1QJ9A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The structure of the outer membrane protein OmpX from Escherichia coli reveals possible mechanisms of virulence.
pubmed rcsb
source organism Escherichia coli
molecule tags Integral membrane protein
total genus 39
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj9A00
3QRAA 2ERVA 3C5OA 4PUXA 1P4TA 1MM5A 1QJPA 3GP6A 2K0LA 1THQA 2LHFA 3QRCA 2N2MA 2M07A 2MHLA 2M06A 2X27X 1G90A 1Q9GA 4RLCA 2F1VA 2F1TA 1ORMA 2GE4A 1MM4A 1QJ9A 3G7GA 1QJ8A 1BXWA 2MNHA 1Q9FA 2N2LA 2JMMA
chains in the Genus database with same CATH superfamily
2Y0LA 2QTKA 3C5OA 5FVNA 4O3ZA 1MPFA 4O49A 3PGRA 2Y7SA 3LK3A 4FMSA 3SY7A 1P4TA 2KXPB 4JFBA 4LSIA 4O4XA 2KDYA 2PORA 2LFUA 3PQSA 5IYUA 1OPFA 2Y0HA 3BS0A 2J4UP 2WJQA 3EMNX 4LSHA 1H6S1 2LHFA 4FSPA 3QRCA 4FOZA 4FT6A 3AA7A 5DL5A 3TZGA 4AKMA 4G75A 2JQYA 2M07A 4AYID 4Z3TA 2IWVA 3AAEB 3PF1A 4RLCA 3LK2B 2F1TA 2W80C 2YNKA 3POQA 4FQEA 3JTYA 4PJ0O 3PQUA 4RJXA 3UU2A 2XE2A 5E79O 2XTRA 3DWOX 4FZLA 4JCHA 4FSOA 2MNHA 3VE1A 4FRTA 4GCPA 4U9CA 3WI5A 3PGUA 3DA3A 2JMMA 5DL7A 5KAFO 5ADXK 4LSEA 3AA1A 4XNLA 4K3CA 4E1SA 1GFPA 4N74A 2W81C 4FZNA 1GFQA 2ODJA 3PORA 4K3BA 5PRNA 4O3XB 3VE2A 3AA0B 5AFUL 3AAEA 1BH3A 1QJPA 5G39A 5GTHO 2R4PA 3LK2A 3GP6A 3NJTA 3AAAA 4QQ1A 5EE2A 5B5EO 2R8AA 3POUA 4RLBA 3FYXA 1OSMA 2N2MA 2PRNA 2KZ7A 4XNKA 5G26A 4KR4A 2MHLA 2X27X 3HOEA 1GFOA 2XTQA 1G90A 3JCUO 1GFMA 1Q9GA 3VZWX 2F1VA 1ORMA 2GE4A 3KVDD 2O4VA 4O3WA 4AZLA 4C4VA 2FGRA 4N75A 1ZHXA 4GCSA 5H2FO 4AKRB 3VY9X 5DL8A 4FESA 7PRNA 1ZHYA 2R89A 4KR8A 3UAQA 4C00A 3LK41 2XE5A 3K19A 3A0HO 3LK42 2YPVA 2R88A 4FZMA 2WVPA 5KAIO 2ERVA 2KXPA 4FUVA 4G76A 2XG6A 4O3YA 2ZLDA 4PUXA 1IZNB 4AYDC 3HOLA 2F1CX 4FRXA 5D5DA 3HWBA 2OMFA 3SYBA 1MM5A 4AFKA 4E1TA 3O0EA 2IWWA 4D5UA 3LK3B 1ZHWA 2K0LA 4N59A 5T5FA 1THQA 3DA4A 2R4LA 2Y2XA 6PRNA 5B66O 1ZHZA 3DWNA 4AYMC 2XE3A 4LSFA 3SZDA 4GF4A 3SZVA 3AA7B 3NSGA 3KZIO 4GCQA 4GHBA 3V8UA 2XE1A 1QJ9A 1T16A 2WJRA 4KRAA 3G7GA 1QJ8A 1GFNA 2AXTO 2XMXA 4PR7A 4RJWA 5GTIO 3SYSA 3UPGA 1Q9FA 3PGSA 2K4TA 2N2LA 1S5LO 4D64A 1YS5A 3QRAA 1E54A 5TISO 3AA6B 3T24A 3AA0A 4O4UA 5ADXL 1PRNA 3HW9A 4D65A 5AFUK 4IL6O 4CTDA 1BT9A 4UB8O 1T1LA 4F4BA 4AYEC 3AA1B 1HXTA 4AUIA 3BRYA 3WU2O 8PRNA 3RBHA 5GV0A 3PRNA 3VY8X 3A0BO 2M06A 3BRZA 3DZMA 4UB6O 3SY9A 3AAAB 4AKRA 2J1NA 1PHOA 4RL9A 1MM4A 3A2SX 3VZUX 2KZ7B 4B61A 4AYNA 1HXXA 5G3AA 2R4NA 2FGQX 5JDPA 4N58A 3VZTX 4BUMX 3WI4A 3AA6A 4C4VB 3POXA 1BXWA 4C69X 5G38A 2ZFGA 3T0SA 1HXUA 1ZHTA 2Y0KA 1IZNA 2X9KA 2KC0A 5DL6A 2R4OA 3T20A
