4C4VB

Structure of the outer membrane protein insertase bama with one potra domain.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
465
structure length
446
Chain Sequence
b'GNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR BAMA
publication title Structure of Bama, an Essential Factor in Outer Membrane Protein Biogenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 90
structure length 446
sequence length 465
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01103 Bac_surface_Ag Surface antigen
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4c4vB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4c4vB01
3OG5A 3EFCA 4C4VB 4C4VA 4BZAA 4K3CA 4N75A 4N74A 4QAYA 4K3BA 4XGAB 4PK1A 3MC9A 4C00A 3MC8A 3Q6BA 2X8XX 2VH2A 2VH1A 2V9HA 2QCZA 2MHJA 2QDFA 3NJTA
chains in the Genus database with same CATH superfamily
1XQQA 4N74A 4PS8A 3WA0A 2M17A 3SFEB 4GCSA 1EWCA 4RM8A 2KC0A 2IGHA 3OWEB 1FRRA 4B0MA 3A33B 2JU6X 1CZPA 3L10B 1WWTA 1WR6E 4BOSC 4AYDC 4WJOA 4RLBA 2IO1B 2DBYA 2DZJA 3PT2B 4AKRB 1QJ8A 4F4BA 3U4EG 4BVUC 2MBEA 4BZAA 2GMIC 1FNUA 1N5XA 3QQ8B 2MBBB 4LSIA 3V05A 3BZDB 3QRCA 3R7RA 1CQVA 5T8IA 1Q0WB 4NY0A 3ZXVA 4M01A 2KWDA 2XTRA 4WJPA 4JPSA 3GE8C 1QOBA 2Y0KA 3UF8A 3AECB 1ZDVA 2VZKD 2G4SA 2KWCA 3ZDTA 1GNUA 3QA8A 3AXCA 4ZYSA 3DA3A 1XD3B 1T3QA 3VTVA 2WXLA 4CHKA 1R4NI 4ANWA 1MM5A 2DZKA 4GLSC 5JDPA 1I4RA 1WF9A 2KWUB 3W1SA 4M8NA 2KK8A 1QOAA 5GTHO 4PS3A 3NS8A 3Q8FA 2HJ8A 2C7HA 3T24A 1FXAA 4HXDA 4B61A 3NZ3A 5G2NA 1HXXA 2WXNA 2KZRA 3AE4B 3DWOX 1UBQA 4K1RB 2BB5A 3DOWA 3PZ8A 3KQ4A 1HXYD 4OVVA 4KZ0A 3M3JA 5IYUA 2X27X 3PREA 1WJ6A 1S3SG 2M1MA 1E5WA 3B1LX 2DYMA 3LB8C 2W80C 1T16A 3DBHI 5DL8A 4R3DA 1R4MB 2X9KA 4NQLB 3ABVB 2AYOB 3PF1A 4DQOC 3AE9B 3VAWA 1STEA 3TJPA 4A90A 3TEWA 4C7ZA 2M06A 3SY9A 1UBIA 1BT0A 2A4ZA 2NBWB 2JRHA 5C23A 4FULA 2C7NB 1OEYJ 1SE2A 3DPDA 4HROA 5HI1A 2Y5PA 2BT6A 2ZW1A 2K8CA 3EA6A 5D3IB 1SB3C 4B95A 2FCMA 2MHJA 3ZRFA 1TY0A 4HVBA 4A6QA 1Q9FA 1L0XB 1OGWA 1ZOYB 4PR7A 2K6DB 3P4QB 1EU3A 4EOYA 4KX6B 2KWVB 1BXWA 4BKTA 5FK9C 2R2OA 4FESA 2QEJC 4ZRKA 1XCTL 3B9JA 4RM9A 3WANA 2NMQA 3DZMA 3RI7C 2D3AA 3O13A 3E56A 4LLGM 4HPLB 3LK41 2MNHA 2C9WB 1SF0A 4EE2A 2N7JA 3AMZA 5CHWA 3P4PB 3KW5B 3RNGC 4AYEC 1J7CA 5AUIA 1HQRD 1XCQL 2KN5A 3ZRCA 3R7QA 4KKJA 3W5UB 3URYA 1E7UA 3NHEB 4XDCA 1EF5A 3JSVA 4F1SA 3RYTA 3I63C 2QIEB 1JWBD 4OZAA 4RJXA 5TISO 1VLBA 4XYCA 4N58A 3QC8B 2WHIA 2BS2B 3AA1B 3K9OB 3PORA 4C00A 3P2BA 2MP2A 2NPTB 1N63A 2KOXA 3C0RB 4IDIA 4P16A 1Q9GA 1TZ1A 3MJ5A 2L7RA 1IYFA 2GI9A 2JZ3B 1E10A 4RJWA 2ICIA 2KLGA 1DOIA 3LK3B 1XLOA 2AQ2B 2W81C 1ZHTA 5KAFO 3SHQA 5H2FO 3TZGA 1WXSA 2K6QA 2AXTO 3WCQA 1L5PA 1QT9A 2W55A 1AN8A 4BBNC 1FD6A 3EFUA 4GDLA 2KNBA 4FZNA 2ON8A 2WX0A 3CSFA 3PGEA 4PYUA 3HM6X 5H8YE 2KDIA 2I1JA 1WGGA 4ZOHC 1WJNA 1TT5B 5PRNA 4KIKA 4M02A 4K7UA 4LNOA 3AA7A 4AYID 2PIAA 3VHTC 1HEZE 1KTKA 2ZEQA 2N1VA 2KQ7A 4HJGE 3NY5A 4IKGA 4IWQA 3N3KB 2WLBA 1IBXA 2LUMA 1P98A 3I9V1 1YN3A 3ZGZA 2N7DA 3GP6A 1T1LA 4KSLC 1WXQA 4WJQA 4HRSA 2LVQA 3PGSA 2IY1B 2RDGA 2M4NA 1FPYA 4UDUC 5FR3A 4O3YA 2WXPA 1YMHE 2O6VB 3VZWX 3PVLA 3CF6E 2INDC 3DCGA 2KC2A 2KDFB 1J0GA 4G75A 1AWDA 3M63B 2INNE 3AA6A 4MGZE 4TV3A 2PLPA 4WIPA 3HHMA 1NEKB 2BW2A 2D2QA 2YVCA 3Q3MC 4F7ZA 1B9RA 1UWXA 4Z3TA 2GOWA 4ZDVA 4NNJB 1Y56A 1ZE3D 3AN1A 2N4FA 3A9KB 4I6LB 4LJOB 1T5XD 2W3RA 4FJYA 3VDZA 2DAFA 1TTNA 4XX5A 3AAEA 1IPGA 3SDLC 2XN9C 2WS3B 4GXBA 2RDBC 2MLBA 2FE8A 2DWQA 3JTYA 3U7DA 3L08A 2N1WA 3QWZB 4XGAB 4WH4A 3JYUA 5G38A 1TS3A 2LJ5A 4TMAB 3AA0A 2R4LA 3N1XC 2BTEA 3VXWA 1DGJA 2EELA 2MQJA 3K19A 1L6VA 2MBQA 2D07B 1V5TA 2JVCA 3IBEA 3R66C 1EO6A 3A9JB 5C3JB 3WI4A 2KQ4X 5IKCM 3RNBC 3EHVA 1EF1A 3BYYB 1F2RC 3SZDA 2MJ3A 3VFKA 5HKHA 5DPTA 4LNFA 5LLIA 2MHLA 4RGMA 2DENB 3WALA 3Q3NC 3VUWA 3DBLI 3C8YA 3DHGC 4KGTA 1FIQA 1V97A 1TS5A 2FBWB 4KV2A 3NOBA 2FUG1 2UYZB 3HOLA 2KJHB 3AAAB 2NS5A 2KDYA 4NAWB 2BF8B 4OZBA 4YWGG 2VRRB 5LXIB 3IHPC 2JYTA 1WGDA 1E54A 4A9AA 1IGDA 4MDKE 4RGOS 1FFUA 2L0TA 2M56B 2OJRA 1GAQB 1WE7A 1GC7A 1PHOA 1L0YB 2ONQA 3Q8AA 1T0YA 2D11A 1KFYB 1VZ8A 5I4DA 1D3ZA 2KDBA 3WU2O 5LNK1 2HD5B 4W9JA 2BB6A 1E90A 4DWFA 1MFWA 5EE0A 1TKGA 3Q8CA 1KM7A 1GC6A 2BPSA 2SEBD 1OPFA 1WRIA 1ET9A 4AFKA 2WXOA 3SYBA 2QTKA 2CJNA 2JQRB 2QC8A 1F0ZA 3VRBB 4B0EA 4MH0E 3Q2AC 1L0VB 4EUTA 