2R4LA

Crystal structure of the long-chain fatty acid transporter fadl mutant p34a
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
421
structure length
412
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNAALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
total genus 103
structure length 412
sequence length 421
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4lA00
3DWOX 2R4PA 3PGUA 3PGRA 3PGSA 3BRYA 2R89A 2R8AA 1T1LA 2R4OA 1T16A 2R4LA 2R4NA 2R88A 3DWNA 3BRZA 3BS0A 3PF1A
chains in the Genus database with same CATH superfamily
3FYXA 2R4PA 4E1SA 5GV0A 4FRXA 4Z3TA 4O4UA 4AKRB 4GCPA 2N2LA 3PQUA 3VY8X 1THQA 5JDPA 2W81C 5DL8A 3A0HO 4BUMX 3T24A 4FSOA 4GCSA 3DWOX 3SYBA 5B66O 3C5OA 5EE2A 2WJRA 3VY9X 3K19A 3VZUX 2XTQA 3AA1B 4N58A 1ZHYA 3WI4A 4D65A 5KAIO 3SY9A 2XE1A 1QJ9A 2LHFA 4G76A 2Y0HA 3QRCA 1ORMA 2R4OA 3AA7B 2AXTO 4RLCA 2JQYA 2Y0KA 4O3YA 3RBHA 1E54A 5E79O 4O49A 4N75A 4XNKA 3SYSA 4C4VB 5IYUA 5TISO 4KRAA 4LSFA 3VZWX 4K3BA 4AZLA 4FRTA 5GTHO 4LSEA 1ZHWA 1HXUA 2MHLA 2F1TA 3PGRA 1BH3A 1ZHTA 4FESA 2GE4A 4FMSA 4FZMA 1H6S1 4FZNA 3DWNA 4XNLA 3AAEB 2J1NA 2KZ7A 3JCUO 4N59A 2XE2A 4AYDC 5GTIO 1HXTA 5PRNA 4O3WA 5G3AA 4E1TA 3AA6A 3HOLA 3JTYA 2JMMA 1T16A 4CTDA 5DL5A 6PRNA 3UPGA 2IWVA 3KZIO 4LSIA 3PGSA 1GFMA 5ADXK 3GP6A 3SY7A 3V8UA 4D64A 3EMNX 2KC0A 2PORA 3NJTA 3VE2A 5AFUK 3LK42 1MM4A 4D5UA 2Y0LA 3LK3A 2N2MA 5KAFO 2ZFGA 4RL9A 2ZLDA 4C00A 2WVPA 3PQSA 3G7GA 4FQEA 3WI5A 3HW9A 1IZNB 3SZVA 3WU2O 2MNHA 3KVDD 4AKRA 1MPFA 3LK2A 2FGRA 4GHBA 4AYMC 2W80C 4O3XB 2M06A 2XE3A 2YNKA 4PR7A 1GFOA 4PUXA 3SZDA 1BXWA 3VZTX 2M07A 1ZHZA 5DL7A 3POXA 1GFPA 3DA4A 1QJ8A 2XG6A 4IL6O 4QQ1A 4FZLA 4RLBA 2X27X 3AA1A 4GCQA 5G39A 4N74A 5ADXL 2R89A 3AA0A 3HOEA 3POUA 4AFKA 5H2FO 1OSMA 1OPFA 3DA3A 4AYNA 3AA7A 2XTRA 3AAAA 3BRZA 4FSPA 3BS0A 4JCHA 4UB6O 2KXPA 2ODJA 5AFUL 2Y7SA 2FGQX 4JFBA 2OMFA 2WJQA 4AUIA 7PRNA 5G38A 4C4VA 1PHOA 3TZGA 4FOZA 1Q9FA 4AKMA 2O4VA 3T20A 1MM5A 4U9CA 2XE5A 3PRNA 4K3CA 5DL6A 2F1VA 5FVNA 1T1LA 2K0LA 4G75A 2R4NA 1PRNA 4LSHA 