2R4LA

Crystal structure of the long-chain fatty acid transporter fadl mutant p34a
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
421
structure length
412
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNAALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 103
structure length 412
sequence length 421
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r4lA00
2R4NA 2R88A 3BRYA 2R4PA 3DWOX 3PF1A 3BRZA 3DWNA 3PGRA 3PGSA 2R8AA 2R89A 3PGUA 2R4OA 3BS0A 1T1LA 2R4LA 1T16A
chains in the Genus database with same CATH superfamily
1G90A 4K3CA 2FGQX 3PQSA 3BRZA 2AXTO 1GFNA 3RBHA 2R89A 4AZLA 1HXXA 1ZHTA 3LK42 4O3YA 5KAFO 3AA1A 4RL9A 1T16A 3AAAB 3AAAA 2LHFA 5ADXL 1IZNA 1QJPA 4E1TA 5DL5A 2WJQA 2XTQA 4FRXA 3AA6B 3PQUA 4LSHA 1HXUA 5AFUK 3WI5A 5G39A 4AYDC 2R4OA 2IWWA 2MHLA 2IWVA 4FT6A 5G26A 3V8UA 2XE3A 4N75A 1BXWA 2R88A 3POXA 4FZLA 4LSEA 3VE1A 4IL6O 1YS5A 3AAEA 5DL6A 1THQA 3DA3A 6PRNA 3VZWX 3VY8X 5H2FO 4U9CA 3AA0A 2OMFA 2Y2XA 4LSFA 2R4PA 4B61A 3AA7A 5G3AA 2GE4A 2YNKA 1S5LO 2K0LA 3SYBA 4AYID 4GF4A 5DL7A 1H6S1 3QRCA 2PRNA 2Y0KA 4XNLA 1GFOA 5B5EO 2QTKA 2KZ7A 3BS0A 3SY9A 1E54A 4AYEC 3AA1B 4E1SA 2XG6A 2JMMA 2ZFGA 4PJ0O 3PF1A 1QJ8A 1IZNB 2WVPA 4FRTA 2J1NA 4FUVA 4D64A 1ZHYA 5DL8A 3BRYA 1ORMA 7PRNA 2FGRA 2KDYA 3HOEA 5AFUL 5FVNA 4GHBA 2PORA 5EE2A 3AAEB 3WI4A 4GCSA 3KVDD 2M07A 4JCHA 2R4LA 4PR7A 4FZMA 2XE5A 4C4VA 3AA0B 3DZMA 1MPFA 4PUXA 5GV0A 2XMXA 4O4UA 4LSIA 1OPFA 5IYUA 2WJRA 3AA7B 3PGUA 1ZHXA 3T24A 3PGRA 3K19A 4O3WA 4FSOA 2F1TA 4FESA 3POQA 5GTHO 4CTDA 1BT9A 3VZTX 2XE1A 4AYMC 3PRNA 1BH3A 4AKRA 4FQEA 4KR4A 2KXPA 2LFUA 2X9KA 4N74A 3T20A 1T1LA 5B66O 4FZNA 2KZ7B 1GFMA 2X27X 1HXTA 2ZLDA 3QRAA 3JCUO 4FMSA 4JFBA 4N59A 4QQ1A 4RLCA 4UB8O 3VE2A 4UB6O 4D65A 2R8AA 4Z3TA 4KR8A 4AFKA 3NJTA 2Y7SA 2W80C 3LK2B 2R4NA 3LK2A 4AYNA 3DA4A 3DWNA 5D5DA 3O0EA 1ZHZA 3PORA 4RJXA 3SYSA 2M06A 3A2SX 4BUMX 2F1CX 2XTRA 3C5OA 2ODJA 4O3XB 5KAIO 2YPVA 3HWBA 5T5FA 4G75A 3LK3A 4C4VB 8PRNA 2XE2A 3KZIO 3FYXA 2MNHA 4G76A 3EMNX 4RLBA 3SZDA 1MM5A 3TZGA 