1OQQA 4GIVA 2KMMA 1WM2A 4D2KA 2FIFA 1OQRA 1YN4A 2L00B 4XWWA 4FJVB 1TGZB 4HJKA 1B1ZA 4UB6O 4N75A 2M0XA 2ACZB 2O2VB 3R8BA 2JYEA 1F1HA 3L54A 3Q14C 2R2QA 3C19A 3Q6BA 3DBSA 4WWPA 2JZZA 1WMHA 2XBBC 5HFYA 4LTUA 2O6VD 1WM3A 2R88A 4HWIB 3SD5A 4ASWC 3FILA 2LGXA 3ZJTA 2YPVA 5D3DA 4US9A 4AWJA 4D65A 1LGRA 2LGYA 4G76A 2WXIA 3PQUA 3MC8A 5FVNA 4GN1A 2LHEA 3VR8B 3VH3B 3MHZA 4O4UA 3TL5A 3SU8X 2G45B 4GOCA 1WGYA 1MHHE 4HPMB 2GLSA 3PLVA 3RN9C 3N1YC 1ZPSA 1V5OA 1UD7A 2JZPA 5JZEB 2LZ6A 1TZOA 1I4GA 2DHZA 2OJWA 4HLEA 4JFBA 2PRNA 1MM4A 1T6BX 4LDTB 3R2IA 4FRTA 3IT4B 4FHKA 4W9EA 4OVZA 4GU2A 2VH1A 3ALBA 2LEKA 2Y5CA 2EMSA 2WU2B 1C79A 4AZLA 5G5GA 4U9CA 3V3XA 3J9CA 2KVRA 5BMGA 2GBRA 2FNJB 4K3BA 4O1NA 2KXJA 1PFDA 1N6ZA 2FIDA 3UIOB 4TUUA 2ASQA 3OJ4B 1XLQA 4HCPB 3H9DA 3PGRA 2Q5WD 3BIID 3NS1A 2MRPA 4MJSB 3PTFC 4FN2A 4IM2A 1LQBA 1L4ZB 1TS2A 4RH6A 5FKAC 5FR6A 2GB1A 2IBIB 2LVOA 2GBJA 5DL5A 3L0WB 5TR5A 1VR9A 2C7MB 3HVDA 4MGKE 2KVZA 1CJEA 3VTUA 1NVID 2B3AA 4I6NB 4J6IA 3ZKJC 3ZQ4A 4BKSA 1UZXB 3APDA 1N5WA 1TY2A 4GB9A 2PE9A 1M94A 1A5RA 5J18A 4AKRA 2J4UP 3RMKC 4TSSA 5EE3A 3VR9B 1KF6B 4C4VB 2CKHB 4ICUA 3T3OA 4FOZA 3RZFA 1V86A 2IWWA 1N62A 2KXPB 2DZIA 2K25A 4MSMB 4JQWC 5JHAA 4L2YA 2IO2B 2DNFA 3DVNU 3TSSA 3OLMD 3QARA 3PO0A 5HG2A 4AUQC 1WSPA 3T8MA 4DXFA 2PORA 1C4PA 1P1AA 1SE3A 4QQ1A 1JROA 4K3CA 4O3XB 3GZNI 2BKFA 1JALA 4B6WA 2CHWA 1WRDB 4QAYA 5AZGA 4JGHB 2IGGA 5JHBA 1C1YB 3MC9A 1C4AA 3ETRA 2W54A 4W9LA 4KR4A 2XE5A 4RCOA 2FCNA 5JH5C 3AEGB 1YOVB 3ENEA 2J52A 5KHOA 3AI5A 3I5JC 1KLGD 3APFA 3ZNID 1JRUA 3A4RA 3NRZA 3TEYA 4ZRJA 4FSOA 5GTIO 4XNLA 4Q2JA 1MPEA 3MFGA 4K7SA 1ZGUB 2N9EB 4GCPA 5D6JB 1TBEA 4I6PA 3L4PA 1NYQA 2LGIA 3QJZA 2PPHA 2LFUA 2D10A 2KYWA 2Z8LA 1V6EA 2OHFA 1KLVA 5J2RA 1JCKB 3I57A 4W9KA 1FXIA 3O0EA 2FUHB 4DHZE 1WGHA 2N2LA 1GFMA 1MG8A 1ROEA 5AZHA 4NJ6A 2Y0LA 2KO3A 5BMHA 3KZIO 2G1EA 3RCZA 1WYGA 2BS4B 2WXGA 1RM6C 1P0RA 4YTMB 3NSGA 3PSEB 1VRAB 1V9JA 2I38A 2ZVNA 2INCC 2KZ7A 1YQBA 2Z0DB 3TEXA 2L52A 3LK2B 2XTQA 1GFPA 2EKIA 3QAQA 3VUXA 4PK1A 3A1QB 4WJNA 1ENFA 4EEWA 4MM3B 2JT4B 2LRWA 4ZRIA 5LXHA 2WYQA 1E8XA 1TKYA 3SR6A 1V1PB 3KLSX 1CK1A 3GS2A 2FGQX 3HIZA 4ZHOA 3TMPB 2KTRB 1FNVA 1KJTA 2ZCCA 1UGMA 2A5UA 3TUOA 3HRDD 2BYFA 2V3NA 1L7YA 3DBRI 5KHQA 3AU5A 2L83A 2KDMA 2J0KA 3A0HO 4ICVA 1SE4A 1YJIA 2D3BA 1YS5A 1V1OA 2WXHA 2MJEA 1PRNA 2H89B 1I7HA 2D5GA 3RT3B 3RPFC 2XK5B 4WAAA 1T0SC 4RFBA 5EDSA 3AA1A 1E6EB 2BWFA 4PUXA 4GMVA 1C78A 2NPTA 3VRAB 1Z2MA 3NZUA 1NENB 1BMLC 1Q10A 1SGHA 2QJLA 4WWMA 3RUIB 4HCNB 4BKSD 4HDQA 2Y0HA 5B66O 3IG3A 4FQEA 5E6PA 4WWNA 4IL6O 3BRZA 1CMXB 1J7BA 4CYEA 1R4NB 1YQ4B 2H88B 2L76A 4CQNA 3LK3A 3AE3B 2HTHA 2K8BA 3LK42 2V4IB 2KX3A 2WWZA 2ZPYA 4AYMC 3APCA 2WXFA 2MX2A 1L4DB 3HW9A 4LSEA 2JQYA 2MJDA 3AA7B 4YTNB 2M07A 1I4HA 3JW0X 5B5EO 3UGBB 2KMCA 1XXGA 2PW9A 1G90A 3AEBB 2BGFA 2ZZPB 3MHSD 3WAOA 1UNSA 4II2B 3RNCC 1AARA 3VZUX 4FADA 1JMLA 4YXDB 1HZ5A 3NZSA 3DBHB 2J4XA 3CSTA 1E8ZA 1KRHA 2X38A 2N2MA 2UU7A 3P4RB 2ZJDA 4D64A 5DL7A 2GRIA 1RFKA 2UWQA 1GB1A 1TYGB 3DVGY 2WQYB 3KVFB 4AYNA 4PT5A 1I35A 2KN4A 4B9KA 3WI5A 1FNWA 4AKMA 3PGUA 3W1YA 4NQKE 1FO4A 2KT7A 4MGIE 4RF0A 3VY9X 3JVZX 4MGYE 3NVZA 2D3GA 2PTLA 4FSPA 4HEA1 1K50A 1QQRA 2O6VA 2FAZA 2BS3B 4FBJB 1YX5B 3TIXA 2JMMA 3PLUA 3U8ZA 2FGRA 3DDCB 4JX1C 4L23A 4ARCA 1YJJA 4L1BA 2K1FA 3DWGC 2XE1A 4XC2A 1QLBB 4HDOA 3L13A 1WGRA 5E79O 2V9HA 1PGXA 2LHDA 4AUIA 4HK2A 1S1QB 4DK5A 1FXTB 3NG0A 3P1MA 2LI5A 2R4PA 3KH0A 2TSSA 5GXGB 2JX5A 4MACA 3N30A 4RLCA 1J8CA 4URKA 3PRZA 3PS6A 2IJ0A 2KTFA 2ZNVC 3A9KA 1AW7A 2CR5A 2IWVA 1WY8A 4KZCA 2MBOA 4BKGA 4YSXB 3B2FA 2QHOA 3WIMA 5AFUK 2JUOA 2W9NA 1L2NA 1ORMA 3HOEA 1D5MC 2L05A 3BINA 3CWIA 1HTOA 2NTSA 4MEMA 2DX5B 1IUEA 5ADXK 1GFQA 4RL9A 3KWVA 1YX6B 1KOTA 5EE9A 3B08A 1PYWD 1J7AA 5D94A 4NZLB 3AE6B 1V2YA 3ZLZA 4IW0A 4AOFA 2L0FA 4MH8A 4REZA 5D5DA 4XWTA 1SIFA 1M4VA 3DA4A 4RGNA 4IUMB 1H6S1 1E7PB 4JLCA 4EZKA 4P7IA 3FC4A 3PHXB 2IZVB 1WJUA 3W5VB 2K3UA 4C7YA 1R7SA 1SEBD 4WAFA 2J0MA 3A9JA 2M8SA 2KD0A 3V61A 4O3WA 2Z0EB 4K81A 2IGDA 2G4DB 6PRNA 3IAS1 1ZUD2 1QF6A 1WR1A 3CMMB 2WXQA 4ZHPA 3ECIA 4BUMX 2KFKB 2LGDA 1ZXHA 3AEAB 2LJIA 1K53A 4M0WB 1TIFA 4NAMA 3FAHA 3X0WA 3GP7A 2BBCA 1UF0A 1WH3A 2WU5B 1MVKA 4KRAA 5L95C 4UB8O 2BQQA 3AAAA 4NAWA 4AP4C 1QJ9A 4CO7A 1V80A 5G26A 2L8JA 3TBLD 2REXA 2RSUA 2QSDA 