chains in the Genus database with same CATH topology
2Y0LA 2QTKA 3C5OA 5FVNA 4O3ZA 1MPFA 4O49A 3SY7A 2Y7SA 3LK3A 4FMSA 1P4TA 2KXPB 4JFBA 4LSIA 4O4XA 2KDYA 2PORA 2LFUA 3PQSA 5IYUA 1OPFA 2Y0HA 2J4UP 3EMNX 4LSHA 1H6S1 2LHFA 4FSPA 3QRCA 4FOZA 4FT6A 3AA7A 5DL5A 4Z3TA 4AKMA 4G75A 2M07A 4AYID 3AAEB 4RLCA 3LK2B 2F1TA 2W80C 2YNKA 3POQA 3JTYA 3PQUA 4RJXA 3UU2A 2XE2A 2XTRA 4JCHA 4FZLA 4FSOA 2MNHA 3VE1A 4FRTA 4GCPA 4U9CA 3WI5A 3DA3A 2JMMA 5DL7A 5ADXK 4LSEA 3AA1A 4XNLA 4E1SA 1GFPA 2W81C 4FZNA 1GFQA 2ODJA 3PORA 5PRNA 4O3XB 3VE2A 3AA0B 5AFUL 3AAEA 1BH3A 1QJPA 3LK2A 3GP6A 4QQ1A 3AAAA 5EE2A 4RLBA 3POUA 5G26A 3FYXA 1OSMA 2N2MA 2PRNA 2KZ7A 4XNKA 4AYEC 4KR4A 2MHLA 2X27X 3HOEA 1GFOA 2XTQA 1G90A 3VZWX 1GFMA 1Q9GA 2F1VA 1ORMA 2GE4A 3KVDD 2O4VA 4O3WA 4AZLA 2FGRA 1ZHXA 4GCSA 4AKRB 3VY9X 5DL8A 4FESA 7PRNA 1ZHYA 4KR8A 3UAQA 3LK41 2XE5A 3K19A 3LK42 2YPVA 4FZMA 3TZGA 2ERVA 2KXPA 4FUVA 4G76A 2XG6A 4O3YA 2ZLDA 4PUXA 1IZNB 4AYDC 3HOLA 4FRXA 5D5DA 3HWBA 2OMFA 3SYBA 1MM5A 4AFKA 4E1TA 3O0EA 4D5UA 3LK3B 1ZHWA 2K0LA 4N59A 5T5FA 1THQA 3DA4A 2Y2XA 6PRNA 1ZHZA 4AYMC 2XE3A 4LSFA 3SZDA 4GF4A 3SZVA 3AA7B 3NSGA 4GCQA 4GHBA 3V8UA 2XE1A 1QJ9A 4KRAA 3G7GA 1QJ8A 1GFNA 2XMXA 4RJWA 3SYSA 3UPGA 1Q9FA 2N2LA 2K4TA 4D64A 1YS5A 3QRAA 1E54A 3AA6B 3T24A 3AA0A 4O4UA 5ADXL 1PRNA 3HW9A 4D65A 5AFUK 1BT9A 4F4BA 3AA1B 1HXTA 4AUIA 8PRNA 3RBHA 5GV0A 3PRNA 3VY8X 2M06A 3SY9A 3AAAB 4AKRA 2J1NA 1PHOA 4RL9A 1MM4A 3A2SX 3VZUX 2KZ7B 4B61A 4AYNA 1HXXA 2FGQX 5JDPA 4N58A 3VZTX 4BUMX 3WI4A 3AA6A 3POXA 1BXWA 4C69X 2ZFGA 3T0SA 1HXUA 1ZHTA 2Y0KA 1IZNA 5DL6A 2KC0A 3T20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRA A;  2ERV A;  3C5O A;  4PUX A;  1P4T A;  1MM5 A;  1QJP A;  3GP6 A;  2K0L A;  1THQ A;  2LHF A;  3QRC A;  2N2M A;  2M07 A;  2MHL A;  2M06 A;  2X27 X;  1G90 A;  1Q9G A;  4RLC A;  2F1V A;  2F1T A;  1ORM A;  2GE4 A;  1MM4 A;  1QJ9 A;  3G7G A;  1QJ8 A;  1BXW A;  2MNH A;  1Q9F A;  2N2L A;  2JMM A; 
#chains in the Genus database with same CATH topology
