A;  3UPG A;  3NS8 A;  4GSW A;  1EF5 A;  4WWO A;  1Q10 A;  3HWB A;  4S17 A;  3PGE A;  4W9C A;  1SE4 A;  4I6N B;  4PUX A;  4LSH A;  3PHX B;  4Z3T A;  4JPS A;  5AZF A;  4PT5 A;  1GFO A;  2FE8 A;  3RNB C;  1LM8 B;  1ZOY B;  1WH3 A;  1F2R C;  3HIZ A;  2IO2 B;  3UIN B;  3JSV B;  1QJP A;  1MM5 A;  2XK5 B;  1ZKH A;  3APC A;  4NJ7 A;  1ISN A;  4RF1 A;  2WU5 B;  1UNS A;  1WM3 A;  1XD3 B;  4MM3 A;  2INP E;  3ZNH B;  3PRZ A;  2INN E;  3DDC B;  3TCA A;  1JWM D;  2MP2 B;  2G4S A;  5AZH A;  2QHO A;  1SXT A;  5IN7 A;  2LJ5 A;  2MEK A;  3BRY A;  4AKR A;  1CQV A;  2L83 A;  4LDT B;  3ZNZ B;  3AAE B;  1WGG A;  4II2 B;  2WP9 B;  4YSZ B;  2M07 A;  3NJT A;  3DOW A;  3KVF B;  1HEZ E;  2DEN B;  2LGX A;  3PRN A;  1ET6 A;  2J4X A;  3PV1 A;  2LXA A;  2R4N A;  4IOI E;  5D94 A;  1SJE D;  4N9F 4;  1JWB D;  3FYX A;  3NVY A;  3BVZ A;  2WU2 B;  3AE6 B;  1P98 A;  4WUR A;  5CTR C;  3KYC D;  4FA6 A;  1QJ9 A;  2J0K A;  1WGK A;  4XDD A;  4GCS A;  2IBI B;  4KIK A;  4AJW A;  2GBK A;  2JF5 A;  5IAA C;  3WAP A;  3AA1 B;  2Y0L A;  3IHP C;  3IBE A;  3Q14 C;  4WWM A;  4PK1 A;  1N5W A;  3IFW B;  4ANV A;  3VR8 B;  2VZK B;  3KYD D;  5HFY A;  4U9C A;  2DNF A;  1L0X B;  3C0R B;  2W82 A;  2R89 A;  3OWE B;  3DVG X;  4KSL C;  2D3G A;  2XEW A;  4FQE A;  4FHJ A;  4P1C C;  7PRN A;  3PLV A;  4E1S A;  1WE7 A;  3T9L A;  3ZXR A;  5I4D A;  1E7U A;  2K4T A;  2I1J A;  1I4G A;  5FKA C;  4FBJ B;  2V9H A;  5AEK B;  2LHE A;  2N9L A;  3N1Y C;  3JCU O;  2DZI A;  2OOB B;  1H6S 1;  1R4N B;  4NQK E;  2KWC A;  3Q3O C;  3L10 B;  1ZHX A;  1FRR A;  4GB9 A;  3B2F A;  4NAW A;  2WDV B;  2JY6 A;  2RD0 A;  4GIV A;  2K5P A;  1NYR A;  3HM6 X;  4HCN B;  3VY9 X;  3ZYY X;  1YN3 A;  2QC8 A;  3IAM 1;  1C4C A;  2AQ1 B;  1B1Z A;  5BO4 B;  4F8C B;  2R2Q A;  2KN5 A;  2MLB A;  4BKS A;  2ZW0 A;  5FK9 C;  3J9C A;  3BK1 A;  3W1S A;  1WMH A;  4LCD E;  4A6Q A;  2IO1 B;  3A1Q A;  1T6B X;  4KR4 A;  4JLC A;  4KKJ A;  2XN9 C;  3DWG C;  1VD2 A;  3IXS A;  1WJ4 A;  2UYZ B;  2WX1 A;  3W2D A;  1FXI A;  4R3D A;  4UDU C;  4YT0 B;  1E8Z A;  2FCM A;  2MCN B;  2LZ6 A;  3I57 A;  2W55 A;  4MSQ B;  2YLM A;  4RLC A;  3RT3 B;  2REX A;  1T3Q A;  4RGM A;  2WXO A;  5DPT A;  3RFZ B;  5BMH A;  5BMI A;  2D10 A;  1JML A;  1JRU A;  1K8R B;  1E54 A;  1GJZ A;  1HXU A;  1V5T A;  3AA6 B;  1K50 A;  2AXT O;  2DYB A;  1Y8R C;  2AYO B;  3PZ8 A;  1KLV A;  5JH5 C;  