3I3TB 3H7SA 1MPFA 3GE3C 1S5LO 3AV8A 2G3QB 2YLMA 3U2SC 1WYWB 3DHHC 2O4VA 2I1KA 4FZLA 1NYRA 2LD9A 2LRUA 4ANVA 3T3NA 4TQ0A 4PYZA 4NPNA 4E3CA 2KHWB 4YTPB 2GBKA 2NBUA 3H6NA 3LYYA 4GSWA 2K8HA 1IZNB 1UELA 1I4PA 4OHJA 1C77A 3H1UA 3ZYYX 1UH6A 3H7PB 1SE9A 3G7GA 4E74A 5GV0A 3M95A 3UQBA 3FYXA 1QOFA 5IA7A 8PRNA 4HKQA 1IP9A 2J7QB 1GFOA 4AS1A 4RNAA 1WXVA 4ANXA 5AUKA 1JRPA 1ZKHA 3HM3A 5DPRA 1E9MA 2Z59B 3FKYA 3N20C 3N9YC 2YEPB 4WURA 4M00A 4GDKB 1X1MA 5BO4B 1D5XC 3S2AA 2O2VA 3AE5B 5L83A 2N0SB 2K0LA 2G9HD 3R2TA 5IOIA 1R4MI 2IPKD 4LCDE 1FM0D 1RAXA 4EKUA 2AL6A 2JXTA 3POXA 5C2TB 1E0ZA 1NI3A 5KAIO 2AWTA 2K22A 3PZDA 5EE1A 3PPAA 2K5PA 1SXTA 1XEEA 3SZVA 2C5LC 2IYDB 5G39A 2L32A 2PKOA 1OTRB 2YNKA 3QK0A 1D5ZC 2PE6B 3Q3OC 2NCNA 3ZNHB 2MBHA 2DYBA 1HXTA 4JWSC 4DHJB 3KUZA 2CU3A 1PUTA 3AEDB 1XT9B 2OMFA 3VE1A 4JE3B 1BT9A 1VDVA 1T0QC 4GGQA 4ZRQA 4IC7B 2CHXA 1JW9D 3RNEC 3IFWB 1WXAA 3SFDB 4FZMA 1EUVB 4GCQA 2C60A 1Y8RC 2WGSA 2F1CX 4IOIE 2B76B 4RMAA 2RR9A 4G50A 3BVMA 1WX7A 2L1AA 3P4SB 4YL8A 2IDYA 3L16A 3DBLB 1ZHWA 1ZW7A 2KAJA 3ZNGC 4XE0A 1WX8A 5IO9A 3EFCA 1ZHYA 2R4NA 2LGSA 4DBGA 2CS4A 3UQAA 4FMSA 4BAXA 3V8UA 3V60A 5TSSA 5J17A 1ZP0B 2IO0B 2JPHA 3BVZA 1ZHZA 5D7GA 5AZFA 4LJPB 3PHWB 1C9FA 5DPWA 3WAPA 3ZJVA 1L6UA 3BYTB 4RGTA 2ZFGA 1HTQA 2W3SA 4MJSA 3TEZA 4H2AA 4KDIC 3JCUO 3DQVA 2J1NA 1SIJA 4N6EB 5EE2A 2J0JA 3EC8A 3HUIA 2PJHA 2PEAA 4YT0B 2ZCBA 2JF5A 3EECA 1ZDXA 2FCSA 1YIWA 1C76A 1IGCA 3MJWA 3W1SC 4ANUA 2MA9B 3DVNV 2WJQA 5C1ZA 5HHDG 3KYCD 3NVYA 3W9CB 1VZ6A 3OJ3A 1C3TA 1I4XA 4C4VA 2CJOA 4LNNA 3LXFA 4E1TA 2KXPA 2NR2A 4JCHA 2RGFA 1HZ6A 1Z5SB 3VY8X 3UI3A 4KDLB 3T20A 3RNAC 5BYRA 3U7ZA 2HTME 1K52A 3B0AA 2QCZA 1OFFA 3BVGA 2MH7A 2PMVA 2PVGC 3UU2A 1Q1OA 3Q8EA 1EWYC 3POUA 2L3ZA 1WJ4A 3AE7B 4G11A 4II3B 4P1CC 2LXCA 4D5UA 2ODJA 4N59A 3U52E 1ZHXA 3RZWC 3NUHB 2N9KA 1UWMA 1YN5A 4YSYB 2KACA 1FCLA 2LASA 1V81A 4W9DA 3SY7A 2R8AA 3QRAA 1JWAD 1PQSA 3QCAA 2HE7A 2GE4A 3H8HA 1YJ1A 3ZXRA 1EM7A 2HJ1A 3BY4B 3IAM1 1JWUD 1K8RB 2MW5A 4JWUC 2GBMA 2N9LA 2OOBB 2ZW0A 2KZ7B 3W2DA 4EZLA 3VQIA 5BYQA 4LK0M 2KJ6A 3RD2A 3X23A 2IO3B 1WIAA 3AEFB 3GOEA 1RRBA 2WDTB 3QIJA 1LM8B 3UIPB 1ISNA 3ZDMC 2JWUA 3JSVB 2M0AA 1F77A 4EZJA 3OAWA 1HXUA 1FEHA 1PDXA 4W9IA 1I42A 4S17A 4LNIA 5E6OA 2I2YA 3LK2A 5D2MB 4M8MA 3SYSA 4W9HA 4N9F4 4LSFA 4XZ4A 3EUB2 4LDTD 2WJRA 4DHJD 2MP2B 3A1QA 4O4XA 2MCNB 1RWSA 3ML8A 4MM3A 1N61A 4AQ7A 2XEWA 1ET6A 1GG3A 1PGAA 2BYEA 4FXCA 1MJDA 2BYTA 4ZRPA 2E6XA 3ML9A 5DCNA 4DXGA 1V1PA 4FLHA 3VE2A 2Y3AA 2PVOD 2DZMA 2K0PA 1BUIC 2CHZA 2KTRA 1A70A 2RPVA 2J53A 3Q8BA 3UAQA 4HPPA 3AEEB 3RFZB 4OW0A 3A2SX 4LSHA 4GDLB 4CTDA 5T5FA 2N9PC 3A4SC 4KGSA 2HDEA 3NVVA 2DLBA 2V0GA 3OG5A 2K9XA 4S0RA 3Q3FA 3KWLA 2XK5A 4P6VF 1F2RI 4KIKB 5BYSA 1ZXIA 2WNMA 1HE8A 2WP9B 4W9CA 5DPSA 5CHVC 2R89A 4YSZB 3DWNA 1JQ4A 1PGBA 2LUEA 1P9DU 3LDZE 3ZW3A 2WXJA 2SAKA 1WZ3A 1DOXA 1V8CA 2IY0B 3GZNB 4JIOU 2RD0A 4C69X 3DWMA 3E9SA 5DL6A 2EMTA 1WGKA 3PRMB 1FCCC 1OEYA 1IBXB 4TKNA 3R3MA 5E6NA 4F8CB 4GHBA 5GMVA 5IAAC 4BBNF 3AH7A 4AJYB 1VZ7A 4A3OA 1I4QA 3LJ3A 3HWBA 1KLUD 3HVZA 1GPXA 4ARIA 3BS0A 3KVDD 3AB5A 1WX9A 3AE8B 2M19A 4OVUA 1UUPA 4JL9A 5G5HA 1VD2A 4A8XC 2RMMA 3NVWA 1J19A 1WE6A 1GUAB 2JXXA 2KJRA 3Q69A 1LFDA 2Y7SA 3EGRA 2K4TA 3VUYA 4NJCA 3AA6B 5MPOA 2BYVE 2AEHA 1WFYA 2K39A 2WX1A 4PS7A 2WDQB 2NBVB 3KUDB 3C5OA 1XF5L 1ACCA 3AULA 2KQSA 1P7EA 1EU4A 4K7WA 2QDFA 1KH0A 2LVPA 2JY6A 3SEBA 3N1ZC 2XE3A 2KDEB 1WI0A 3DHIC 3ZTDA 2INPE 1E7VA 4KKIA 3CIRB 1OSMA 1NBFC 3ZVVA 1VJKA 4BFRA 3AAEB 1RFAA 2V3SA 2KFJA 4DDGD 3UPGA 4KGRA 3BK1A 2WDRB 2F1VA 3P63A 1JWSD 4BOZB 2W82A 1MI0A 2V4LA 1P4TA 3TCAA 4FHJA 2JWZA 2ZVOA 4DXAB 3AU4A 2KX0A 1F9JA 2ZNVB 3AE2B 1HA5A 3MP9A 1SJED 3KYDD 2DYOA 1T0RC 2J42A 3AA0B 4O3ZA 1C4CA 5H92C 4IM0A 2XMXA 4A20A 2LHFA 4FJZA 1THQA 1SSNA 2D3CA 2GBNA 1SBBB 4KVGB 1GJZA 3HK0A 1QZEA 4J3OD 2KC1A 4ACFA 3ZO5B 2JRIB 3DBRB 4FUVA 2NTTA 3ZJUA 1F52A 2KANA 1NDDA 3POQA 2Y2XA 4USAA 4LNKA 1GFNA 3QX1A 3IXSA 2KLCA 1JWMD 5AFUL 4HKZE 4US8A 3RBHA 5IP4D 1VCBA 3BRYA 2ZPNA 4C80A 3VVWB 5ADXL 1RLFA 4DHZB 2AQ1B 2EKEC 4W9GA 2LXAA 1D6EC 1TS4A 3ZIMA 4IM3A 3VZTX 2Y5BB 3BWUD 2KMAA 4FRXA 1YD8U 4C56C 4O49A 3RULA 2WDVB 3PRNA 4A3PA 4IWPA 1MG4A 4GF4A 2WVPA 2ZLDA 5CX3A 3NJTA 3PZ7A 2LMCA 2VZKB 4DDID 5CTRC 2ERVA 1XLPA 4MSQB 2WXKA 1RYJA 1YNTE 3MTNB 2XG6A 2AL3A 