4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
4N74A 3MC8A 4C00A 2QCZA 3NJTA 2X8XX 2VH1A 3EFCA 4XGAB 3OG5A 2V9HA 4BZAA 3MC9A 4K3CA 4C4VB 2MHJA 3Q6BA 4QAYA 2VH2A 4K3BA 4C4VA 4PK1A 4N75A 2QDFA
chains in the Genus database with same CATH superfamily
3ZRFA 2XE5A 2FCNA 4IWPA 1SE4A 3PPAA 2JF5A 4JWSC 3AA7B 4GCQA 2KLCA 2XNAC 3LK2B 1HA5A 3V6CB 4ANUA 3UQBA 2L8JA 4W9EA 2NTTA 1TS5A 5CHFA 1ZHTA 3SHQA 4U9CA 4RGOS 2PVOD 3N32A 3RZWC 4FLHA 5L83A 1TY0A 2C60A 2MX2A 1YN3A 3VY9X 3U2SC 4X57B 2IO2B 2L0FA 4XDCA 4GDLA 5EDSA 5C23A 1A70A 2J0JA 1FNVA 3V61A 4XGAB 3A0BO 5FVNA 1JMLA 3M95A 5KAFO 3CMMB 2ERVA 1EUVB 2Y0KA 3WAOA 1P4TA 1IGDA 1N61A 5J2RA 4EZKA 4ZDVA 3AXCA 1WJ4A 1XLQA 2KDFB 4BKTA 5H92C 1ZHZA 3BK1A 4IWOA 4LSEA 4B9KA 1V97A 1FD6A 1K52A 1I4PA 3KUDB 1QT9A 5J17A 1WZ3A 4A55A 2K0LA 4NJ7A 2MBOA 1LO5D 4F7ZA 3TSSA 3BS0A 1WR1A 1RLFA 1YQ3B 2QC8A 1TKGA 1D5XC 3R8BA 1SSNA 1IP9A 3RI7C 3HW9A 4HPPA 1ZOYB 3P4RB 4XZ4A 5BMHA 3PRMB 1CK1A 4IWQA 4IUMB 1E7VA 3IAM1 1NYRA 4WJQA 2J52A 4P16A 1V81A 2WQYB 2EMTA 4ZYSA 3N9YC 4C56C 2CJOA 4M02A 2HTHA 4AZLA 2BF8B 4C4VA 1HE8A 2V4IB 3IT4B 5T5FA 2KK8A 1CMXB 3AB5A 2MWSB 1SE2A 4FJYA 3BRZA 2KFKA 5G55A 3UI3A 3BZDB 2GB1A 2D3CA 2XG6A 3SZDA 1E9MA 2CU3A 2PLPA 1T0YA 4IM0A 3PGSA 2M4NA 2H89B 4M8NA 2WU2B 2V3NA 5DPRA 1NBFC 4MH0E 1TBEA 3KW5B 2M19A 3A9JB 1C9FA 3A1QB 3EC8A 2IO0B 5C1ZA 4MGIE 1FRRA 3M3JA 2LVOA 4RFBA 3PLVA 4HJKA 2X27X 2HTME 5AFUK 3DA4A 3M63B 5GMVA 4EKUA 2WJRA 5H8YE 1T0QC 2LI5A 3QCAA 1WZ0A 2KNBA 2FCQA 3OG5A 4LDTB 4LJPB 4BOSC 3P2BA 4J6IA 2GLSA 4LCDE 2LRUA 1HTQA 2IY0B 3AE5B 3DVGY 3DBSA 2M07A 2K25A 1C3TA 4W9JA 3AULA 4MGYE 3VE1A 3KYCD 3ZQ4A 4YXDB 4LJOB 1C78A 4FBJB 2G3QB 5DPTA 2KJHB 3H7PB 1N63A 4A3OA 3CF6E 3VUWA 4S0RA 4MACA 8PRNA 2K1FA 2X9KA 1KRHA 3VQIA 2IBIB 4P1CC 1JCKB 1HTOA 4FA6A 2J53A 3AA1B 4KKJA 2MCNB 2GE4A 1OEYJ 3AA7A 4E3CA 3Q8EA 3LK2A 1ZHYA 4FRXA 4JFBA 3Q3NC 3QJZA 2L05A 4OVVA 3T9LA 4MEMA 4PUXA 5E6PA 1K53A 2PIAA 3AA6B 4N59A 4W9FA 1L0XB 2KJRA 1UZXB 1TZOA 2LVQA 4P6VF 1P7FA 1K51A 5HKHA 2FAZA 2JY6A 3WI4A 1ZHXA 4RM8A 1S5LO 2FIDA 3NS1A 3UIPB 1GG3A 4BKSA 4CO7A 1SE9A 2QEJC 1IBXA 4US9A 4RGMA 1SE3A 1CZPA 2KQ7A 1VR9A 4GSWA 1QF6A 2O2VB 3AU5A 2WLBA 4O49A 3SYBA 3U7DA 3SDLC 3AECB 1KJTA 3AE1B 1BXTA 2ZCCA 4AS1A 2CJNA 2E6XA 3UGBB 4BKSD 4HVBA 1T0RC 2KDBA 3L4PA 3UQAA 1GC6A 2N9EB 1OQQA 5B5EO 2KTFA 1NI3A 5GXGB 2ZW0A 4HK2A 2NPTB 4MM3A 4XNKA 3D32A 2MJDA 3GS2A 3V05A 3VAWA 1R4NB 2ZZPB 3U30A 2WVPA 1WXMA 3AEAB 1UUPA 2KVRA 3U8ZA 1ESFA 1XLNA 3ZGZA 4PS7A 2RSUA 3LXFA 1MG4A 2UWQA 3P4QB 5E6NA 3Q6BA 3NS8A 3DHIC 3AE2B 3OAWA 5IA7A 3MP9A 4XNLA 1YX6B 2QDFA 3VE2A 4AQ7A 1STEA 4DXFA 4TV3A 3VTVA 2J4UP 2KVZA 3PS6A 4TQ0A 2MRPA 3EFUA 1J19A 2JSVX 2ZLDA 5L95C 3KVDD 3WA0A 1YN5A 2PKOA 1BT0A 4N6EB 2DZJA 3APFA 1Y8RC 2VRRB 3BVMA 3UAQA 2ZVNA 2X8XX 2GBRA 4WQMA 1GJZA 3JVZX 3KLSX 3SZVA 3WAMA 3FILA 5FR3A 1QLBB 5B66O 2N9LA 4I6PA 3A9JA 3A1QA 4GDLB 1K8RB 4MJSB 4GCPA 2JUOA 3CSTA 5LNK1 4O4UA 5CHWA 3UIOB 2JRIB 2LZ6A 1T3QA 2N9PC 2K22A 2L76A 1UELA 4FQEA 4OW0A 3DDCB 5EE9A 3QHTA 2F1CX 3ZDMC 4LNOA 4AJYB 2INDC 2VH2A 3ZNGC 4K3BA 1SBBB 3LYYA 4D65A 5DPSA 3HWBA 4NAWB 2L00B 1RFKA 1V49A 3L0WB 3R3MA 2K39A 2L83A 4ZRQA 4JWUC 5EE2A 3VDZA 3MFGA 4FSOA 4L2YA 3AA0B 2KDMA 4JLCA 1EWYC 2IWVA 2BT6A 4LDTD 2LEKA 2G9HD 3V8UA 2AYOB 2GBNA 1GFPA 2IO3B 3ZW3A 1C77A 4ARIA 3H6NA 1NEKB 4LSHA 2TSSA 5IP4D 2MJEA 3VVWB 5IYUA 3NZUA 3AE9B 1FXIA 1CQVA 2GOWA 3AE4B 1WXSA 3NRZA 1ORMA 2L32A 2AQ2B 4L23A 2R4OA 3AA1A 1RWSA 1JWBD 2DNFA 1AN8A 2VZKB 4TQ1A 4ANWA 1S1QB 1YNTE 5BMIA 1GNUA 1I4XA 4LTUA 4MELA 4FUVA 1YD8U 1HXUA 4RH6A 2QHOA 4II3B 3ZDTA 4ZYNA 3AA6A 4YTNB 3RD2A 1TS3A 4LNFA 1WIAA 2INPE 2JZZA 3PRPB 2LFIA 4DDGD 3KVFB 4KSLC 4ZRPA 1HQRD 2KFJA 3RNAC 1EM7A 3DWGC 2DX5B 3DBRI 1E7PB 1E0ZA 2NCNA 2DYMA 5G26A 1I4QA 1KLUD 5BYRA 4URKA 3HVZA 2W81C 3HOLA 1V86A 3RMKC 2NTSA 1WE7A 3B0AA 4DXGA 2O2VA 4XX5A 2N9XA 3N1ZC 3GE8C 2L52A 2NBWB 2WXPA 2RD0A 2KDYA 1WSPA 2FGRA 2RDHA 3JTYA 3Q3OC 3ZNZB 1E8YA 1GB4A 5AFUL 2WX1A 2KOXA 2AL6A 1V5OA 2YLMA 2K6QA 2KTRB 2Q5WD 4YTMB 4ASWC 2JU6X 3KQ4A 5BMGA 2D11A 1WM2A 5G5HA 2BVCA 3RT3B 2BS2B 3SY7A 2JWZA 2NPTA 2VH1A 4AJWA 3AEBB 2INNE 4BBNC 2W3SA 3E9SA 3HVDA 4GOCA 3MHSD 3ZNHB 3TBLD 4CTDA 5MPOA 4J3OD 1UGMA 1XCQL 4AUQC 