2J4UP 2K4TA 4O4XA 4O3ZA 4FOZA 5ADXK 2N2MA 4C69X 3PGSA 4XNKA 2ERVA 4AKRB 4KRAA 2KXPB 3UAQA 2N2LA 1P4TA 3AA6A 1ZHWA 3HW9A 2KC0A 3SZVA 3WU2O 5TISO 1Q9GA 1PHOA 4GCQA 5E79O 4O49A 3A0HO 1GFPA 2Y0LA 4N58A 2JQYA 2Y0HA 5PRNA 4AKMA 3JTYA 3A0BO 4K3BA 3DWOX 4RJWA 3LK41 4D5UA 4AUIA 5GTIO 3UU2A 3VY9X 1Q9FA 4F4BA 2O4VA 2F1VA 3VZUX 3GP6A 5G38A 3UPGA 1GFQA 1OSMA 1QJ9A 1PRNA 3HOLA 4GCPA 3T0SA 3NSGA 3SY7A 1MM4A 2W81C 3LK3B 4C00A 3G7GA 3POUA 4FSPA 5JDPA
chains in the Genus database with same CATH topology
2R4NA 2R88A 3BRYA 2R4PA 3DWOX 3PF1A 3BRZA 3DWNA 3PGRA 3PGSA 2R8AA 2R89A 3PGUA 2R4OA 3BS0A 1T1LA 2R4LA 1T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4N A;  2R88 A;  3BRY A;  2R4P A;  3DWO X;  3PF1 A;  3BRZ A;  3DWN A;  3PGR A;  3PGS A;  2R8A A;  2R89 A;  3PGU A;  2R4O A;  3BS0 A;  1T1L A;  2R4L A;  1T16 A; 
#chains in the Genus database with same CATH topology
 1G90 A;  4K3C A;  2FGQ X;  3PQS A;  3BRZ A;  2AXT O;  1GFN A;  3RBH A;  2R89 A;  4AZL A;  1HXX A;  1ZHT A;  3LK4 2;  4O3Y A;  5KAF O;  3AA1 A;  4RL9 A;  1T16 A;  3AAA B;  3AAA A;  2LHF A;  5ADX L;  1IZN A;  1QJP A;  4E1T A;  5DL5 A;  2WJQ A;  2XTQ A;  4FRX A;  3AA6 B;  3PQU A;  4LSH A;  1HXU A;  5AFU K;  3WI5 A;  5G39 A;  4AYD C;  2R4O A;  2IWW A;  2MHL A;  2IWV A;  4FT6 A;  5G26 A;  3V8U A;  2XE3 A;  4N75 A;  1BXW A;  2R88 A;  3POX A;  4FZL A;  4LSE A;  3VE1 A;  4IL6 O;  1YS5 A;  3AAE A;  5DL6 A;  1THQ A;  3DA3 A;  6PRN A;  3VZW X;  3VY8 X;  5H2F O;  4U9C A;  3AA0 A;  2OMF A;  2Y2X A;  4LSF A;  2R4P A;  4B61 A;  3AA7 A;  5G3A A;  2GE4 A;  2YNK A;  1S5L O;  2K0L A;  3SYB A;  4AYI D;  4GF4 A;  5DL7 A;  1H6S 1;  3QRC A;  2PRN A;  2Y0K A;  4XNL A;  1GFO A;  5B5E O;  2QTK A;  2KZ7 A;  3BS0 A;  3SY9 A;  1E54 A;  4AYE C;  3AA1 B;  4E1S A;  2XG6 A;  2JMM A;  2ZFG A;  4PJ0 O;  3PF1 A;  1QJ8 A;  1IZN B;  2WVP A;  4FRT A;  2J1N A;  4FUV A;  4D64 A;  1ZHY A;  5DL8 A;  3BRY A;  1ORM A;  7PRN A;  2FGR A;  2KDY A;  3HOE A;  5AFU L;  5FVN A;  4GHB A;  2POR A;  5EE2 A;  3AAE