1WXMA 3UINB 1QKZA 2V3PA 1UGJA 1U4AA 2KFKA 3PQSA 1E8WA 2AQ3B 1QOGA 4E71A 2QMTA 2R61A 3DVGX 1ESFA 4AJWA 3M62B 4M0WA 1FRDA 1XO3A 3N32A 1G6JA 3ZNZB 1N60A 3BK2A 2N7EA 2BKRB 4FA6A 2N9XA 2X8XX 3T0SA 2QILA 4EFOA 3T9LA 3ZUNA 3GB1A 3RNFC 2MSED 1DYQA 5AEKB 5G3AA 1K51A 3V6CB 1BH3A 4MT5A 2OEDA 2WXMA 3D32A 1WZ0A 1BXTA 3B2GA 4WQMA 3MC0B 1QJPA 4FT6A 1WMHB 3WAMA 4G0NB 2MWSB 3IVFA 2RDHA 1V49A 2V1YA 1YQ3B 4NJ7A 3ZTCA 2DAJA 1IZNA 4E1SA 1XLNA 2MEKA 2BVCA 3FILB 3ONSA 1FFVA 2AX5A 3H7PA 2KKCA 4RF1A 2BWES 3IT6B 4ITKA 1GOZA 5IN7A 4X57B 1D4BA 5E6JA 2LFIA 3V62A 2FCQA 3VH4B 3AM9A 4TQ1A 4G3XB 1Q5WB 3VTWA 1P7FA 4PJ0O 3KUCB 4WWOA 2R4OA 1E8YA 3QHTA 3PV1A 3U30A 1AYFA 4KSKC 2F1TA 5BMIA 2JSVX 4GDKA 4P1BC 1GB4A 1LO5D 1TJEA 1OQYA 2E3TA 1DOYA 1P3QU 1H8CA 1H4RA 3A0BO 4OZCA 2LWPA 3AE1B 2CU1A 4IWOA 5CHFA 2VH2A 1QILA 2YEPF 4W9FA 4XNKA 1NI2A 1FMAD 5G55A 2NVUI 4XDDA 4MELA 3V6EB 1TKEA 2RPQA 3Q3JA 4ZYNA 2WXRA 1LXDA 3K9PB 4KR8A 3P42A 3O65B 7PRNA 1MHXA 2XE2A 4IG7B 1SJHD 3PRPB 5JXVA 4WQOB 3L17A 4A55A 2XNAC 3EMNX
chains in the Genus database with same CATH topology
3OG5A 3EFCA 4C4VB 4C4VA 4BZAA 4K3CA 4N75A 4N74A 4QAYA 4K3BA 4XGAB 4PK1A 3MC9A 4C00A 3MC8A 3Q6BA 2X8XX 2VH2A 2VH1A 2V9HA 2QCZA 2MHJA 2QDFA 3NJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG5 A;  3EFC A;  4C4V B;  4C4V A;  4BZA A;  4K3C A;  4N75 A;  4N74 A;  4QAY A;  4K3B A;  4XGA B;  4PK1 A;  3MC9 A;  4C00 A;  3MC8 A;  3Q6B A;  2X8X X;  2VH2 A;  2VH1 A;  2V9H A;  2QCZ A;  2MHJ A;  2QDF A;  3NJT A; 
#chains in the Genus database with same CATH topology
 1XQQ A;  4N74 A;  4PS8 A;  3WA0 A;  2M17 A;  3SFE B;  4GCS A;  1EWC A;  4RM8 A;  2KC0 A;  2IGH A;  3OWE B;  1FRR A;  4B0M A;  3A33 B;  2JU6 X;  1CZP A;  3L10 B;  1WWT A;  1WR6 E;  4BOS C;  4AYD C;  4WJO A;  4RLB A;  2IO1 B;  2DBY A;  2DZJ A;  3PT2 B;  4AKR B;  1QJ8 A;  4F4B A;  3U4E G;  4BVU C;  2MBE A;  4BZA A;  2GMI C;  1FNU A;  1N5X A;  3QQ8 B;  2MBB B;  4LSI A;  3V05 A;  3BZD B;  3QRC A;  3R7R A;  1CQV A;  5T8I A;  1Q0W B;  4NY0 A;  3ZXV A;  4M01 A;  2KWD A;  2XTR A;  4WJP A;  4JPS A;  3GE8 C;  1QOB A;  2Y0K A;  3UF8 A;  3AEC B;  1ZDV A;  2VZK D;  2G4S A;  2KWC A;  3ZDT A;  1GNU A;  3QA8 A;  3AXC A;  4ZYS A;  3DA3 A;  1XD3 B;  1T3Q A;  3VTV A;  2WXL A;  4CHK A;  1R4N I;  4ANW A;  1MM5 A;  2DZK A;  4GLS C;  5JDP A;  1I4R A;  1WF9 A;  2KWU B;  3W1S A;  4M8N A;  2KK8 A;  1QOA A;  5GTH O;  4PS3 A;  3NS8 A;  3Q8F A;  2HJ8 A;  2C7H A;  3T24 A;  1FXA A;  4HXD A;  4B61 A;  3NZ3 A;  5G2N A;  1HXX A;  2WXN A;  2KZR A;  3AE4 B;  3DWO X;  1UBQ A;  4K1R B;  2BB5 A;  3DOW A;  3PZ8 A;  3KQ4 A;  1HXY D;  4OVV A;  4KZ0 A;  3M3J A;  5IYU A;  2X27 X;  3PRE A;  1WJ6 A;  1S3S G;  2M1M A;  1E5W A;  3B1L X;  2DYM A;  3LB8 C;  2W80 C;  1T16 A;  3DBH I;  5DL8 A;  4R3D A;  1R4M B;  2X9K A;  4NQL B;  3ABV B;  2AYO B;  3PF1 A;  4DQO C;  3AE9 B;  3VAW A;  1STE A;  3TJP A;  4A90 A;  3TEW A;  4C7Z A;  2M06 A;  3SY9 A;  1UBI A;  1BT0 A;  2A4Z A;  2NBW B;  2JRH A;  5C23 A;  4FUL A;  2C7N B;  1OEY J;  1SE2 A;  3DPD A;  4HRO A;  5HI1 A;  2Y5P A;  2BT6 A;  2ZW1 A;  2K8C A;  3EA6 A;  5D3I B;  1SB3 C;  4B95 A;  2FCM A;  2MHJ A;  3ZRF A;  1TY0 A;  4HVB A;  4A6Q A;  1Q9F A;  1L0X B;  1OGW A;  1ZOY B;  4PR7 A;  2K6D B;  3P4Q B;  1EU3 A;  4EOY A;  4KX6 B;  2KWV B;  1BXW A;  4BKT A;  5FK9 C;  2R2O A;  4FES A;  2QEJ C;  4ZRK A;  1XCT L;  3B9J A;  4RM9 A;  3WAN A;  2NMQ A;  3DZM A;  3RI7 C;  2D3A A;  3O13 A;  3E56 A;  4LLG M;  4HPL B;  3LK4 1;  2MNH A;  2C9W B;  1SF0 A;  4EE2 A;  2N7J A;  3AMZ A;  5CHW A;  3P4P B;  3KW5 B;  3RNG C;  4AYE C;  1J7C A;  5AUI A;  1HQR D;  1XCQ L;  2KN5 A;  3ZRC A;  3R7Q A;  4KKJ A;  3W5U B;  3URY A;  1E7U A;  3NHE B;  4XDC A;  1EF5 A;  3JSV A;  4F1S A;  3RYT A;  3I63 C;  2QIE B;  1JWB D;  4OZA A;  4RJX A;  5TIS O;  1VLB A;  4XYC A;  4N58 A;  3QC8 B;  2WHI A;  2BS2 B;  3AA1 B;  3K9O B;  3POR A;  4C00 A;  3P2B A;  2MP2 A;  2NPT B;  1N63 A;  2KOX A;  3C0R B;  4IDI A;  4P16 A;  1Q9G A;  1TZ1 A;  3MJ5 A;  2L7R A;  1IYF A;  2GI9 A;  2JZ3 B;  1E10 A;  4RJW A;  2ICI A;  2KLG A;  1DOI A;  3LK3 B;  1XLO A;  2AQ2 B;  2W81 C;  1ZHT A;  5KAF O;  3SHQ A;  5H2F O;  3TZG A;  1WXS A;  2K6Q A;  2AXT O;  3WCQ A;  1L5P A;  1QT9 A;  2W55 A;  1AN8 