3ZVVA 3AE8B 3PT2B 2XE1A 4GIVA 5HHDG 3H8HA 4QAYA 3DVNV 3NVYA 4BZAA 2D3AA 4YWGG 3IHPC 1HEZE 3WU2O 2LGXA 1N5WA 1WGGA 3I57A 2N1VA 2L0TA 4USAA 4EZJA 3PO0A 1F9JA 3PGEA 5EE3A 1J7AA 3TZGA 1F2RC 2R4NA 2V1YA 4EE2A 5DCNA 1L2NA 5BYSA 5LXHA 1P9DU 2D10A 1EO6A 3ALBA 4I6NB 3A4RA 2WYQA 2WXMA 1U4AA 4AOFA 1G6JA 4KGRA 4KX6B 2Y2XA 3TCAA 3U7ZA 1P0RA 2DAJA 1ZXIA 4TKNA 1QKZA 3B2FA 2BYVE 1WGYA 3HHMA 1YN4A 4FMSA 2IZVB 4LNIA 3ZKJC 3RNFC 2WU5B 4WJPA 2PE6B 1NENB 3DVGX 5JHAA 3OJ3A 2AX5A 3T3OA 4MJSA 3NJTA 2PMVA 2KYWA 4GB9A 2K5PA 4WIPA 2XMXA 3HOEA 4IM3A 1IBXB 3X0WA 2Y0HA 3I3TB 2MHLA 5AUIA 3POQA 4S17A 4EOYA 1GFOA 1PQSA 1ET9A 2XN9C 1IUEA 2ACZB 4FJZA 2FUHB 4RL9A 2N0SB 3JSVB 4NNJB 4NAWA 4HROA 2DWQA 3IXSA 4FESA 3SFEB 3MC9A 4FULA 2YVCA 3LK3B 2HJ8A 1V9JA 3PHXB 1ROEA 3VXWA 1ZE3D 4O3ZA 5FR6A 2JT4B 1SEBD 2YNKA 2W54A 4MM3B 4R3DA 1TIFA 3AA0A 1I4RA 5AUKA 3VR8B 1J8CA 3PGRA 1CJEA 4DHJD 1D3ZA 2Z8LA 4PS3A 4IL6O 3DWMA 3A0HO 4AKMA 2WXRA 2KMMA 3PZ8A 1L6UA 1XO3A 2LJIA 2WXKA 1WRIA 4BUMX 1VJKA 4AYMC 5BYQA 1OSMA 4FOZA 2KD0A 2D3GA 3KH0A 4OZCA 3ZNID 1E8ZA 1AYFA 4AYEC 3B1LX 1N5XA 2KC0A 2PE9A 2C7NB 4DDID 1YOVB 3R66C 1WRDB 4MGKE 3QRAA 5EE0A 1WXVA 2JQRB 3LK41 1UF0A 3APDA 4WWNA 4NZLB 1C1YB 5TR5A 3AE3B 1SIFA 2JXXA 4F1SA 2XK5B 4BOZB 2WP9B 4TSSA 2V0GA 4C80A 5J18A 3AN1A 2AL3A 2NBVB 3VZWX 1FPYA 4KR4A 4HPMB 4ARCA 2MBEA 4N74A 2VZKD 2WXOA 3IVFA 2KX3A 5AZFA 2LUMA 3UF8A 2MNHA 3TIXA 5DPWA 4RCOA 5KAIO 2FUG1 1NI2A 3FILB 1LQBA 1L5PA 4A90A 2D2QA 1RFAA 5JDPA 3W1SA 4IM2A 1RYJA 2CHZA 3SYSA 4WAAA 2N1WA 1GFQA 4FSPA 3AU4A 3ETRA 4F8CB 4XYCA 3B08A 3PRZA 5ADXK 3DPDA 2QTKA 5D3IB 4HRSA 1VZ8A 2KTRA 1MG8A 3NZ3A 2KANA 1D6EC 2KACA 1WJ6A 4YSXB 2I1KA 1FNUA 4GCSA 4B0MA 1WX9A 3MJ5A 1ENFA 1WFYA 4GLSC 4KIKB 5DL7A 4H2AA 4FADA 4US8A 3LDZE 5KHQA 5G5GA 1BH3A 3EHVA 3AAEA 2KN5A 2KKCA 3PQUA 2DBYA 3MTNB 3P1MA 1FO4A 3B9JA 4RGTA 4M8MA 4C7ZA 2LHDA 2JMMA 2WXHA 1R7SA 2ZJDA 1E5WA 4AYDC 2BTEA 3GZNB 3O65B 4PK1A 2QIEB 2RR9A 1MPFA 3VH3B 2IGGA 4JL9A 2LGYA 2K8CA 2G1EA 2K4TA 4D64A 1LFDA 1GUAB 3DBHB 1PGBA 2J42A 1ET6A 3NVWA 5C2TB 4JIOU 4NQLB 3PZ7A 1BMLC 4IC7B 4AFKA 3BIID 3TEWA 3ZJUA 2DZKA 1V5TA 4EFOA 3SU8X 2RPQA 2X38A 3PV1A 2KN4A 4ZRKA 1WX7A 1AWDA 1WMHA 1DOIA 1N62A 1DOXA 3GP6A 3DZMA 1NDDA 2GMIC 2ZFGA 2ODJA 7PRNA 3DQVA 3AAAA 4HDOA 1LGRA 1C4CA 3TJPA 2RPVA 5JH5C 1Z2MA 2WGSA 2K6DB 2RMMA 4ZRIA 4GGQA 2N9KA 1L4DB 4HCPB 2EELA 4FXCA 2B3AA 2ZW1A 1SJHD 1UH6A 3ZLZA 3VHTC 3AEFB 3C8YA 1OTRB 1WF9A 3JSVA 2MP2A 1L7YA 1UWXA 1L4ZB 4GF4A 1WI0A 3WI5A 3MJWA 4LNNA 3LK3A 2WJQA 5CX3A 5IO9A 1XD3B 2R8AA 3I9V1 3ML9A 3APCA 3MC8A 4O1NA 2ZVOA 2FGQX 3A9KB 3Q8FA 4G75A 3Q3MC 2KDIA 2J0KA 3RNCC 2W80C 1UD7A 3K19A 2K9XA 1YMHE 5EE1A 1TT5B 3TUOA 2G4DB 2YEPF 1GFNA 5G38A 4WURA 1VDVA 3KZIO 3PREA 2G4SA 1A5RA 3AE6B 3Q3FA 1PFDA 1P98A 4HXDA 4G0NB 3I63C 2FCSA 1WY8A 2V9HA 3PORA 3OJ4B 2WXLA 1HZ6A 2LGIA 2PORA 1MHHE 3PLUA 4RMAA 2FNJB 3QC8B 2XK5A 3RNBC 1Q9GA 3NVZA 3L17A 1BUIC 4MH8A 1IGCA 2KWVB 3BK2A 3W2DA 2EMSA 3RNGC 3DOWA 2A4ZA 2MJ3A 4K7SA 3G7GA 3B2GA 2DAFA 3AI5A 1WXAA 3VTUA 1L0VB 2PEAA 1AW7A 4TUUA 4DHZB 1ZW7A 1ZXHA 3VRAB 1M4VA 2MHJA 1XEEA 2KXPB 1RM6C 1E10A 3RYTA 3TMPB 3PF1A 2LWPA 2FBWB 3V6EB 4PR7A 2J7QB 4FT6A 2PJHA 3VZTX 3AM9A 1TJEA 4KZCA 1ZP0B 1B9RA 4B0EA 2M1MA 2JRHA 4OVZA 3NSGA 3VR9B 2Y0LA 1IZNB 2BKFA 3HRDD 4DHJB 4P1BC 4DQOC 1WE6A 1QOBA 3PQSA 4AKRA 1TKEA 3T8MA 1Y56A 4A8XC 4B95A 4KIKA 3L10B 1PDXA 1KTKA 1ZUD2 3HUIA 5D5DA 1JW9D 1QQRA 3Q8AA 2M0XA 3RPFC 2N2LA 1MI0A 3CWIA 4IOIE 3QX1A 2M56B 2MBBB 3Q3JA 2W82A 1I7HA 4JCHA 4GDKB 1UBIA 1WH3A 2M17A 2WXQA 3FYXA 1HZ5A 2LVPA 1XLPA 3LJ3A 3HM3A 3T3NA 2K8BA 2F1TA 4MSQB 2Y5PA 2KZ7A 2I1JA 2MBQA 4WAFA 2DYBA 4IDIA 5I4DA 5D7GA 1JROA 2A5UA 3V62A 3RBHA 3PZDA 5JXVA 3EUB2 4E1TA 5E79O 2IPKD 2LXCA 5C3JB 4M01A 2AQ3B 2DHZA 3GOEA 1EWCA 3HK0A 2WXIA 4C00A 3JCUO 4WWOA 2BPSA 2LHEA 1YJIA 4G11A 3BRYA 3PSEB 4NAMA 1GFMA 1XT9B 4IW0A 5AZHA 2JPHA 3JW0X 1ZPSA 1V1OA 3EA6A 3SY9A 4G50A 2ON8A 3C19A 3FAHA 1E8XA 4E74A 1SGHA 4W9GA 4W9LA 1KH0A 3T20A 4YT0B 4DK5A 1F2RI 2KC1A 2QILA 5CHVC 2WDTB 3L13A 2PW9A 3S2AA 3DBLB 4TMAB 5ADXL 2OJWA 1F1HA 2PVGC 1JRUA 3BVZA 3IG3A 1WWTA 1TGZB 3EGRA 3DHHC 3H7SA 3WIMA 2O6VB 4DHZE 2NS5A 1WJNA 1FRDA 2LRWA 1GOZA 1D5MC 1FMAD 2KMAA 3A9KA 2OMFA 4ACFA 4II2B 1E6EB 1OGWA 2LMCA 5G3AA 2NBUA 2MH7A 2Y7SA 1RAXA 2IO1B 3AAEB 1TS2A 2HE7A 3QWZB 2WNMA 4YL8A 3C5OA 1H4RA 3W5VB 4YSZB 4Q2JA 3TEZA 2REXA 1RRBA 2XTRA 2L1AA 3RUIB 1Q1OA 3NHEB 4K7UA 2XE3A 3DHGC 3NOBA 2WDQB 1Q5WB 1R4MB 4M00A 1ZKHA 5AEKB 1T1LA 3ZJVA 1QOGA 1L0YB 3GZNI 3P4PB 1KLGD 3VZUX 3HIZA 2BW2A 4KDLB 4AUIA 4HCNB 4FJVB 2CKHB 3SFDB 1QOAA 1N6ZA 3DBHI 1ZHWA 1DGJA 2W9NA 4AP4C 1OEYA 3P4SB 1MM4A 4A6QA 2J4XA 1JQ4A 3P42A 1WR6E 4GN1A 2BB6A 5H2FO 1ISNA 2UU7A 3IBEA 3AMZA 2BYEA 1Q0WB 2GBKA 1QJPA 4AWJA 2ZPYA 3ECIA 3KWLA 2KXPA 1WMHB 4JE3B 1QJ9A 2MW5A 4LSFA 5JZEB 2R88A 4DBGA 4E71A 1DOYA 5E6OA 3NY5A 2LGSA 5DL6A 2SAKA 1X1MA 1FCCC 3AAAB 2PPHA 2WXNA 4OZBA 4O3XB 2JX5A 2J1NA 1IZNA 1UWMA 4O3WA 2MQJA 1OQYA 2WDVB 3KUZA 4MSMB 4WQOB 3A2SX 4KRAA 3QIJA 2KT7A 2L3ZA 1H8CA 2MP2B 1EU4A 4RLCA 2ZNVC 4NJCA 2R2OA 4C69X 4REZA 1VRAB 1FXTB 1T5XD 1IPGA 1T6BX 4NY0A 3TEYA 4N75A 3T0SA 3WALA 1MM5A 3R7RA 1R4NI 2V3PA 4GDKA 4JQWC 4WH4A 5HG2A 5JHBA 1OFFA 2R61A 3RZFA 2FCMA 1BXWA 1TYGB 4K7WA 2WS3B 4HDQA 3POUA 4G76A 5IN7A 1HXTA 4YSYB 3GP7A 4FHKA 3RNEC 1MPEA 1WYGA 4W9CA 2IDYA 2UYZB 1KOTA 1F52A 2W3RA 2GBJA 3P63A 1PUTA 1I4GA 2DZMA 1LM8B 5E6JA 2FIFA 1E54A 4B61A 2M06A 1PHOA 2JYTA 1UNSA 2XEWA 2OHFA 1UGJA 4ICUA 4OZAA 5HFYA 1C79A 1YS5A 3FKYA 3VRBB 1J7CA 2INCC 3QAQA 4ANVA 1K50A 4AYNA 4OVUA 3ONSA 4P7IA 3T24A 2IY1B 3AV8A 3ZRCA 4GHBA 1F0ZA 1E90A 2JVCA 5FKAC 3ZXVA 4FZMA 2ZCBA 3L08A 2LD9A 1JALA 2LFUA 2LGDA 4ZHOA 1C76A 1WGDA 2EKEC 1FNWA 1V80A 4DXAB 1ZGUB 1LXDA 3QQ8B 2V4LA 2GI9A 1XXGA 3DBRB 3W9CB 1VLBA 4IKGA 4HWIB 3JYUA 3ZYYX 1I4HA 1BT9A 1EF5A 2AQ1B 3WCQA 1M94A 3VUXA 1XQQA 2OEDA 3LB8C 4F4BA 2NMQA 3NG0A 3EFCA 4KV2A 2KZRA 3C0RB 3N1XC 2LHFA 4RM9A 2QMTA 2BKRB 2O6VA 4BKGA 5TISO 1OQRA 3ZUNA 1YQ4B 1KF6B 5CTRC 3ZJTA 4AKRB 2DYOA 4OHJA 4BVUC 4XDDA 3U4EG 1ACCA 3ZO5B 1SIJA 2D5GA 3RCZA 1PRNA 4CHKA 1SXTA 1WGKA 1VZ7A 2QCZA 1J0GA 4RLBA 3SD5A 3DCGA 4A9AA 2LUEA 3R2IA 4XWTA 2CHWA 2O6VD 3O13A 3N3KB 4BFRA 3ZTDA 3V3XA 1H6S1 1E7UA 4NPNA 1EF1A 1I42A 1D5ZC 3NUHB 3IAS1 2KMCA 3NZSA 2KJ6A 2KZ7B 2L7RA 1Q9FA 1S3SG 2JZPA 3AEEB 2C7MB 3ML8A 1WX8A 3E56A 2HDEA 2PTLA 2ZNVB 2Y5BB 2AWTA 4PYUA 4O4XA 1WGHA 3IT6B 2BYTA 2D07B 2LASA 1N60A 2Y3AA 5BO4B 5G39A 2K0PA 1D4BA 3H1UA 1L6VA 4RJWA 4MT5A 4W9HA 3PRNA 3SEBA 2KHWB 1V8CA 2IGHA 2CR5A 2M0AA 6PRNA 3UINB 2JQYA 3EMNX 1ZDXA 3FC4A 4JX1C 1V1PB 3KYDD 2KC2A 2BS4B 4K1RB 2RDBC 3PVLA 3R7QA 3VTWA 4IG7B 4A20A 3AH7A 2HJ1A 3ABVB 4KDIC 4CYEA 4M0WB 2G45B 2JXTA 3QK0A 4RNAA 3DBLI 2R4PA 4GXBA 2M8SA 3ZIMA 3KWVA 2IWWA 1TY2A 3OWEB 2BWFA 4RF0A 4Z3TA 2N7JA 1FFUA 3J9CA 3DWOX 1PYWD 4RGNA 2BB5A 2JWUA 4MGZE 1I35A 2AEHA 3POXA 1TTNA 2BGFA 2WDRB 1F77A 4N9F4 2EKIA 3VUYA 3K9PB 4PT5A 2WHIA 1AARA 4A3PA 2WXJA 4RF1A 4D2KA 4UDUC 2YPVA 3I5JC 2KWUB 1THQA 4EUTA 1QZEA 4KVGB 4KGTA 1Z5SB 4LNKA 5D2MB 4ZRJA 2PRNA 3BWUD 5GTIO 3L16A 1NVID 1GPXA 3PTFC 1R4MI 2R4LA 1YQBA 1P7EA 2MEKA 4K3CA 3EECA 2IYDB 1GAQB 2KXJA 5G2NA 4LSIA 2DZIA 3ZXRA 3VY8X 4D5UA 3L54A 2OOBB 1SB3C 2MSED 1YJJA 3AE7B 3R2TA 1TS4A 1FFVA 3W1SC 5LXIB 2BS3B 3DA3A 1FEHA 1GC7A 4L1BA 4G3XB 4JGHB 2WX0A 1MHXA 4JPSA 2C9WB 4N58A 3DVNU 2N4FA 1WYWB 2FE8A 1PGXA 4FZLA 1JRPA 2Z0DB 1WJUA 1XLOA 2KO3A 2LXAA 1Q10A 4NQKE 3LK42 3BY4B 4ITKA 3X23A 5PRNA 2BBCA 2ONQA 4HEA1 4W9KA 2BWES 3K9OB 3Q8BA 1GB1A 1KM7A 4K81A 5FK9C 1JWMD 5DL5A 1C4AA 2NVUI 2N2MA 1QJ8A 3ZTCA 3TL5A 2MLBA 1ZDVA 2CU1A 2IJ0A 3Q2AC 1KLVA 2WXGA 2SEBD 4AYID 2RDGA 1XF5L 5IKCM 2KWCA 2CHXA 2CS4A 3GB1A 4ANXA 3OLMD 4FN2A 3BVGA 2I38A 2E3TA 3MHZA 2O4VA 2XE2A 2V3SA 2KLGA 1DYQA 3UU2A 1QOFA 4GU2A 1MFWA 2KQSA 1WXQA 5IAAC 4WWMA 5HI1A 4WJNA 2N7EA 1OPFA 2C7HA 5D6JB 4UB6O 4CQNA 3DWNA 3WAPA 2C5LC 4NJ6A 2Z0EB 2XTQA 3PGUA 1FIQA 1V2YA 2W55A 4C7YA 3U52E 2NR2A 3O0EA 2D3BA 3SR6A 2KQ4X 2QJLA 3A33B 4ZHPA 2JYEA 4BBNF 3BYYB 3RN9C 4W9IA 4YTPB 3GE3C 3H7PA 3A4SC 4KKIA 4XWWA 2R2QA 2KAJA 5LLIA 4KR8A 2KX0A 5GTHO 4WJOA 1V6EA 1T16A 3WANA 4E1SA 1P3QU 1KFYB 1WM3A 4KZ0A 5KHOA 4C4VB 1C4PA 4HJGE 3NVVA 1P1AA 2ZEQA 4QQ1A 1JWSD 1VD2A 4XE0A 4LK0M 4EEWA 5T8IA 2HD5B 3Q69A 2KFKB 2BYFA 4RJXA 1UBQA 2WXFA 2BQQA 4ICVA 1J7BA 1V1PA 3N1YC 1PGAA 2F1VA 4KSKC 2H88B 1JWUD 3QRCA 3IFWB 3M62B 5AZGA 2RGFA 4M0WA 3HM6X 2ICIA 4WWPA 3RFZB 2AXTO 4BAXA 1QILA 2GBMA 4O3YA 4PS8A 4FRTA 5TSSA 4GMVA 