2FGQ X;  3AA0 A;  1E5W A;  1YQ3 B;  5CHW A;  2MX2 A;  2PIA A;  2WDT B;  2XG6 A;  1QT9 A;  4O3Y A;  2KK8 A;  5T8I A;  4HVB A;  4EFO A;  2WQY B;  3NG0 A;  3VRB B;  1JWA D;  2XMX A;  1KTK A;  3PTF C;  2DYO A;  3R7Q A;  3KLS X;  1X1M A;  2PVO D;  1V1O A;  3HUI A;  3RN9 C;  2ZJD A;  4L23 A;  3RYT A;  1OSM A;  4FSO A;  1T0S C;  2MSE D;  1AYF A;  4RFB A;  2W3R A;  4M00 A;  3UF8 A;  4ZRJ A;  2KC2 A;  1V1P A;  2FCN A;  4TSS A;  2W9N A;  2Y5C A;  1NEN B;  2SEB D;  4MGY E;  2K0L A;  4WQO B;  4IUM B;  1BXT A;  4E1T A;  4LDT D;  4MH8 A;  1P0R A;  4K3C A;  2L32 A;  2MBB B;  4A20 A;  1G90 A;  4GLS C;  1OEY A;  4M8N A;  4XDC A;  3T8M A;  2RPV A;  2LUM A;  2KFK B;  2VH1 A;  2ZLD A;  2KWU B;  3AE5 B;  3LK4 2;  1NVI D;  2V4L A;  1MG8 A;  4N58 A;  3GE8 C;  3IVF A;  2ODJ A;  2JUO A;  4KIK B;  1QOA A;  4AWJ A;  4GDK A;  5DPW A;  3LK2 A;  2N7E A;  3HRD D;  4GF4 A;  2QJL A;  2MA9 B;  3SD5 A;  4PJ0 O;  1QZE A;  1T5X D;  3PT2 B;  4J3O D;  2IO3 B;  3BRZ A;  5DPR A;  1OQY A;  2LVP A;  2RMM A;  3MC9 A;  2EKI A;  4GXB A;  4RF0 A;  2YEP F;  4AYM C;  3GZN I;  4RNA A;  3L17 A;  4KGT A;  2QEJ C;  1WGD A;  4IG7 B;  4K7S A;  3ZUN A;  4EKU A;  2XNA C;  5BYS A;  1AN8 A;  2DAJ A;  1MJD A;  1F9J A;  3VTW A;  3QQ8 B;  4YTM B;  4AUI A;  1JWU D;  3RNF C;  4FN2 A;  1NDD A;  5E6O A;  3TL5 A;  1FEH A;  4XZ4 A;  2AEH A;  1RWS A;  2KQ4 X;  1S3S G;  4UB8 O;  2HJ8 A;  1MFW A;  2MQJ A;  4AKM A;  2LHD A;  4KVG B;  4KDL B;  3LK3 B;  4JL9 A;  1AAR A;  1TJE A;  3TZG A;  1DOI A;  1C77 A;  4RMA A;  3VE1 A;  1FXT B;  1KH0 A;  1WXS A;  1WR1 A;  3WAL A;  1PGA A;  2WWZ A;  3S2A A;  3LJ3 A;  2HDE A;  4AYI D;  1WMH B;  1I7H A;  1M94 A;  3JVZ X;  4NAM A;  2JXX A;  2XBB C;  3A1Q B;  1V49 A;  2ACZ B;  4GCP A;  4LLG M;  2BYT A;  1XT9 B;  3JSV A;  1E90 A;  5BMG A;  5PRN A;  2JVC A;  2XK5 A;  1EO6 A;  2QTK A;  1QIL A;  3ZRF A;  3WAO A;  4N59 A;  4IW0 A;  3URY A;  2AX5 A;  4C80 A;  4YTP B;  1EUV B;  2QIE B;  4DXF A;  4I6L B;  3SU8 X;  1VCB A;  2MP2 A;  2DZK A;  3DBL B;  3NVW A;  2RSU A;  2O6V B;  3QAR A;  3RZW C;  2QMT A;  1R4M B;  4BBN F;  2CU3 A;  1ZXI A;  3ZTC A;  1HZ6 A;  3AAE A;  1I4R A;  3AUL A;  3SYB A;  4RGN A;  2FCQ A;  4A9A A;  1UGJ A;  1WGH A;  3NVZ A;  3V60 A;  2MHJ A;  1BML C;  1FIQ A;  1C4P A;  1WXQ A;  4D64 A;  3H7S A;  4AOF A;  1Q1O A;  4TV3 A;  3VH3 B;  2PE6 B;  5D3I B;  2NTS A;  3U7D A;  