A;  4BBN C;  1FD6 A;  3EFU A;  4GDL A;  2KNB A;  4FZN A;  2ON8 A;  2WX0 A;  3CSF A;  3PGE A;  4PYU A;  3HM6 X;  5H8Y E;  2KDI A;  2I1J A;  1WGG A;  4ZOH C;  1WJN A;  1TT5 B;  5PRN A;  4KIK A;  4M02 A;  4K7U A;  4LNO A;  3AA7 A;  4AYI D;  2PIA A;  3VHT C;  1HEZ E;  1KTK A;  2ZEQ A;  2N1V A;  2KQ7 A;  4HJG E;  3NY5 A;  4IKG A;  4IWQ A;  3N3K B;  2WLB A;  1IBX A;  2LUM A;  1P98 A;  3I9V 1;  1YN3 A;  3ZGZ A;  2N7D A;  3GP6 A;  1T1L A;  4KSL C;  1WXQ A;  4WJQ A;  4HRS A;  2LVQ A;  3PGS A;  2IY1 B;  2RDG A;  2M4N A;  1FPY A;  4UDU C;  5FR3 A;  4O3Y A;  2WXP A;  1YMH E;  2O6V B;  3VZW X;  3PVL A;  3CF6 E;  2IND C;  3DCG A;  2KC2 A;  2KDF B;  1J0G A;  4G75 A;  1AWD A;  3M63 B;  2INN E;  3AA6 A;  4MGZ E;  4TV3 A;  2PLP A;  4WIP A;  3HHM A;  1NEK B;  2BW2 A;  2D2Q A;  2YVC A;  3Q3M C;  4F7Z A;  1B9R A;  1UWX A;  4Z3T A;  2GOW A;  4ZDV A;  4NNJ B;  1Y56 A;  1ZE3 D;  3AN1 A;  2N4F A;  3A9K B;  4I6L B;  4LJO B;  1T5X D;  2W3R A;  4FJY A;  3VDZ A;  2DAF A;  1TTN A;  4XX5 A;  3AAE A;  1IPG A;  3SDL C;  2XN9 C;  2WS3 B;  4GXB A;  2RDB C;  2MLB A;  2FE8 A;  2DWQ A;  3JTY A;  3U7D A;  3L08 A;  2N1W A;  3QWZ B;  4XGA B;  4WH4 A;  3JYU A;  5G38 A;  1TS3 A;  2LJ5 A;  4TMA B;  3AA0 A;  2R4L A;  3N1X C;  2BTE A;  3VXW A;  1DGJ A;  2EEL A;  2MQJ A;  3K19 A;  1L6V A;  2MBQ A;  2D07 B;  1V5T A;  2JVC A;  3IBE A;  3R66 C;  1EO6 A;  3A9J B;  5C3J B;  3WI4 A;  2KQ4 X;  5IKC M;  3RNB C;  3EHV A;  1EF1 A;  3BYY B;  1F2R C;  3SZD A;  2MJ3 A;  3VFK A;  5HKH A;  5DPT A;  4LNF A;  5LLI A;  2MHL A;  4RGM A;  2DEN B;  3WAL A;  3Q3N C;  3VUW A;  3DBL I;  3C8Y A;  3DHG C;  4KGT A;  1FIQ A;  1V97 A;  1TS5 A;  2FBW B;  4KV2 A;  3NOB A;  2FUG 1;  2UYZ B;  3HOL A;  2KJH B;  3AAA B;  2NS5 A;  2KDY A;  4NAW B;  2BF8 B;  4OZB A;  4YWG G;  2VRR B;  5LXI B;  3IHP C;  2JYT A;  1WGD A;  1E54 A;  4A9A A;  1IGD A;  4MDK E;  4RGO S;  1FFU A;  2L0T A;  2M56 B;  2OJR A;  1GAQ B;  1WE7 A;  1GC7 A;  1PHO A;  1L0Y B;  2ONQ A;  3Q8A A;  1T0Y A;  2D11 A;  1KFY B;  1VZ8 A;  5I4D A;  1D3Z A;  2KDB A;  3WU2 O;  5LNK 1;  2HD5 B;  4W9J A;  2BB6 A;  1E90 A;  4DWF A;  1MFW A;  5EE0 A;  1TKG A;  3Q8C A;  1KM7 A;  1GC6 A;  2BPS A;  2SEB D;  1OPF A;  1WRI A;  1ET9 A;  4AFK A;  2WXO A;  3SYB A;  2QTK A;  2CJN A;  2JQR B;  2QC8 A;  1F0Z A;  3VRB B;  4B0E A;  4MH0 E;  3Q2A C;  1L0V B;  4EUT A;  1OQQ A;  4GIV A;  2KMM A;  1WM2 A;  4D2K A;  2FIF A;  1OQR A;  1YN4 A;  2L00 B;  4XWW A;  4FJV B;  1TGZ B;  4HJK A;  1B1Z A;  4UB6 O;  4N75 A;  2M0X A;  2ACZ B;  2O2V B;  3R8B A;  2JYE A;  1F1H A;  3L54 A;  3Q14 C;  2R2Q A;  3C19 A;  3Q6B A;  3DBS A;  4WWP A;  2JZZ A;  1WMH A;  2XBB C;  5HFY A;  4LTU A;  2O6V D;  1WM3 A;  2R88 A;  4HWI B;  3SD5 A;  4ASW C;  3FIL A;  2LGX A;  3ZJT A;  2YPV A;  5D3D A;  4US9 A;  4AWJ A;  4D65 A;  1LGR A;  2LGY A;  4G76 A;  2WXI A;  3PQU A;  3MC8 A;  5FVN A;  4GN1 A;  2LHE A;  3VR8 B;  3VH3 B;  3MHZ A;  4O4U A;  3TL5 A;  3SU8 X;  2G45 B;  4GOC A;  1WGY A;  1MHH E;  4HPM B;  2GLS A;  3PLV A;  3RN9 C;  3N1Y C;  1ZPS A;  1V5O A;  1UD7 A;  2JZP A;  5JZE B;  2LZ6 A;  1TZO A;  1I4G A;  2DHZ A;  2OJW A;  4HLE A;  4JFB A;  2PRN A;  1MM4 A;  1T6B X;  4LDT B;  3R2I A;  4FRT A;  3IT4 B;  4FHK A;  4W9E A;  4OVZ A;  4GU2 A;  2VH1 A;  3ALB A;  2LEK A;  2Y5C A;  2EMS A;  2WU2 B;  1C79 A;  4AZL A;  5G5G A;  4U9C A;  3V3X A;  3J9C A;  2KVR A;  5BMG A;  2GBR A;  2FNJ B;  4K3B A;  4O1N A;  2KXJ A;  1PFD A;  1N6Z A;  2FID A;  3UIO B;  4TUU A;  2ASQ A;  3OJ4 B;  1XLQ A;  4HCP B;  3H9D A;  3PGR A;  2Q5W D;  3BII D;  3NS1 A;  2MRP A;  4MJS B;  3PTF C;  4FN2 A;  4IM2 A;  1LQB A;  1L4Z B;  1TS2 A;  4RH6 A;  5FKA C;  5FR6 A;  2GB1 A;  2IBI B;  2LVO A;  2GBJ A;  5DL5 A;  3L0W B;  5TR5 A;  1VR9 A;  2C7M B;  3HVD A;  4MGK E;  2KVZ A;  1CJE A;  3VTU A;  1NVI D;  2B3A A;  4I6N B;  4J6I A;  3ZKJ C;  3ZQ4 A;  4BKS A;  1UZX B;  3APD A;  1N5W A;  1TY2 A;  4GB9 A;  2PE9 A;  1M94 A;  1A5R A;  5J18 A;  4AKR A;  2J4U P;  3RMK C;  4TSS A;  5EE3 A;  3VR9 B;  1KF6 B;  4C4V B;  2CKH B;  4ICU A;  3T3O A;  4FOZ A;  3RZF A;  1V86 A;  2IWW A;  1N62 A;  2KXP B;  2DZI A;  2K25 A;  4MSM B;  4JQW C;  5JHA A;  4L2Y A;  2IO2 B;  2DNF A;  3DVN U;  3TSS A;  3OLM D;  3QAR A;  3PO0 A;  