3V60A 3UPGA 4FZNA 3RULA 4I6LB 1WGRA 1EU3A 5IOIA 1SJED 2MA9B 2DENB 2MBHA 3CSFA 4EZLA 4DWFA 4HLEA 3PHWB 4ZOHC 3URYA 3VH4B 2K8HA 4B6WA 3QARA 2KDEB 1NYQA 1HXXA 3H9DA 3N30A 1G90A 1YX5B 1SF0A 1MJDA 3BINA 2J0MA 3AEDB 4HPLB 4PJ0O 3KUCB 3Q8CA 1VCBA 3ENEA 2Z59B 1MVKA 2ZPNA 1HXYD 4HKQA 1FM0D 1FCLA 1YJ1A 2Y5CA 2B76B 2QSDA 4MDKE 1XCTL 3MC0B 3AEGB 4LLGM 5D3DA 2N7DA 4PYZA 3BYTB 4HKZE 1B1ZA 5D94A 2ASQA 1JWAD 3Q14C 1TZ1A 3QA8A 3CIRB 1YIWA 1IYFA 5DL8A 5GV0A 4FHJA 1FXAA 3TEXA 1E8WA 1VZ6A 2WWZA 3W5UB 2LJ5A 2XBBC 2GRIA 2I2YA 4XC2A 2YEPB 4W9DA 2DLBA 3N20C 3W1YA 4UB8O 1T0SC 2K3UA 2R89A 2OJRA 4KGSA 1TKYA 3VFKA 2KWDA 2IGDA 2JZ3B
chains in the Genus database with same CATH topology
4N74A 3MC8A 4C00A 2QCZA 3NJTA 2X8XX 2VH1A 3EFCA 4XGAB 3OG5A 2V9HA 4BZAA 3MC9A 4K3CA 4C4VB 2MHJA 3Q6BA 4QAYA 2VH2A 4K3BA 4C4VA 4PK1A 4N75A 2QDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N74 A;  3MC8 A;  4C00 A;  2QCZ A;  3NJT A;  2X8X X;  2VH1 A;  3EFC A;  4XGA B;  3OG5 A;  2V9H A;  4BZA A;  3MC9 A;  4K3C A;  4C4V B;  2MHJ A;  3Q6B A;  4QAY A;  2VH2 A;  4K3B A;  4C4V A;  4PK1 A;  4N75 A;  2QDF A; 
#chains in the Genus database with same CATH topology
 3ZRF A;  2XE5 A;  2FCN A;  4IWP A;  1SE4 A;  3PPA A;  2JF5 A;  4JWS C;  3AA7 B;  4GCQ A;  2KLC A;  2XNA C;  3LK2 B;  1HA5 A;  3V6C B;  4ANU A;  3UQB A;  2L8J A;  4W9E A;  2NTT A;  1TS5 A;  5CHF A;  1ZHT A;  3SHQ A;  4U9C A;  4RGO S;  2PVO D;  3N32 A;  3RZW C;  4FLH A;  5L83 A;  1TY0 A;  2C60 A;  2MX2 A;  1YN3 A;  3VY9 X;  3U2S C;  4X57 B;  2IO2 B;  2L0F A;  4XDC A;  4GDL A;  5EDS A;  5C23 A;  1A70 A;  2J0J A;  1FNV A;  3V61 A;  4XGA B;  3A0B O;  5FVN A;  1JML A;  3M95 A;  5KAF O;  3CMM B;  2ERV A;  1EUV B;  2Y0K A;  3WAO A;  1P4T A;  1IGD A;  1N61 A;  5J2R A;  4EZK A;  4ZDV A;  3AXC A;  1WJ4 A;  1XLQ A;  2KDF B;  4BKT A;  5H92 C;  1ZHZ A;  3BK1 A;  4IWO A;  4LSE A;  4B9K A;  1V97 A;  1FD6 A;  1K52 A;  1I4P A;  3KUD B;  1QT9 A;  5J17 A;  1WZ3 A;  4A55 A;  2K0L A;  4NJ7 A;  2MBO A;  1LO5 D;  4F7Z A;  3TSS A;  3BS0 A;  1WR1 A;  1RLF A;  1YQ3 B;  2QC8 A;  1TKG A;  1D5X C;  3R8B A;  1SSN A;  1IP9 A;  3RI7 C;  3HW9 A;  4HPP A;  1ZOY B;  3P4R B;  4XZ4 A;  5BMH A;  3PRM B;  1CK1 A;  4IWQ A;  4IUM B;  1E7V A;  3IAM 1;  1NYR A;  4WJQ A;  2J52 A;  4P16 A;  1V81 A;  2WQY B;  2EMT A;  4ZYS A;  3N9Y C;  4C56 C;  2CJO A;  4M02 A;  2HTH A;  4AZL A;  2BF8 B;  4C4V A;  1HE8 A;  2V4I B;  3IT4 B;  5T5F A;  2KK8 A;  1CMX B;  3AB5 A;  2MWS B;  1SE2 A;  4FJY A;  3BRZ A;  2KFK A;  5G55 A;  3UI3 A;  3BZD B;  2GB1 A;  2D3C A;  2XG6 A;  3SZD A;  1E9M A;  2CU3 A;  2PLP A;  1T0Y A;  4IM0 A;  3PGS A;  2M4N A;  2H89 B;  4M8N A;  2WU2 B;  2V3N A;  5DPR A;  1NBF C;  4MH0 E;  1TBE A;  3KW5 B;  2M19 A;  3A9J B;  1C9F A;  3A1Q B;  3EC8 A;  2IO0 B;  5C1Z A;  4MGI E;  1FRR A;  3M3J A;  2LVO A;  4RFB A;  3PLV A;  4HJK A;  2X27 X;  2HTM E;  5AFU K;  3DA4 A;  3M63 B;  5GMV A;  4EKU A;  2WJR A;  5H8Y E;  1T0Q C;  2LI5 A;  3QCA A;  1WZ0 A;  2KNB A;  2FCQ A;  3OG5 A;  4LDT B;  4LJP B;  4BOS C;  3P2B A;  4J6I A;  2GLS A;  4LCD E;  2LRU A;  1HTQ A;  2IY0 B;  3AE5 B;  3DVG Y;  3DBS A;  2M07 A;  2K25 A;  1C3T A;  4W9J A;  3AUL A;  4MGY E;  3VE1 A;  3KYC D;  3ZQ4 A;  4YXD B;  4LJO B;  1C78 A;  4FBJ B;  2G3Q B;  5DPT A;  2KJH B;  3H7P B;  1N63 A;  4A3O A;  3CF6 E;  3VUW A;  4S0R A;  4MAC A;  8PRN A;  2K1F A;  2X9K A;  1KRH A;  3VQI A;  2IBI B;  4P1C C;  1JCK B;  1HTO A;  4FA6 A;  2J53 A;  3AA1 B;  4KKJ A;  2MCN B;  2GE4 A;  1OEY J;  3AA7 A;  4E3C A;  3Q8E A;  3LK2 A;  1ZHY A;  4FRX A;  4JFB A;  3Q3N C;  3QJZ A;  2L05 A;  4OVV A;  3T9L A;  4MEM A;  4PUX A;  5E6P A;  1K53 A;  2PIA A;  3AA6 B;  4N59 A;  4W9F A;  1L0X B;  2KJR A;  1UZX B;  1TZO A;  2LVQ A;  4P6V F;  1P7F A;  1K51 A;  5HKH A;  2FAZ A;  2JY6 A;  3WI4 A;  1ZHX A;  4RM8 A;  1S5L O;  2FID A;  3NS1 A;  3UIP B;  1GG3 A;  4BKS A;  4CO7 A;  1SE9 A;  2QEJ C;  1IBX A;  4US9 A;  4RGM A;  1SE3 A;  1CZP A;  2KQ7 A;  1VR9 A;  4GSW A;  1QF6 A;  2O2V B;  3AU5 A;  2WLB A;  4O49 A;  3SYB A;  3U7D A;  3SDL C;  3AEC B;  1KJT A;  3AE1 B;  1BXT A;  2ZCC A;  4AS1 A;  2CJN A;  2E6X A;  3UGB B;  4BKS D;  4HVB