1ZHXA 1GFNA 3AAEA 3BRYA 3A2SX 3LK2B 2J4UP 2X9KA 3A0BO 3PORA 4FT6A 2XMXA 1QJPA 4RJWA 4UB8O 5B5EO 4AYID 2K4TA 4AYEC 4O4XA 5D5DA 3POQA 3PGUA 4FUVA 1Q9GA 2YPVA 2F1CX 2R4LA 2R88A 2ERVA 2KZ7B 3NSGA 4KR8A 5G26A 1S5LO 2PRNA 4KR4A 1YS5A 3AA0B 2KDYA 4F4BA 1HXXA 4C69X 3AA6B 3HWBA 4B61A 2R8AA 3AAAB 3T0SA 5T5FA 2KXPB 4PJ0O 2IWWA 1IZNA 3UAQA 3LK41 1G90A 4O3ZA 1GFQA 3QRAA 2LFUA 4RJXA 3UU2A 8PRNA 2QTKA 2Y2XA 1P4TA 3DZMA 3O0EA 4GF4A 3VE1A 3LK3B 1BT9A 3PF1A
chains in the Genus database with same CATH topology
3DWOX 2R4PA 3PGUA 3PGRA 3PGSA 3BRYA 2R89A 2R8AA 1T1LA 2R4OA 1T16A 2R4LA 2R4NA 2R88A 3DWNA 3BRZA 3BS0A 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWO X;  2R4P A;  3PGU A;  3PGR A;  3PGS A;  3BRY A;  2R89 A;  2R8A A;  1T1L A;  2R4O A;  1T16 A;  2R4L A;  2R4N A;  2R88 A;  3DWN A;  3BRZ A;  3BS0 A;  3PF1 A; 
#chains in the Genus database with same CATH topology
 3FYX A;  2R4P A;  4E1S A;  5GV0 A;  4FRX A;  4Z3T A;  4O4U A;  4AKR B;  4GCP A;  2N2L A;  3PQU A;  3VY8 X;  1THQ A;  5JDP A;  2W81 C;  5DL8 A;  3A0H O;  4BUM X;  3T24 A;  4FSO A;  4GCS A;  3DWO X;  3SYB A;  5B66 O;  3C5O A;  5EE2 A;  2WJR A;  3VY9 X;  3K19 A;  3VZU X;  2XTQ A;  3AA1 B;  4N58 A;  1ZHY A;  3WI4 A;  4D65 A;  5KAI O;  3SY9 A;  2XE1 A;  1QJ9 A;  2LHF A;  4G76 A;  2Y0H A;  3QRC A;  1ORM A;  2R4O A;  3AA7 B;  2AXT O;  4RLC A;  2JQY A;  2Y0K A;  4O3Y A;  3RBH A;  1E54 A;  5E79 O;  4O49 A;  4N75 A;  4XNK A;  3SYS A;  4C4V B;  5IYU A;  5TIS O;  4KRA A;  4LSF A;  3VZW X;  4K3B A;  4AZL A;  4FRT A;  5GTH O;  4LSE A;  1ZHW A;  1HXU A;  2MHL A;  2F1T A;  3PGR A;  1BH3 A;  1ZHT A;  4FES A;  2GE4 A;  4FMS A;  4FZM A;  1H6S 1;  4FZN A;  3DWN A;  4XNL A;  3AAE B;  2J1N A;  2KZ7 A;  3JCU O;  4N59 A;  2XE2 A;  4AYD C;  5GTI O;  1HXT A;  5PRN A;  4O3W A;  5G3A A;  4E1T A;  3AA6 A;  3HOL A;  3JTY A;  2JMM A;  1T16 A;  4CTD A;  5DL5 A;  6PRN A;  3UPG A;  2IWV A;  3KZI O;  4LSI A;  3PGS A;  1GFM A;  5ADX K;  3GP6 A;  3SY7 A;  3V8U A;  4D64 A;  3EMN X;  2KC0 A;  