5HG2 A;  4AUQ C;  1WSP A;  3T8M A;  4DXF A;  2POR A;  1C4P A;  1P1A A;  1SE3 A;  4QQ1 A;  1JRO A;  4K3C A;  4O3X B;  3GZN I;  2BKF A;  1JAL A;  4B6W A;  2CHW A;  1WRD B;  4QAY A;  5AZG A;  4JGH B;  2IGG A;  5JHB A;  1C1Y B;  3MC9 A;  1C4A A;  3ETR A;  2W54 A;  4W9L A;  4KR4 A;  2XE5 A;  4RCO A;  2FCN A;  5JH5 C;  3AEG B;  1YOV B;  3ENE A;  2J52 A;  5KHO A;  3AI5 A;  3I5J C;  1KLG D;  3APF A;  3ZNI D;  1JRU A;  3A4R A;  3NRZ A;  3TEY A;  4ZRJ A;  4FSO A;  5GTI O;  4XNL A;  4Q2J A;  1MPE A;  3MFG A;  4K7S A;  1ZGU B;  2N9E B;  4GCP A;  5D6J B;  1TBE A;  4I6P A;  3L4P A;  1NYQ A;  2LGI A;  3QJZ A;  2PPH A;  2LFU A;  2D10 A;  2KYW A;  2Z8L A;  1V6E A;  2OHF A;  1KLV A;  5J2R A;  1JCK B;  3I57 A;  4W9K A;  1FXI A;  3O0E A;  2FUH B;  4DHZ E;  1WGH A;  2N2L A;  1GFM A;  1MG8 A;  1ROE A;  5AZH A;  4NJ6 A;  2Y0L A;  2KO3 A;  5BMH A;  3KZI O;  2G1E A;  3RCZ A;  1WYG A;  2BS4 B;  2WXG A;  1RM6 C;  1P0R A;  4YTM B;  3NSG A;  3PSE B;  1VRA B;  1V9J A;  2I38 A;  2ZVN A;  2INC C;  2KZ7 A;  1YQB A;  2Z0D B;  3TEX A;  2L52 A;  3LK2 B;  2XTQ A;  1GFP A;  2EKI A;  3QAQ A;  3VUX A;  4PK1 A;  3A1Q B;  4WJN A;  1ENF A;  4EEW A;  4MM3 B;  2JT4 B;  2LRW A;  4ZRI A;  5LXH A;  2WYQ A;  1E8X A;  1TKY A;  3SR6 A;  1V1P B;  3KLS X;  1CK1 A;  3GS2 A;  2FGQ X;  3HIZ A;  4ZHO A;  3TMP B;  2KTR B;  1FNV A;  1KJT A;  2ZCC A;  1UGM A;  2A5U A;  3TUO A;  3HRD D;  2BYF A;  2V3N A;  1L7Y A;  3DBR I;  5KHQ A;  3AU5 A;  2L83 A;  2KDM A;  2J0K A;  3A0H O;  4ICV A;  1SE4 A;  1YJI A;  2D3B A;  1YS5 A;  1V1O A;  2WXH A;  2MJE A;  1PRN A;  2H89 B;  1I7H A;  2D5G A;  3RT3 B;  3RPF C;  2XK5 B;  4WAA A;  1T0S C;  4RFB A;  5EDS A;  3AA1 A;  1E6E B;  2BWF A;  4PUX A;  4GMV A;  1C78 A;  2NPT A;  3VRA B;  1Z2M A;  3NZU A;  1NEN B;  1BML C;  1Q10 A;  1SGH A;  2QJL A;  4WWM A;  3RUI B;  4HCN B;  4BKS D;  4HDQ A;  2Y0H A;  5B66 O;  3IG3 A;  4FQE A;  5E6P A;  4WWN A;  4IL6 O;  3BRZ A;  1CMX B;  1J7B A;  4CYE A;  1R4N B;  1YQ4 B;  2H88 B;  2L76 A;  4CQN A;  3LK3 A;  3AE3 B;  2HTH A;  2K8B A;  3LK4 2;  2V4I B;  2KX3 A;  2WWZ A;  2ZPY A;  4AYM C;  3APC A;  2WXF A;  2MX2 A;  1L4D B;  3HW9 A;  4LSE A;  2JQY A;  2MJD A;  3AA7 B;  4YTN B;  2M07 A;  1I4H A;  3JW0 X;  5B5E O;  3UGB B;  2KMC A;  1XXG A;  2PW9 A;  1G90 A;  3AEB B;  2BGF A;  2ZZP B;  3MHS D;  3WAO A;  1UNS A;  4II2 B;  3RNC C;  1AAR A;  3VZU X;  4FAD A;  1JML A;  4YXD B;  1HZ5 A;  3NZS A;  3DBH B;  2J4X A;  3CST A;  1E8Z A;  1KRH A;  2X38 A;  2N2M A;  2UU7 A;  3P4R B;  2ZJD A;  4D64 A;  5DL7 A;  2GRI A;  1RFK A;  2UWQ A;  1GB1 A;  1TYG B;  3DVG Y;  2WQY B;  3KVF B;  4AYN A;  4PT5 A;  1I35 A;  2KN4 A;  4B9K A;  3WI5 A;  1FNW A;  4AKM A;  3PGU A;  3W1Y A;  4NQK E;  1FO4 A;  2KT7 A;  4MGI E;  4RF0 A;  3VY9 X;  3JVZ X;  4MGY E;  3NVZ A;  2D3G A;  2PTL A;  4FSP A;  4HEA 1;  1K50 A;  1QQR A;  2O6V A;  2FAZ A;  2BS3 B;  4FBJ B;  1YX5 B;  3TIX A;  2JMM A;  3PLU A;  3U8Z A;  2FGR A;  3DDC B;  4JX1 C;  4L23 A;  4ARC A;  1YJJ A;  4L1B A;  2K1F A;  3DWG C;  2XE1 A;  4XC2 A;  1QLB B;  4HDO A;  3L13 A;  1WGR A;  5E79 O;  2V9H A;  1PGX A;  2LHD A;  4AUI A;  4HK2 A;  1S1Q B;  4DK5 A;  1FXT B;  3NG0 A;  3P1M A;  2LI5 A;  2R4P A;  3KH0 A;  2TSS A;  5GXG B;  2JX5 A;  4MAC A;  3N30 A;  4RLC A;  1J8C A;  4URK A;  3PRZ A;  3PS6 A;  2IJ0 A;  2KTF A;  2ZNV C;  3A9K A;  1AW7 A;  2CR5 A;  2IWV A;  1WY8 A;  4KZC A;  2MBO A;  4BKG A;  4YSX B;  3B2F A;  2QHO A;  3WIM A;  5AFU K;  2JUO A;  2W9N A;  1L2N A;  1ORM A;  3HOE A;  1D5M C;  2L05 A;  3BIN A;  3CWI A;  1HTO A;  2NTS A;  4MEM A;  2DX5 B;  1IUE A;  5ADX K;  1GFQ A;  4RL9 A;  3KWV A;  1YX6 B;  1KOT A;  5EE9 A;  3B08 A;  1PYW D;  1J7A A;  5D94 A;  4NZL B;  3AE6 B;  1V2Y A;  3ZLZ A;  4IW0 A;  4AOF A;  2L0F A;  4MH8 A;  4REZ A;  5D5D A;  4XWT A;  1SIF A;  1M4V A;  3DA4 A;  4RGN A;  4IUM B;  1H6S 1;  1E7P B;  4JLC A;  4EZK A;  4P7I A;  3FC4 A;  3PHX B;  2IZV B;  1WJU A;  3W5V B;  2K3U A;  4C7Y A;  1R7S A;  1SEB D;  4WAF A;  2J0M A;  3A9J A;  2M8S A;  2KD0 A;  3V61 A;  4O3W A;  2Z0E B;  4K81 A;  2IGD A;  2G4D B;  6PRN A;  3IAS 1;  1ZUD 2;  1QF6 A;  1WR1 A;  3CMM B;  2WXQ A;  4ZHP A;  3ECI A;  4BUM X;  2KFK B;  2LGD A;  1ZXH A;  3AEA B;  2LJI A;  1K53 A;  4M0W