A;  1T0R C;  2KDB A;  3L4P A;  3UQA A;  1GC6 A;  2N9E B;  1OQQ A;  5B5E O;  2KTF A;  1NI3 A;  5GXG B;  2ZW0 A;  4HK2 A;  2NPT B;  4MM3 A;  4XNK A;  3D32 A;  2MJD A;  3GS2 A;  3V05 A;  3VAW A;  1R4N B;  2ZZP B;  3U30 A;  2WVP A;  1WXM A;  3AEA B;  1UUP A;  2KVR A;  3U8Z A;  1ESF A;  1XLN A;  3ZGZ A;  4PS7 A;  2RSU A;  3LXF A;  1MG4 A;  2UWQ A;  3P4Q B;  5E6N A;  3Q6B A;  3NS8 A;  3DHI C;  3AE2 B;  3OAW A;  5IA7 A;  3MP9 A;  4XNL A;  1YX6 B;  2QDF A;  3VE2 A;  4AQ7 A;  1STE A;  4DXF A;  4TV3 A;  3VTV A;  2J4U P;  2KVZ A;  3PS6 A;  4TQ0 A;  2MRP A;  3EFU A;  1J19 A;  2JSV X;  2ZLD A;  5L95 C;  3KVD D;  3WA0 A;  1YN5 A;  2PKO A;  1BT0 A;  4N6E B;  2DZJ A;  3APF A;  1Y8R C;  2VRR B;  3BVM A;  3UAQ A;  2ZVN A;  2X8X X;  2GBR A;  4WQM A;  1GJZ A;  3JVZ X;  3KLS X;  3SZV A;  3WAM A;  3FIL A;  5FR3 A;  1QLB B;  5B66 O;  2N9L A;  4I6P A;  3A9J A;  3A1Q A;  4GDL B;  1K8R B;  4MJS B;  4GCP A;  2JUO A;  3CST A;  5LNK 1;  4O4U A;  5CHW A;  3UIO B;  2JRI B;  2LZ6 A;  1T3Q A;  2N9P C;  2K22 A;  2L76 A;  1UEL A;  4FQE A;  4OW0 A;  3DDC B;  5EE9 A;  3QHT A;  2F1C X;  3ZDM C;  4LNO A;  4AJY B;  2IND C;  2VH2 A;  3ZNG C;  4K3B A;  1SBB B;  3LYY A;  4D65 A;  5DPS A;  3HWB A;  4NAW B;  2L00 B;  1RFK A;  1V49 A;  3L0W B;  3R3M A;  2K39 A;  2L83 A;  4ZRQ A;  4JWU C;  5EE2 A;  3VDZ A;  3MFG A;  4FSO A;  4L2Y A;  3AA0 B;  2KDM A;  4JLC A;  1EWY C;  2IWV A;  2BT6 A;  4LDT D;  2LEK A;  2G9H D;  3V8U A;  2AYO B;  2GBN A;  1GFP A;  2IO3 B;  3ZW3 A;  1C77 A;  4ARI A;  3H6N A;  1NEK B;  4LSH A;  2TSS A;  5IP4 D;  2MJE A;  3VVW B;  5IYU A;  3NZU A;  3AE9 B;  1FXI A;  1CQV A;  2GOW A;  3AE4 B;  1WXS A;  3NRZ A;  1ORM A;  2L32 A;  2AQ2 B;  4L23 A;  2R4O A;  3AA1 A;  1RWS A;  1JWB D;  2DNF A;  1AN8 A;  2VZK B;  4TQ1 A;  4ANW A;  1S1Q B;  1YNT E;  5BMI A;  1GNU A;  1I4X A;  4LTU A;  4MEL A;  4FUV A;  1YD8 U;  1HXU A;  4RH6 A;  2QHO A;  4II3 B;  3ZDT A;  4ZYN A;  3AA6 A;  4YTN B;  3RD2 A;  1TS3 A;  4LNF A;  1WIA A;  2INP E;  2JZZ A;  3PRP B;  2LFI A;  4DDG D;  3KVF B;  4KSL C;  4ZRP A;  1HQR D;  2KFJ A;  3RNA C;  1EM7 A;  3DWG C;  2DX5 B;  3DBR I;  1E7P B;  1E0Z A;  2NCN A;  2DYM A;  5G26 A;  1I4Q A;  1KLU D;  5BYR A;  4URK A;  3HVZ A;  2W81 C;  3HOL A;  1V86 A;  3RMK C;  2NTS A;  1WE7 A;  3B0A A;  4DXG A;  2O2V A;  4XX5 A;  2N9X A;  3N1Z C;  3GE8 C;  2L52 A;  2NBW B;  2WXP A;  2RD0 A;  2KDY A;  1WSP A;  2FGR A;  2RDH A;  3JTY A;  3Q3O C;  3ZNZ B;  1E8Y A;  1GB4 A;  5AFU L;  2WX1 A;  2KOX A;  2AL6 A;  1V5O A;  2YLM A;  2K6Q A;  2KTR B;  2Q5W D;  4YTM B;  4ASW C;  2JU6 X;  3KQ4 A;  5BMG A;  2D11 A;  1WM2 A;  5G5H A;  2BVC A;  3RT3 B;  2BS2 B;  3SY7 A;  2JWZ A;  2NPT A;  2VH1 A;  4AJW A;  3AEB B;  2INN E;  4BBN C;  2W3S A;  3E9S A;  3HVD A;  4GOC A;  3MHS D;  3ZNH B;  3TBL D;  4CTD A;  5MPO A;  4J3O D;  1UGM A;  1XCQ L;  4AUQ C;  3ZVV A;  3AE8 B;  3PT2 B;  2XE1 A;  4GIV A;  5HHD G;  3H8H A;  4QAY A;  3DVN V;  3NVY A;  4BZA A;  2D3A A;  4YWG G;  3IHP C;  1HEZ E;  3WU2 O;  2LGX A;  1N5W A;  1WGG A;  3I57 A;  2N1V A;  2L0T A;  4USA A;  4EZJ A;  3PO0 A;  1F9J A;  3PGE A;  5EE3 A;  1J7A A;  3TZG A;  1F2R C;  2R4N A;  2V1Y A;  4EE2 A;  5DCN A;  1L2N A;  5BYS A;  5LXH A;  1P9D U;  2D10 A;  1EO6 A;  3ALB A;  4I6N B;  3A4R A;  2WYQ A;  2WXM A;  1U4A A;  4AOF A;  1G6J A;  4KGR A;  4KX6 B;  2Y2X A;  3TCA A;  3U7Z A;  1P0R A;  2DAJ A;  1ZXI A;  4TKN A;  1QKZ A;  3B2F A;  2BYV E;  1WGY A;  3HHM A;  1YN4 A;  4FMS A;  2IZV B;  4LNI A;  3ZKJ C;  3RNF C;  2WU5 B;  4WJP A;  2PE6 B;  1NEN B;  3DVG X;  5JHA A;  3OJ3 A;  2AX5 A;  3T3O A;  4MJS A;  3NJT A;  2PMV A;  2KYW A;  4GB9 A;  2K5P A;  4WIP A;  2XMX A;  3HOE A;  4IM3 A;  1IBX B;  3X0W A;  2Y0H A;  3I3T B;  2MHL A;  5AUI A;  3POQ A;  4S17 A;  4EOY A;  1GFO A;  1PQS A;  1ET9 A;  2XN9 C;  1IUE A;  2ACZ B;  4FJZ A;  2FUH B;  4RL9 A;  2N0S B;  3JSV B;  4NNJ B;  4NAW A;  4HRO A;  2DWQ A;  3IXS A;  4FES A;  3SFE B;  3MC9 A;  4FUL A;  2YVC A;  3LK3 B;  2HJ8 A;  1V9J A;  3PHX B;  1ROE A;  3VXW A;  1ZE3 D;  4O3Z A;  5FR6 A;  2JT4 B;  1SEB D;  2YNK A;  2W54 A;  4MM3 B;  4R3D A;  1TIF A;  3AA0 A;  1I4R A;  5AUK A;  3VR8 B;  