2POR A;  3NJT A;  3VE2 A;  5AFU K;  3LK4 2;  1MM4 A;  4D5U A;  2Y0L A;  3LK3 A;  2N2M A;  5KAF O;  2ZFG A;  4RL9 A;  2ZLD A;  4C00 A;  2WVP A;  3PQS A;  3G7G A;  4FQE A;  3WI5 A;  3HW9 A;  1IZN B;  3SZV A;  3WU2 O;  2MNH A;  3KVD D;  4AKR A;  1MPF A;  3LK2 A;  2FGR A;  4GHB A;  4AYM C;  2W80 C;  4O3X B;  2M06 A;  2XE3 A;  2YNK A;  4PR7 A;  1GFO A;  4PUX A;  3SZD A;  1BXW A;  3VZT X;  2M07 A;  1ZHZ A;  5DL7 A;  3POX A;  1GFP A;  3DA4 A;  1QJ8 A;  2XG6 A;  4IL6 O;  4QQ1 A;  4FZL A;  4RLB A;  2X27 X;  3AA1 A;  4GCQ A;  5G39 A;  4N74 A;  5ADX L;  2R89 A;  3AA0 A;  3HOE A;  3POU A;  4AFK A;  5H2F O;  1OSM A;  1OPF A;  3DA3 A;  4AYN A;  3AA7 A;  2XTR A;  3AAA A;  3BRZ A;  4FSP A;  3BS0 A;  4JCH A;  4UB6 O;  2KXP A;  2ODJ A;  5AFU L;  2Y7S A;  2FGQ X;  4JFB A;  2OMF A;  2WJQ A;  4AUI A;  7PRN A;  5G38 A;  4C4V A;  1PHO A;  3TZG A;  4FOZ A;  1Q9F A;  4AKM A;  2O4V A;  3T20 A;  1MM5 A;  4U9C A;  2XE5 A;  3PRN A;  4K3C A;  5DL6 A;  2F1V A;  5FVN A;  1T1L A;  2K0L A;  4G75 A;  2R4N A;  1PRN A;  4LSH A;  1ZHX A;  1GFN A;  3AAE A;  3BRY A;  3A2S X;  3LK2 B;  2J4U P;  2X9K A;  3A0B O;  3POR A;  4FT6 A;  2XMX A;  1QJP A;  4RJW A;  4UB8 O;  5B5E O;  4AYI D;  2K4T A;  4AYE C;  4O4X A;  5D5D A;  3POQ A;  3PGU A;  4FUV A;  1Q9G A;  2YPV A;  2F1C X;  2R4L A;  2R88 A;  2ERV A;  2KZ7 B;  3NSG A;  4KR8 A;  5G26 A;  1S5L O;  2PRN A;  4KR4 A;  1YS5 A;  3AA0 B;  2KDY A;  4F4B A;  1HXX A;  4C69 X;  3AA6 B;  3HWB A;  4B61 A;  2R8A A;  3AAA B;  3T0S A;  5T5F A;  2KXP B;  4PJ0 O;  2IWW A;  1IZN A;  3UAQ A;  3LK4 1;  1G90 A;  4O3Z A;  1GFQ A;  3QRA A;  2LFU A;  4RJX A;  3UU2 A;  8PRN A;  2QTK A;  2Y2X A;  1P4T A;  3DZM A;  3O0E A;  4GF4 A;  3VE1 A;  3LK3 B;  1BT9 A;  3PF1 A; 
#chains in the Genus database with same CATH homology
 3DWO X;  2R4P A;  3PGU A;  3PGR A;  3PGS A;  3BRY A;  2R89 A;  2R8A A;  1T1L A;  2R4O A;  1T16 A;  2R4L A;  2R4N A;  2R88 A;  3DWN A;  3BRZ A;  3BS0 A;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...