B;  1TIF A;  4NAM A;  3FAH A;  3X0W A;  3GP7 A;  2BBC A;  1UF0 A;  1WH3 A;  2WU5 B;  1MVK A;  4KRA A;  5L95 C;  4UB8 O;  2BQQ A;  3AAA A;  4NAW A;  4AP4 C;  1QJ9 A;  4CO7 A;  1V80 A;  5G26 A;  2L8J A;  3TBL D;  2REX A;  2RSU A;  2QSD A;  3I3T B;  3H7S A;  1MPF A;  3GE3 C;  1S5L O;  3AV8 A;  2G3Q B;  2YLM A;  3U2S C;  1WYW B;  3DHH C;  2O4V A;  2I1K A;  4FZL A;  1NYR A;  2LD9 A;  2LRU A;  4ANV A;  3T3N A;  4TQ0 A;  4PYZ A;  4NPN A;  4E3C A;  2KHW B;  4YTP B;  2GBK A;  2NBU A;  3H6N A;  3LYY A;  4GSW A;  2K8H A;  1IZN B;  1UEL A;  1I4P A;  4OHJ A;  1C77 A;  3H1U A;  3ZYY X;  1UH6 A;  3H7P B;  1SE9 A;  3G7G A;  4E74 A;  5GV0 A;  3M95 A;  3UQB A;  3FYX A;  1QOF A;  5IA7 A;  8PRN A;  4HKQ A;  1IP9 A;  2J7Q B;  1GFO A;  4AS1 A;  4RNA A;  1WXV A;  4ANX A;  5AUK A;  1JRP A;  1ZKH A;  3HM3 A;  5DPR A;  1E9M A;  2Z59 B;  3FKY A;  3N20 C;  3N9Y C;  2YEP B;  4WUR A;  4M00 A;  4GDK B;  1X1M A;  5BO4 B;  1D5X C;  3S2A A;  2O2V A;  3AE5 B;  5L83 A;  2N0S B;  2K0L A;  2G9H D;  3R2T A;  5IOI A;  1R4M I;  2IPK D;  4LCD E;  1FM0 D;  1RAX A;  4EKU A;  2AL6 A;  2JXT A;  3POX A;  5C2T B;  1E0Z A;  1NI3 A;  5KAI O;  2AWT A;  2K22 A;  3PZD A;  5EE1 A;  3PPA A;  2K5P A;  1SXT A;  1XEE A;  3SZV A;  2C5L C;  2IYD B;  5G39 A;  2L32 A;  2PKO A;  1OTR B;  2YNK A;  3QK0 A;  1D5Z C;  2PE6 B;  3Q3O C;  2NCN A;  3ZNH B;  2MBH A;  2DYB A;  1HXT A;  4JWS C;  4DHJ B;  3KUZ A;  2CU3 A;  1PUT A;  3AED B;  1XT9 B;  2OMF A;  3VE1 A;  4JE3 B;  1BT9 A;  1VDV A;  1T0Q C;  4GGQ A;  4ZRQ A;  4IC7 B;  2CHX A;  1JW9 D;  3RNE C;  3IFW B;  1WXA A;  3SFD B;  4FZM A;  1EUV B;  4GCQ A;  2C60 A;  1Y8R C;  2WGS A;  2F1C X;  4IOI E;  2B76 B;  4RMA A;  2RR9 A;  4G50 A;  3BVM A;  1WX7 A;  2L1A A;  3P4S B;  4YL8 A;  2IDY A;  3L16 A;  3DBL B;  1ZHW A;  1ZW7 A;  2KAJ A;  3ZNG C;  4XE0 A;  1WX8 A;  5IO9 A;  3EFC A;  1ZHY A;  2R4N A;  2LGS A;  4DBG A;  2CS4 A;  3UQA A;  4FMS A;  4BAX A;  3V8U A;  3V60 A;  5TSS A;  5J17 A;  1ZP0 B;  2IO0 B;  2JPH A;  3BVZ A;  1ZHZ A;  5D7G A;  5AZF A;  4LJP B;  3PHW B;  1C9F A;  5DPW A;  3WAP A;  3ZJV A;  1L6U A;  3BYT B;  4RGT A;  2ZFG A;  1HTQ A;  2W3S A;  4MJS A;  3TEZ A;  4H2A A;  4KDI C;  3JCU O;  3DQV A;  2J1N A;  1SIJ A;  4N6E B;  5EE2 A;  2J0J A;  3EC8 A;  3HUI A;  2PJH A;  2PEA A;  4YT0 B;  2ZCB A;  2JF5 A;  3EEC A;  1ZDX A;  2FCS A;  1YIW A;  1C76 A;  1IGC A;  3MJW A;  3W1S C;  4ANU A;  2MA9 B;  3DVN V;  2WJQ A;  5C1Z A;  5HHD G;  3KYC D;  3NVY A;  3W9C B;  1VZ6 A;  3OJ3 A;  1C3T A;  1I4X A;  4C4V A;  2CJO A;  4LNN A;  3LXF A;  4E1T A;  2KXP A;  2NR2 A;  4JCH A;  2RGF A;  1HZ6 A;  1Z5S B;  3VY8 X;  3UI3 A;  4KDL B;  3T20 A;  3RNA C;  5BYR A;  3U7Z A;  2HTM E;  1K52 A;  3B0A A;  2QCZ A;  1OFF A;  3BVG A;  2MH7 A;  2PMV A;  2PVG C;  3UU2 A;  1Q1O A;  3Q8E A;  1EWY C;  3POU A;  2L3Z A;  1WJ4 A;  3AE7 B;  4G11 A;  4II3 B;  4P1C C;  2LXC A;  4D5U A;  2ODJ A;  4N59 A;  3U52 E;  1ZHX A;  3RZW C;  3NUH B;  2N9K A;  1UWM A;  1YN5 A;  4YSY B;  2KAC A;  1FCL A;  2LAS A;  1V81 A;  4W9D A;  3SY7 A;  2R8A A;  3QRA A;  1JWA D;  1PQS A;  3QCA A;  2HE7 A;  2GE4 A;  3H8H A;  1YJ1 A;  3ZXR A;  1EM7 A;  2HJ1 A;  3BY4 B;  3IAM 1;  1JWU D;  1K8R B;  2MW5 A;  4JWU C;  2GBM A;  2N9L A;  2OOB B;  2ZW0 A;  2KZ7 B;  3W2D A;  4EZL A;  3VQI A;  5BYQ A;  4LK0 M;  2KJ6 A;  3RD2 A;  3X23 A;  2IO3 B;  1WIA A;  3AEF B;  3GOE A;  1RRB A;  2WDT B;  3QIJ A;  1LM8 B;  3UIP B;  1ISN A;  3ZDM C;  2JWU A;  3JSV B;  2M0A A;  1F77 A;  4EZJ A;  3OAW A;  1HXU A;  1FEH A;  1PDX A;  4W9I A;  1I42 A;  4S17 A;  4LNI A;  5E6O A;  2I2Y A;  3LK2 A;  5D2M B;  4M8M A;  3SYS A;  4W9H A;  4N9F 4;  4LSF A;  4XZ4 A;  3EUB 2;  4LDT D;  2WJR A;  4DHJ D;  2MP2 B;  3A1Q A;  4O4X A;  2MCN B;  1RWS A;  3ML8 A;  4MM3 A;  1N61 A;  4AQ7 A;  2XEW A;  1ET6 A;  1GG3 A;  1PGA A;  2BYE A;  4FXC A;  1MJD A;  2BYT A;  4ZRP A;  2E6X A;  3ML9 A;  5DCN A;  4DXG A;  1V1P A;  4FLH A;  3VE2 A;  2Y3A A;  2PVO D;  2DZM A;  2K0P A;  1BUI C;  2CHZ A;  2KTR A;  1A70 A;  2RPV A;  2J53 A;  3Q8B A;  3UAQ A;  4HPP A;  3AEE B;  3RFZ B;  4OW0 A;  3A2S X;  4LSH A;  4GDL B;  4CTD A;  5T5F A;  2N9P C;  3A4S C;  4KGS A;  2HDE A;  3NVV A;  2DLB A;  2V0G A;  3OG5 A;  2K9X A;  4S0R A;  3Q3F A;  