1J8C A;  3PGR A;  1CJE A;  4DHJ D;  1D3Z A;  2Z8L A;  4PS3 A;  4IL6 O;  3DWM A;  3A0H O;  4AKM A;  2WXR A;  2KMM A;  3PZ8 A;  1L6U A;  1XO3 A;  2LJI A;  2WXK A;  1WRI A;  4BUM X;  1VJK A;  4AYM C;  5BYQ A;  1OSM A;  4FOZ A;  2KD0 A;  2D3G A;  3KH0 A;  4OZC A;  3ZNI D;  1E8Z A;  1AYF A;  4AYE C;  3B1L X;  1N5X A;  2KC0 A;  2PE9 A;  2C7N B;  4DDI D;  1YOV B;  3R66 C;  1WRD B;  4MGK E;  3QRA A;  5EE0 A;  1WXV A;  2JQR B;  3LK4 1;  1UF0 A;  3APD A;  4WWN A;  4NZL B;  1C1Y B;  5TR5 A;  3AE3 B;  1SIF A;  2JXX A;  4F1S A;  2XK5 B;  4BOZ B;  2WP9 B;  4TSS A;  2V0G A;  4C80 A;  5J18 A;  3AN1 A;  2AL3 A;  2NBV B;  3VZW X;  1FPY A;  4KR4 A;  4HPM B;  4ARC A;  2MBE A;  4N74 A;  2VZK D;  2WXO A;  3IVF A;  2KX3 A;  5AZF A;  2LUM A;  3UF8 A;  2MNH A;  3TIX A;  5DPW A;  4RCO A;  5KAI O;  2FUG 1;  1NI2 A;  3FIL B;  1LQB A;  1L5P A;  4A90 A;  2D2Q A;  1RFA A;  5JDP A;  3W1S A;  4IM2 A;  1RYJ A;  2CHZ A;  3SYS A;  4WAA A;  2N1W A;  1GFQ A;  4FSP A;  3AU4 A;  3ETR A;  4F8C B;  4XYC A;  3B08 A;  3PRZ A;  5ADX K;  3DPD A;  2QTK A;  5D3I B;  4HRS A;  1VZ8 A;  2KTR A;  1MG8 A;  3NZ3 A;  2KAN A;  1D6E C;  2KAC A;  1WJ6 A;  4YSX B;  2I1K A;  1FNU A;  4GCS A;  4B0M A;  1WX9 A;  3MJ5 A;  1ENF A;  1WFY A;  4GLS C;  4KIK B;  5DL7 A;  4H2A A;  4FAD A;  4US8 A;  3LDZ E;  5KHQ A;  5G5G A;  1BH3 A;  3EHV A;  3AAE A;  2KN5 A;  2KKC A;  3PQU A;  2DBY A;  3MTN B;  3P1M A;  1FO4 A;  3B9J A;  4RGT A;  4M8M A;  4C7Z A;  2LHD A;  2JMM A;  2WXH A;  1R7S A;  2ZJD A;  1E5W A;  4AYD C;  2BTE A;  3GZN B;  3O65 B;  4PK1 A;  2QIE B;  2RR9 A;  1MPF A;  3VH3 B;  2IGG A;  4JL9 A;  2LGY A;  2K8C A;  2G1E A;  2K4T A;  4D64 A;  1LFD A;  1GUA B;  3DBH B;  1PGB A;  2J42 A;  1ET6 A;  3NVW A;  5C2T B;  4JIO U;  4NQL B;  3PZ7 A;  1BML C;  4IC7 B;  4AFK A;  3BII D;  3TEW A;  3ZJU A;  2DZK A;  1V5T A;  4EFO A;  3SU8 X;  2RPQ A;  2X38 A;  3PV1 A;  2KN4 A;  4ZRK A;  1WX7 A;  1AWD A;  1WMH A;  1DOI A;  1N62 A;  1DOX A;  3GP6 A;  3DZM A;  1NDD A;  2GMI C;  2ZFG A;  2ODJ A;  7PRN A;  3DQV A;  3AAA A;  4HDO A;  1LGR A;  1C4C A;  3TJP A;  2RPV A;  5JH5 C;  1Z2M A;  2WGS A;  2K6D B;  2RMM A;  4ZRI A;  4GGQ A;  2N9K A;  1L4D B;  4HCP B;  2EEL A;  4FXC A;  2B3A A;  2ZW1 A;  1SJH D;  1UH6 A;  3ZLZ A;  3VHT C;  3AEF B;  3C8Y A;  1OTR B;  1WF9 A;  3JSV A;  2MP2 A;  1L7Y A;  1UWX A;  1L4Z B;  4GF4 A;  1WI0 A;  3WI5 A;  3MJW A;  4LNN A;  3LK3 A;  2WJQ A;  5CX3 A;  5IO9 A;  1XD3 B;  2R8A A;  3I9V 1;  3ML9 A;  3APC A;  3MC8 A;  4O1N A;  2ZVO A;  2FGQ X;  3A9K B;  3Q8F A;  4G75 A;  3Q3M C;  2KDI A;  2J0K A;  3RNC C;  2W80 C;  1UD7 A;  3K19 A;  2K9X A;  1YMH E;  5EE1 A;  1TT5 B;  3TUO A;  2G4D B;  2YEP F;  1GFN A;  5G38 A;  4WUR A;  1VDV A;  3KZI O;  3PRE A;  2G4S A;  1A5R A;  3AE6 B;  3Q3F A;  1PFD A;  1P98 A;  4HXD A;  4G0N B;  3I63 C;  2FCS A;  1WY8 A;  2V9H A;  3POR A;  3OJ4 B;  2WXL A;  1HZ6 A;  2LGI A;  2POR A;  1MHH E;  3PLU A;  4RMA A;  2FNJ B;  3QC8 B;  2XK5 A;  3RNB C;  1Q9G A;  3NVZ A;  3L17 A;  1BUI C;  4MH8 A;  1IGC A;  2KWV B;  3BK2 A;  3W2D A;  2EMS A;  3RNG C;  3DOW A;  2A4Z A;  2MJ3 A;  4K7S A;  3G7G A;  3B2G A;  2DAF A;  3AI5 A;  1WXA A;  3VTU A;  1L0V B;  2PEA A;  1AW7 A;  4TUU A;  4DHZ B;  1ZW7 A;  1ZXH A;  3VRA B;  1M4V A;  2MHJ A;  1XEE A;  2KXP B;  1RM6 C;  1E10 A;  3RYT A;  3TMP B;  3PF1 A;  2LWP A;  2FBW B;  3V6E B;  4PR7 A;  2J7Q B;  4FT6 A;  2PJH A;  3VZT X;  3AM9 A;  1TJE A;  4KZC A;  1ZP0 B;  1B9R A;  4B0E A;  2M1M A;  2JRH A;  4OVZ A;  3NSG A;  3VR9 B;  2Y0L A;  1IZN B;  2BKF A;  3HRD D;  4DHJ B;  4P1B C;  4DQO C;  1WE6 A;  1QOB A;  3PQS A;  4AKR A;  1TKE A;  3T8M A;  1Y56 A;  4A8X C;  4B95 A;  4KIK A;  3L10 B;  1PDX A;  1KTK A;  1ZUD 2;  3HUI A;  5D5D A;  1JW9 D;  1QQR A;  3Q8A A;  2M0X A;  3RPF C;  2N2L A;  1MI0 A;  3CWI A;  4IOI E;  3QX1 A;  2M56 B;  2MBB B;  3Q3J A;  2W82 A;  1I7H A;  4JCH A;  4GDK B;  1UBI A;  1WH3 A;  2M17 A;  2WXQ A;  3FYX A;  1HZ5 A;  2LVP A;  1XLP A;  3LJ3 A;  3HM3 A;  3T3N A;  2K8B A;  2F1T A;  4MSQ B;  2Y5P A;  2KZ7 A;  2I1J A;  2MBQ A;  4WAF A;  2DYB A;  4IDI A;  5I4D A;  5D7G A;  1JRO A;  2A5U A;  3V62 A;  3RBH A;  3PZD A;  5JXV