B;  3WI4 A;  4GCS A;  3KVD D;  2M07 A;  4JCH A;  2R4L A;  4PR7 A;  4FZM A;  2XE5 A;  4C4V A;  3AA0 B;  3DZM A;  1MPF A;  4PUX A;  5GV0 A;  2XMX A;  4O4U A;  4LSI A;  1OPF A;  5IYU A;  2WJR A;  3AA7 B;  3PGU A;  1ZHX A;  3T24 A;  3PGR A;  3K19 A;  4O3W A;  4FSO A;  2F1T A;  4FES A;  3POQ A;  5GTH O;  4CTD A;  1BT9 A;  3VZT X;  2XE1 A;  4AYM C;  3PRN A;  1BH3 A;  4AKR A;  4FQE A;  4KR4 A;  2KXP A;  2LFU A;  2X9K A;  4N74 A;  3T20 A;  1T1L A;  5B66 O;  4FZN A;  2KZ7 B;  1GFM A;  2X27 X;  1HXT A;  2ZLD A;  3QRA A;  3JCU O;  4FMS A;  4JFB A;  4N59 A;  4QQ1 A;  4RLC A;  4UB8 O;  3VE2 A;  4UB6 O;  4D65 A;  2R8A A;  4Z3T A;  4KR8 A;  4AFK A;  3NJT A;  2Y7S A;  2W80 C;  3LK2 B;  2R4N A;  3LK2 A;  4AYN A;  3DA4 A;  3DWN A;  5D5D A;  3O0E A;  1ZHZ A;  3POR A;  4RJX A;  3SYS A;  2M06 A;  3A2S X;  4BUM X;  2F1C X;  2XTR A;  3C5O A;  2ODJ A;  4O3X B;  5KAI O;  2YPV A;  3HWB A;  5T5F A;  4G75 A;  3LK3 A;  4C4V B;  8PRN A;  2XE2 A;  3KZI O;  3FYX A;  2MNH A;  4G76 A;  3EMN X;  4RLB A;  3SZD A;  1MM5 A;  3TZG A;  2J4U P;  2K4T A;  4O4X A;  4O3Z A;  4FOZ A;  5ADX K;  2N2M A;  4C69 X;  3PGS A;  4XNK A;  2ERV A;  4AKR B;  4KRA A;  2KXP B;  3UAQ A;  2N2L A;  1P4T A;  3AA6 A;  1ZHW A;  3HW9 A;  2KC0 A;  3SZV A;  3WU2 O;  5TIS O;  1Q9G A;  1PHO A;  4GCQ A;  5E79 O;  4O49 A;  3A0H O;  1GFP A;  2Y0L A;  4N58 A;  2JQY A;  2Y0H A;  5PRN A;  4AKM A;  3JTY A;  3A0B O;  4K3B A;  3DWO X;  4RJW A;  3LK4 1;  4D5U A;  4AUI A;  5GTI O;  3UU2 A;  3VY9 X;  1Q9F A;  4F4B A;  2O4V A;  2F1V A;  3VZU X;  3GP6 A;  5G38 A;  3UPG A;  1GFQ A;  1OSM A;  1QJ9 A;  1PRN A;  3HOL A;  4GCP A;  3T0S A;  3NSG A;  3SY7 A;  1MM4 A;  2W81 C;  3LK3 B;  4C00 A;  3G7G A;  3POU A;  4FSP A;  5JDP A; 
#chains in the Genus database with same CATH homology
 2R4N A;  2R88 A;  3BRY A;  2R4P A;  3DWO X;  3PF1 A;  3BRZ A;  3DWN A;  3PGR A;  3PGS A;  2R8A A;  2R89 A;  3PGU A;  2R4O A;  3BS0 A;  1T1L A;  2R4L A;  1T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...