3KWL A;  2XK5 A;  4P6V F;  1F2R I;  4KIK B;  5BYS A;  1ZXI A;  2WNM A;  1HE8 A;  2WP9 B;  4W9C A;  5DPS A;  5CHV C;  2R89 A;  4YSZ B;  3DWN A;  1JQ4 A;  1PGB A;  2LUE A;  1P9D U;  3LDZ E;  3ZW3 A;  2WXJ A;  2SAK A;  1WZ3 A;  1DOX A;  1V8C A;  2IY0 B;  3GZN B;  4JIO U;  2RD0 A;  4C69 X;  3DWM A;  3E9S A;  5DL6 A;  2EMT A;  1WGK A;  3PRM B;  1FCC C;  1OEY A;  1IBX B;  4TKN A;  3R3M A;  5E6N A;  4F8C B;  4GHB A;  5GMV A;  5IAA C;  4BBN F;  3AH7 A;  4AJY B;  1VZ7 A;  4A3O A;  1I4Q A;  3LJ3 A;  3HWB A;  1KLU D;  3HVZ A;  1GPX A;  4ARI A;  3BS0 A;  3KVD D;  3AB5 A;  1WX9 A;  3AE8 B;  2M19 A;  4OVU A;  1UUP A;  4JL9 A;  5G5H A;  1VD2 A;  4A8X C;  2RMM A;  3NVW A;  1J19 A;  1WE6 A;  1GUA B;  2JXX A;  2KJR A;  3Q69 A;  1LFD A;  2Y7S A;  3EGR A;  2K4T A;  3VUY A;  4NJC A;  3AA6 B;  5MPO A;  2BYV E;  2AEH A;  1WFY A;  2K39 A;  2WX1 A;  4PS7 A;  2WDQ B;  2NBV B;  3KUD B;  3C5O A;  1XF5 L;  1ACC A;  3AUL A;  2KQS A;  1P7E A;  1EU4 A;  4K7W A;  2QDF A;  1KH0 A;  2LVP A;  2JY6 A;  3SEB A;  3N1Z C;  2XE3 A;  2KDE B;  1WI0 A;  3DHI C;  3ZTD A;  2INP E;  1E7V A;  4KKI A;  3CIR B;  1OSM A;  1NBF C;  3ZVV A;  1VJK A;  4BFR A;  3AAE B;  1RFA A;  2V3S A;  2KFJ A;  4DDG D;  3UPG A;  4KGR A;  3BK1 A;  2WDR B;  2F1V A;  3P63 A;  1JWS D;  4BOZ B;  2W82 A;  1MI0 A;  2V4L A;  1P4T A;  3TCA A;  4FHJ A;  2JWZ A;  2ZVO A;  4DXA B;  3AU4 A;  2KX0 A;  1F9J A;  2ZNV B;  3AE2 B;  1HA5 A;  3MP9 A;  1SJE D;  3KYD D;  2DYO A;  1T0R C;  2J42 A;  3AA0 B;  4O3Z A;  1C4C A;  5H92 C;  4IM0 A;  2XMX A;  4A20 A;  2LHF A;  4FJZ A;  1THQ A;  1SSN A;  2D3C A;  2GBN A;  1SBB B;  4KVG B;  1GJZ A;  3HK0 A;  1QZE A;  4J3O D;  2KC1 A;  4ACF A;  3ZO5 B;  2JRI B;  3DBR B;  4FUV A;  2NTT A;  3ZJU A;  1F52 A;  2KAN A;  1NDD A;  3POQ A;  2Y2X A;  4USA A;  4LNK A;  1GFN A;  3QX1 A;  3IXS A;  2KLC A;  1JWM D;  5AFU L;  4HKZ E;  4US8 A;  3RBH A;  5IP4 D;  1VCB A;  3BRY A;  2ZPN A;  4C80 A;  3VVW B;  5ADX L;  1RLF A;  4DHZ B;  2AQ1 B;  2EKE C;  4W9G A;  2LXA A;  1D6E C;  1TS4 A;  3ZIM A;  4IM3 A;  3VZT X;  2Y5B B;  3BWU D;  2KMA A;  4FRX A;  1YD8 U;  4C56 C;  4O49 A;  3RUL A;  2WDV B;  3PRN A;  4A3P A;  4IWP A;  1MG4 A;  4GF4 A;  2WVP A;  2ZLD A;  5CX3 A;  3NJT A;  3PZ7 A;  2LMC A;  2VZK B;  4DDI D;  5CTR C;  2ERV A;  1XLP A;  4MSQ B;  2WXK A;  1RYJ A;  1YNT E;  3MTN B;  2XG6 A;  2AL3 A;  1WXM A;  3UIN B;  1QKZ A;  2V3P A;  1UGJ A;  1U4A A;  2KFK A;  3PQS A;  1E8W A;  2AQ3 B;  1QOG A;  4E71 A;  2QMT A;  2R61 A;  3DVG X;  1ESF A;  4AJW A;  3M62 B;  4M0W A;  1FRD A;  1XO3 A;  3N32 A;  1G6J A;  3ZNZ B;  1N60 A;  3BK2 A;  2N7E A;  2BKR B;  4FA6 A;  2N9X A;  2X8X X;  3T0S A;  2QIL A;  4EFO A;  3T9L A;  3ZUN A;  3GB1 A;  3RNF C;  2MSE D;  1DYQ A;  5AEK B;  5G3A A;  1K51 A;  3V6C B;  1BH3 A;  4MT5 A;  2OED A;  2WXM A;  3D32 A;  1WZ0 A;  1BXT A;  3B2G A;  4WQM A;  3MC0 B;  1QJP A;  4FT6 A;  1WMH B;  3WAM A;  4G0N B;  2MWS B;  3IVF A;  2RDH A;  1V49 A;  2V1Y A;  1YQ3 B;  4NJ7 A;  3ZTC A;  2DAJ A;  1IZN A;  4E1S A;  1XLN A;  2MEK A;  2BVC A;  3FIL B;  3ONS A;  1FFV A;  2AX5 A;  3H7P A;  2KKC A;  4RF1 A;  2BWE S;  3IT6 B;  4ITK A;  1GOZ A;  5IN7 A;  4X57 B;  1D4B A;  5E6J A;  2LFI A;  3V62 A;  2FCQ A;  3VH4 B;  3AM9 A;  4TQ1 A;  4G3X B;  1Q5W B;  3VTW A;  1P7F A;  4PJ0 O;  3KUC B;  4WWO A;  2R4O A;  1E8Y A;  3QHT A;  3PV1 A;  3U30 A;  1AYF A;  4KSK C;  2F1T A;  5BMI A;  2JSV X;  4GDK A;  4P1B C;  1GB4 A;  1LO5 D;  1TJE A;  1OQY A;  2E3T A;  1DOY A;  1P3Q U;  1H8C A;  1H4R A;  3A0B O;  4OZC A;  2LWP A;  3AE1 B;  2CU1 A;  4IWO A;  5CHF A;  2VH2 A;  1QIL A;  2YEP F;  4W9F A;  4XNK A;  1NI2 A;  1FMA D;  5G55 A;  2NVU I;  4XDD A;  4MEL A;  3V6E B;  1TKE A;  2RPQ A;  3Q3J A;  4ZYN A;  2WXR A;  1LXD A;  3K9P B;  4KR8 A;  3P42 A;  3O65 B;  7PRN A;  1MHX A;  2XE2 A;  4IG7 B;  1SJH D;  3PRP B;  5JXV A;  4WQO B;  3L17 A;  4A55 A;  2XNA C;  3EMN X; 
#chains in the Genus database with same CATH homology
 3OG5 A;  3EFC A;  4C4V B;  4C4V A;  4BZA A;  4K3C A;  4N75 A;  4N74 A;  4QAY A;  4K3B A;  4XGA B;  4PK1 A;  3MC9 A;  4C00 A;  3MC8 A;  3Q6B A;  2X8X X;  2VH2 A;  2VH1 A;  2V9H A;  2QCZ A;  2MHJ A;  2QDF A;  3NJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...