3W1Y A;  4P16 A;  3E56 A;  1YX6 B;  2IZV B;  1UWM A;  2BYF A;  2OHF A;  3SY7 A;  1MVK A;  2C5L C;  1UGM A;  3Q2A C;  1I4Q A;  2F1V A;  3A2S X;  2RDB C;  3A9K B;  3T3N A;  1KJT A;  4EE2 A;  2WXI A;  2RR9 A;  3U4E G;  2KX3 A;  5IKC M;  2J53 A;  1HA5 A;  2CU1 A;  2WXR A;  3SFE B;  1MHX A;  2X38 A;  4EEW A;  4GCQ A;  5E79 O;  3RI7 C;  2OMF A;  3RBH A;  1OQQ A;  4FLH A;  2GBR A;  2LHF A;  1I4P A;  3LDZ E;  1UD7 A;  2JWZ A;  3T20 A;  3DVN V;  1F0Z A;  1Q5W B;  1IP9 A;  2WLB A;  1H4R A;  1V81 A;  1A70 A;  4L2Y A;  2Y2X A;  3DHH C;  3NZ3 A;  2BYV E;  5B66 O;  2POR A;  1QKZ A;  2KDM A;  1V9J A;  3UGB B;  2F1T A;  1F77 A;  3NRZ A;  2KJR A;  1WX8 A;  4MGI E;  2K1F A;  4EOY A;  2GOW A;  3QAQ A;  1V2Y A;  1Z5S B;  4WQM A;  3SZV A;  3VRA B;  2LEK A;  2KJH B;  3ZJV A;  1EWY C;  2A5U A;  1PQS A;  4C7Z A;  3VZW X;  2KX0 A;  2I1K A;  2IY1 B;  1EWC A;  4G50 A;  5EE0 A;  4ZRQ A;  2K9X A;  3SDL C;  3VFK A;  1YX5 B;  3CIR B;  2BB6 A;  1YD8 U;  4BFR A;  3OJ3 A;  3B0A A;  2XE5 A;  4HKZ E;  1KFY B;  2KWV B;  1LGR A;  1MHH E;  4MJS B;  1VR9 A;  5AZG A;  2IDY A;  3KWL A;  2PLP A;  3B2G A;  1R4N I;  1E9M A;  3A0H O;  4JGH B;  1QOB A;  3VE2 A;  1YJI A;  1LO5 D;  3DQV A;  3KUZ A;  3BY4 B;  2KXP A;  1FMA D;  4ASW C;  4BOZ B;  2MJD A;  1WXM A;  3LB8 C;  2NBV B;  3ZQ4 A;  2L3Z A;  1WX9 A;  4JWS C;  4ZRK A;  2IJ0 A;  2A4Z A;  2I38 A;  3AA6 A;  2L0T A;  4BKS D;  4O3Z A;  3FIL B;  3T24 A;  2WDQ B;  4MDK E;  4DBG A;  3ONS A;  2BKF A;  4HDQ A;  1F1H A;  3AEA B;  2KLG A;  4RJW A;  1E7P B;  3UQB A;  3AEB B;  3V61 A;  1ZHY A;  3WIM A;  3ZJT A;  3KUC B;  2ZW1 A;  2O4V A;  2K25 A;  3NZU A;  4B9K A;  4BVU C;  3U52 E;  2W80 C;  1E7V A;  2K22 A;  3AEF B;  4WJN A;  3W1S C;  5EE1 A;  3HHM A;  5AFU K;  1VZ8 A;  2CR5 A;  4ICU A;  2DZJ A;  3FC4 A;  4HCP B;  3K19 A;  1YN4 A;  2N4F A;  3Q6B A;  1ZDX A;  1KLU D;  3X0W A;  4P6V F;  4M01 A;  3PQU A;  3GB1 A;  1YN5 A;  4DHJ D;  4C7Y A;  3L08 A;  2BT6 A;  3LK4 1;  1GPX A;  4EUT A;  5TSS A;  1IBX B;  2PTL A;  2L1A A;  3V05 A; 
#chains in the Genus database with same CATH homology
 2QCZ A;  2VH1 A;  2X8X X;  4XGA B;  3OG5 A;  3MC9 A;  4C00 A;  4K3B A;  3EFC A;  2V9H A;  3Q6B A;  4BZA A;  4PK1 A;  4C4V B;  4N74 A;  4K3C A;  2QDF A;  2MHJ A;  3MC8 A;  3NJT A;  4QAY A;  2VH2 A;  4N75 A;  4C4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...