A;  3EUB 2;  4E1T A;  5E79 O;  2IPK D;  2LXC A;  5C3J B;  4M01 A;  2AQ3 B;  2DHZ A;  3GOE A;  1EWC A;  3HK0 A;  2WXI A;  4C00 A;  3JCU O;  4WWO A;  2BPS A;  2LHE A;  1YJI A;  4G11 A;  3BRY A;  3PSE B;  4NAM A;  1GFM A;  1XT9 B;  4IW0 A;  5AZH A;  2JPH A;  3JW0 X;  1ZPS A;  1V1O A;  3EA6 A;  3SY9 A;  4G50 A;  2ON8 A;  3C19 A;  3FAH A;  1E8X A;  4E74 A;  1SGH A;  4W9G A;  4W9L A;  1KH0 A;  3T20 A;  4YT0 B;  4DK5 A;  1F2R I;  2KC1 A;  2QIL A;  5CHV C;  2WDT B;  3L13 A;  2PW9 A;  3S2A A;  3DBL B;  4TMA B;  5ADX L;  2OJW A;  1F1H A;  2PVG C;  1JRU A;  3BVZ A;  3IG3 A;  1WWT A;  1TGZ B;  3EGR A;  3DHH C;  3H7S A;  3WIM A;  2O6V B;  4DHZ E;  2NS5 A;  1WJN A;  1FRD A;  2LRW A;  1GOZ A;  1D5M C;  1FMA D;  2KMA A;  3A9K A;  2OMF A;  4ACF A;  4II2 B;  1E6E B;  1OGW A;  2LMC A;  5G3A A;  2NBU A;  2MH7 A;  2Y7S A;  1RAX A;  2IO1 B;  3AAE B;  1TS2 A;  2HE7 A;  3QWZ B;  2WNM A;  4YL8 A;  3C5O A;  1H4R A;  3W5V B;  4YSZ B;  4Q2J A;  3TEZ A;  2REX A;  1RRB A;  2XTR A;  2L1A A;  3RUI B;  1Q1O A;  3NHE B;  4K7U A;  2XE3 A;  3DHG C;  3NOB A;  2WDQ B;  1Q5W B;  1R4M B;  4M00 A;  1ZKH A;  5AEK B;  1T1L A;  3ZJV A;  1QOG A;  1L0Y B;  3GZN I;  3P4P B;  1KLG D;  3VZU X;  3HIZ A;  2BW2 A;  4KDL B;  4AUI A;  4HCN B;  4FJV B;  2CKH B;  3SFD B;  1QOA A;  1N6Z A;  3DBH I;  1ZHW A;  1DGJ A;  2W9N A;  4AP4 C;  1OEY A;  3P4S B;  1MM4 A;  4A6Q A;  2J4X A;  1JQ4 A;  3P42 A;  1WR6 E;  4GN1 A;  2BB6 A;  5H2F O;  1ISN A;  2UU7 A;  3IBE A;  3AMZ A;  2BYE A;  1Q0W B;  2GBK A;  1QJP A;  4AWJ A;  2ZPY A;  3ECI A;  3KWL A;  2KXP A;  1WMH B;  4JE3 B;  1QJ9 A;  2MW5 A;  4LSF A;  5JZE B;  2R88 A;  4DBG A;  4E71 A;  1DOY A;  5E6O A;  3NY5 A;  2LGS A;  5DL6 A;  2SAK A;  1X1M A;  1FCC C;  3AAA B;  2PPH A;  2WXN A;  4OZB A;  4O3X B;  2JX5 A;  2J1N A;  1IZN A;  1UWM A;  4O3W A;  2MQJ A;  1OQY A;  2WDV B;  3KUZ A;  4MSM B;  4WQO B;  3A2S X;  4KRA A;  3QIJ A;  2KT7 A;  2L3Z A;  1H8C A;  2MP2 B;  1EU4 A;  4RLC A;  2ZNV C;  4NJC A;  2R2O A;  4C69 X;  4REZ A;  1VRA B;  1FXT B;  1T5X D;  1IPG A;  1T6B X;  4NY0 A;  3TEY A;  4N75 A;  3T0S A;  3WAL A;  1MM5 A;  3R7R A;  1R4N I;  2V3P A;  4GDK A;  4JQW C;  4WH4 A;  5HG2 A;  5JHB A;  1OFF A;  2R61 A;  3RZF A;  2FCM A;  1BXW A;  1TYG B;  4K7W A;  2WS3 B;  4HDQ A;  3POU A;  4G76 A;  5IN7 A;  1HXT A;  4YSY B;  3GP7 A;  4FHK A;  3RNE C;  1MPE A;  1WYG A;  4W9C A;  2IDY A;  2UYZ B;  1KOT A;  1F52 A;  2W3R A;  2GBJ A;  3P63 A;  1PUT A;  1I4G A;  2DZM A;  1LM8 B;  5E6J A;  2FIF A;  1E54 A;  4B61 A;  2M06 A;  1PHO A;  2JYT A;  1UNS A;  2XEW A;  2OHF A;  1UGJ A;  4ICU A;  4OZA A;  5HFY A;  1C79 A;  1YS5 A;  3FKY A;  3VRB B;  1J7C A;  2INC C;  3QAQ A;  4ANV A;  1K50 A;  4AYN A;  4OVU A;  3ONS A;  4P7I A;  3T24 A;  2IY1 B;  3AV8 A;  3ZRC A;  4GHB A;  1F0Z A;  1E90 A;  2JVC A;  5FKA C;  3ZXV A;  4FZM A;  2ZCB A;  3L08 A;  2LD9 A;  1JAL A;  2LFU A;  2LGD A;  4ZHO A;  1C76 A;  1WGD A;  2EKE C;  1FNW A;  1V80 A;  4DXA B;  1ZGU B;  1LXD A;  3QQ8 B;  2V4L A;  2GI9 A;  1XXG A;  3DBR B;  3W9C B;  1VLB A;  4IKG A;  4HWI B;  3JYU A;  3ZYY X;  1I4H A;  1BT9 A;  1EF5 A;  2AQ1 B;  3WCQ A;  1M94 A;  3VUX A;  1XQQ A;  2OED A;  3LB8 C;  4F4B A;  2NMQ A;  3NG0 A;  3EFC A;  4KV2 A;  2KZR A;  3C0R B;  3N1X C;  2LHF A;  4RM9 A;  2QMT A;  2BKR B;  2O6V A;  4BKG A;  5TIS O;  1OQR A;  3ZUN A;  1YQ4 B;  1KF6 B;  5CTR C;  3ZJT A;  4AKR B;  2DYO A;  4OHJ A;  4BVU C;  4XDD A;  3U4E G;  1ACC A;  3ZO5 B;  1SIJ A;  2D5G A;  3RCZ A;  1PRN A;  4CHK A;  1SXT A;  1WGK A;  1VZ7 A;  2QCZ A;  1J0G A;  4RLB A;  3SD5 A;  3DCG A;  4A9A A;  2LUE A;  3R2I A;  4XWT A;  2CHW A;  2O6V D;  3O13 A;  3N3K B;  4BFR A;  3ZTD A;  3V3X A;  1H6S 1;  1E7U A;  4NPN A;  1EF1 A;  1I42 A;  1D5Z C;  3NUH B;  3IAS 1;  2KMC A;  3NZS A;  2KJ6 A;  2KZ7 B;  2L7R A;  1Q9F A;  1S3S G;  2JZP A;  3AEE B;  2C7M B;  3ML8 A;  1WX8 A;  3E56 A;  2HDE A;  2PTL A;  2ZNV B;  2Y5B B;  2AWT A;  4PYU A;  4O4X A;  1WGH A;  3IT6 B;  2BYT A;  2D07 B;  2LAS A;  1N60 A;  2Y3A A;  5BO4 B;  5G39 A;  2K0P A;  1D4B A;  3H1U A;  1L6V A;  4RJW A;  4MT5 A;  4W9H A;  3PRN A;  3SEB A;  2KHW B;  1V8C A;  2IGH A;  2CR5 A;  2M0A A;  6PRN A;  3UIN B;  2JQY A;  3EMN X;  1ZDX A;  3FC4 A;  4JX1 C;  1V1P B;  3KYD D;  2KC2 A;  2BS4 B;  4K1R B;  2RDB C;  3PVL A;  3R7Q A;  3VTW A;  4IG7 B;  4A20 A;  3AH7 A;  2HJ1 A;  3ABV B;  4KDI C;  4CYE A;  4M0W B;  2G45 B;  2JXT A;  3QK0 A;  4RNA A;  3DBL I;  2R4P A;  4GXB A;  2M8S A;  3ZIM A;  3KWV A;  2IWW A;  1TY2 A;  3OWE B;  2BWF A;  4RF0 A;  4Z3T A;  2N7J A;  1FFU A;  3J9C A;  3DWO X;  1PYW D;  4RGN A;  2BB5 A;  2JWU A;  4MGZ E;  1I35 A;  2AEH A;  3POX A;  1TTN A;  2BGF A;  2WDR B;  1F77 A;  4N9F 4;  2EKI A;  3VUY A;  3K9P B;  4PT5 A;  2WHI A;  1AAR A;  4A3P A;  2WXJ A;  4RF1 A;  4D2K A;  4UDU C;  2YPV A;  3I5J C;  2KWU B;  1THQ A;  4EUT A;  1QZE A;  4KVG B;  4KGT A;  1Z5S B;  4LNK A;  5D2M B;  4ZRJ A;  2PRN A;  3BWU D;  5GTI O;  3L16 A;  1NVI D;  1GPX A;  3PTF C;  1R4M I;  2R4L A;  1YQB A;  1P7E A;  2MEK A;  4K3C A;  3EEC A;  2IYD B;  1GAQ B;  2KXJ A;  5G2N A;  4LSI A;  2DZI A;  3ZXR A;  3VY8 X;  4D5U A;  3L54 A;  2OOB B;  1SB3 C;  2MSE D;  1YJJ A;  3AE7 B;  3R2T A;  1TS4 A;  1FFV A;  3W1S C;  5LXI B;  2BS3 B;  3DA3 A;  1FEH A;  1GC7 A;  4L1B A;  4G3X B;  4JGH B;  2WX0 A;  1MHX A;  4JPS A;  2C9W B;  4N58 A;  3DVN U;  2N4F A;  1WYW B;  2FE8 A;  1PGX A;  4FZL A;  1JRP A;  2Z0D B;  1WJU A;  1XLO A;  2KO3 A;  2LXA A;  1Q10 A;  4NQK E;  3LK4 2;  3BY4 B;  4ITK A;  3X23 A;  5PRN A;  2BBC A;  2ONQ A;  4HEA 1;  4W9K A;  2BWE S;  3K9O B;  3Q8B A;  1GB1 A;  1KM7 A;  4K81 A;  5FK9 C;  1JWM D;  5DL5 A;  1C4A A;  2NVU I;  2N2M A;  1QJ8 A;  3ZTC A;  3TL5 A;  2MLB A;  1ZDV A;  2CU1 A;  2IJ0 A;  3Q2A C;  1KLV A;  2WXG A;  2SEB D;  4AYI D;  2RDG A;  1XF5 L;  5IKC M;  2KWC A;  2CHX A;  2CS4 A;  3GB1 A;  4ANX A;  3OLM D;  4FN2 A;  3BVG A;  2I38 A;  2E3T A;  3MHZ A;  2O4V A;  2XE2 A;  2V3S A;  2KLG A;  1DYQ A;  3UU2 A;  1QOF A;  4GU2 A;  1MFW A;  2KQS A;  1WXQ A;  5IAA C;  4WWM A;  5HI1 A;  4WJN A;  2N7E A;  1OPF A;  2C7H A;  5D6J B;  4UB6 O;  4CQN A;  3DWN A;  3WAP A;  2C5L C;  4NJ6 A;  2Z0E B;  2XTQ A;  3PGU A;  1FIQ A;  1V2Y A;  2W55 A;  4C7Y A;  3U52 E;  2NR2 A;  3O0E A;  2D3B A;  3SR6 A;  2KQ4 X;  2QJL A;  3A33 B;  4ZHP A;  2JYE A;  4BBN F;  3BYY B;  3RN9 C;  4W9I A;  4YTP B;  3GE3 C;  3H7P A;  3A4S C;  4KKI A;  4XWW A;  2R2Q A;  2KAJ A;  5LLI A;  4KR8 A;  2KX0 A;  5GTH O;  4WJO A;  1V6E A;  1T16 A;  3WAN A;  4E1S A;  1P3Q U;  1KFY B;  1WM3 A;  4KZ0 A;  5KHO A;  4C4V B;  1C4P A;  4HJG E;  3NVV A;  1P1A A;  2ZEQ A;  4QQ1 A;  1JWS D;  1VD2 A;  4XE0 A;  4LK0 M;  4EEW A;  5T8I A;  2HD5 B;  3Q69 A;  2KFK B;  2BYF A;  4RJX A;  1UBQ A;  2WXF A;  2BQQ A;  4ICV A;  1J7B A;  1V1P A;  3N1Y C;  1PGA A;  2F1V A;  4KSK C;  2H88 B;  1JWU D;  3QRC A;  3IFW B;  3M62 B;  5AZG A;  2RGF A;  4M0W A;  3HM6 X;  2ICI A;  4WWP A;  3RFZ B;  2AXT O;  4BAX A;  1QIL A;  2GBM A;  4O3Y A;  4PS8 A;  4FRT A;  5TSS A;  4GMV A;  3V60 A;  3UPG A;  4FZN A;  3RUL A;  4I6L B;  1WGR A;  1EU3 A;  5IOI A;  1SJE D;  2MA9 B;  2DEN B;  2MBH A;  3CSF A;  4EZL A;  4DWF A;  4HLE A;  3PHW B;  4ZOH C;  3URY A;  3VH4 B;  2K8H A;  4B6W A;  3QAR A;  2KDE B;  1NYQ A;  1HXX A;  3H9D A;  3N30 A;  1G90 A;  1YX5 B;  1SF0 A;  1MJD A;  3BIN A;  2J0M A;  3AED B;  4HPL B;  4PJ0 O;  3KUC B;  3Q8C A;  1VCB A;  3ENE A;  2Z59 B;  1MVK A;  2ZPN A;  1HXY D;  4HKQ A;  1FM0 D;  1FCL A;  1YJ1 A;  2Y5C A;  2B76 B;  2QSD A;  4MDK E;  1XCT L;  3MC0 B;  3AEG B;  4LLG M;  5D3D A;  2N7D A;  4PYZ A;  3BYT B;  4HKZ E;  1B1Z A;  5D94 A;  2ASQ A;  1JWA D;  3Q14 C;  1TZ1 A;  3QA8 A;  3CIR B;  1YIW A;  1IYF A;  5DL8 A;  5GV0 A;  4FHJ A;  1FXA A;  3TEX A;  1E8W A;  1VZ6 A;  2WWZ A;  3W5U B;  2LJ5 A;  2XBB C;  2GRI A;  2I2Y A;  4XC2 A;  2YEP B;  4W9D A;  2DLB A;  3N20 C;  3W1Y A;  4UB8 O;  1T0S C;  2K3U A;  2R89 A;  2OJR A;  4KGS A;  1TKY A;  3VFK A;  2KWD A;  2IGD A;  2JZ3 B; 
#chains in the Genus database with same CATH homology
 4N74 A;  3MC8 A;  4C00 A;  2QCZ A;  3NJT A;  2X8X X;  2VH1 A;  3EFC A;  4XGA B;  3OG5 A;  2V9H A;  4BZA A;  3MC9 A;  4K3C A;  4C4V B;  2MHJ A;  3Q6B A;  4QAY A;  2VH2 A;  4K3B A;  4C4V A;  4PK1 A;  4N75 A;  2QDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...