 2Y0L A;  2QTK A;  3C5O A;  5FVN A;  4O3Z A;  1MPF A;  4O49 A;  3PGR A;  2Y7S A;  3LK3 A;  4FMS A;  3SY7 A;  1P4T A;  2KXP B;  4JFB A;  4LSI A;  4O4X A;  2KDY A;  2POR A;  2LFU A;  3PQS A;  5IYU A;  1OPF A;  2Y0H A;  3BS0 A;  2J4U P;  2WJQ A;  3EMN X;  4LSH A;  1H6S 1;  2LHF A;  4FSP A;  3QRC A;  4FOZ A;  4FT6 A;  3AA7 A;  5DL5 A;  3TZG A;  4AKM A;  4G75 A;  2JQY A;  2M07 A;  4AYI D;  4Z3T A;  2IWV A;  3AAE B;  3PF1 A;  4RLC A;  3LK2 B;  2F1T A;  2W80 C;  2YNK A;  3POQ A;  4FQE A;  3JTY A;  4PJ0 O;  3PQU A;  4RJX A;  3UU2 A;  2XE2 A;  5E79 O;  2XTR A;  3DWO X;  4FZL A;  4JCH A;  4FSO A;  2MNH A;  3VE1 A;  4FRT A;  4GCP A;  4U9C A;  3WI5 A;  3PGU A;  3DA3 A;  2JMM A;  5DL7 A;  5KAF O;  5ADX K;  4LSE A;  3AA1 A;  4XNL A;  4K3C A;  4E1S A;  1GFP A;  4N74 A;  2W81 C;  4FZN A;  1GFQ A;  2ODJ A;  3POR A;  4K3B A;  5PRN A;  4O3X B;  3VE2 A;  3AA0 B;  5AFU L;  3AAE A;  1BH3 A;  1QJP A;  5G39 A;  5GTH O;  2R4P A;  3LK2 A;  3GP6 A;  3NJT A;  3AAA A;  4QQ1 A;  5EE2 A;  5B5E O;  2R8A A;  3POU A;  4RLB A;  3FYX A;  1OSM A;  2N2M A;  2PRN A;  2KZ7 A;  4XNK A;  5G26 A;  4KR4 A;  2MHL A;  2X27 X;  3HOE A;  1GFO A;  2XTQ A;  1G90 A;  3JCU O;  1GFM A;  1Q9G A;  3VZW X;  2F1V A;  1ORM A;  2GE4 A;  3KVD D;  2O4V A;  4O3W A;  4AZL A;  4C4V A;  2FGR A;  4N75 A;  1ZHX A;  4GCS A;  5H2F O;  4AKR B;  3VY9 X;  5DL8 A;  4FES A;  7PRN A;  1ZHY A;  2R89 A;  4KR8 A;  3UAQ A;  4C00 A;  3LK4 1;  2XE5 A;  3K19 A;  3A0H O;  3LK4 2;  2YPV A;  2R88 A;  4FZM A;  2WVP A;  5KAI O;  2ERV A;  2KXP A;  4FUV A;  4G76 A;  2XG6 A;  4O3Y A;  2ZLD A;  4PUX A;  1IZN B;  4AYD C;  3HOL A;  2F1C X;  4FRX A;  5D5D A;  3HWB A;  2OMF A;  3SYB A;  1MM5 A;  4AFK A;  4E1T A;  3O0E A;  2IWW A;  4D5U A;  3LK3 B;  1ZHW A;  2K0L A;  4N59 A;  5T5F A;  1THQ A;  3DA4 A;  2R4L A;  2Y2X A;  6PRN A;  5B66 O;  1ZHZ A;  3DWN A;  4AYM C;  2XE3 A;  4LSF A;  3SZD A;  4GF4 A;  3SZV A;  3AA7 B;  3NSG A;  3KZI O;  4GCQ A;  4GHB A;  3V8U A;  2XE1 A;  1QJ9 A;  1T16 A;  2WJR A;  4KRA A;  3G7G A;  1QJ8 A;  1GFN A;  2AXT O;  2XMX A;  4PR7 A;  4RJW A;  5GTI O;  3SYS A;  3UPG A;  1Q9F A;  3PGS A;  2K4T A;  2N2L A;  1S5L O;  4D64 A;  1YS5 A;  3QRA A;  1E54 A;  5TIS O;  3AA6 B;  3T24 A;  3AA0 A;  4O4U A;  5ADX L;  1PRN A;  3HW9 A;  4D65 A;  5AFU K;  4IL6 O;  4CTD A;  1BT9 A;  4UB8 O;  1T1L A;  4F4B A;  4AYE C;  3AA1 B;  1HXT A;  4AUI A;  3BRY A;  3WU2 O;  8PRN A;  3RBH A;  5GV0 A;  3PRN A;  3VY8 X;  3A0B O;  2M06 A;  3BRZ A;  3DZM A;  4UB6 O;  3SY9 A;  3AAA B;  4AKR A;  2J1N A;  1PHO A;  4RL9 A;  1MM4 A;  3A2S X;  3VZU X;  2KZ7 B;  4B61 A;  4AYN A;  1HXX A;  5G3A A;  2R4N A;  2FGQ X;  5JDP A;  4N58 A;  3VZT X;  4BUM X;  3WI4 A;  3AA6 A;  4C4V B;  3POX A;  1BXW A;  4C69 X;  5G38 A;  2ZFG A;  3T0S A;  1HXU A;  1ZHT A;  2Y0K A;  1IZN A;  2X9K A;  2KC0 A;  5DL6 A;  2R4O A;  3T20 A; 
#chains in the Genus database with same CATH homology
 2Y0L A;  2QTK A;  3C5O A;  5FVN A;  4O3Z A;  1MPF A;  4O49 A;  3SY7 A;  2Y7S A;  3LK3 A;  4FMS A;  1P4T A;  2KXP B;  4JFB A;  4LSI A;  4O4X A;  2KDY A;  2POR A;  2LFU A;  3PQS A;  5IYU A;  1OPF A;  2Y0H A;  2J4U P;  3EMN X;  4LSH A;  1H6S 1;  2LHF A;  4FSP A;  3QRC A;  4FOZ A;  4FT6 A;  3AA7 A;  5DL5 A;  4Z3T A;  4AKM A;  4G75 A;  2M07 A;  4AYI D;  3AAE B;  4RLC A;  3LK2 B;  2F1T A;  2W80 C;  2YNK A;  3POQ A;  3JTY A;  3PQU A;  4RJX A;  3UU2 A;  2XE2 A;  2XTR A;  4JCH A;  4FZL A;  4FSO A;  2MNH A;  3VE1 A;  4FRT A;  4GCP A;  4U9C A;  3WI5 A;  3DA3 A;  2JMM A;  5DL7 A;  5ADX K;  4LSE A;  3AA1 A;  4XNL A;  4E1S A;  1GFP A;  2W81 C;  4FZN A;  1GFQ A;  2ODJ A;  3POR A;  5PRN A;  4O3X B;  3VE2 A;  3AA0 B;  5AFU L;  3AAE A;  1BH3 A;  1QJP A;  3LK2 A;  3GP6 A;  4QQ1 A;  3AAA A;  5EE2 A;  4RLB A;  3POU A;  5G26 A;  3FYX A;  1OSM A;  2N2M A;  2PRN A;  2KZ7 A;  4XNK A;  4AYE C;  4KR4 A;  2MHL A;  2X27 X;  3HOE A;  1GFO A;  2XTQ A;  1G90 A;  3VZW X;  1GFM A;  1Q9G A;  2F1V A;  1ORM A;  2GE4 A;  3KVD D;  2O4V A;  4O3W A;  4AZL A;  2FGR A;  1ZHX A;  4GCS A;  4AKR B;  3VY9 X;  5DL8 A;  4FES A;  7PRN A;  1ZHY A;  4KR8 A;  3UAQ A;  3LK4 1;  2XE5 A;  3K19 A;  3LK4 2;  2YPV A;  4FZM A;  3TZG A;  2ERV A;  2KXP A;  4FUV A;  4G76 A;  2XG6 A;  4O3Y A;  2ZLD A;  4PUX A;  1IZN B;  4AYD C;  3HOL A;  4FRX A;  5D5D A;  3HWB A;  2OMF A;  3SYB A;  1MM5 A;  4AFK A;  4E1T A;  3O0E A;  4D5U A;  3LK3 B;  1ZHW A;  2K0L A;  4N59 A;  5T5F A;  1THQ A;  3DA4 A;  2Y2X A;  6PRN A;  1ZHZ A;  4AYM C;  2XE3 A;  4LSF A;  3SZD A;  4GF4 A;  3SZV A;  3AA7 B;  3NSG A;  4GCQ A;  4GHB A;  3V8U A;  2XE1 A;  1QJ9 A;  4KRA A;  3G7G A;  1QJ8 A;  1GFN A;  2XMX A;  4RJW A;  3SYS A;  3UPG A;  1Q9F A;  2N2L A;  2K4T A;  4D64 A;  1YS5 A;  3QRA A;  1E54 A;  3AA6 B;  3T24 A;  3AA0 A;  4O4U A;  5ADX L;  1PRN A;  3HW9 A;  4D65 A;  5AFU K;  1BT9 A;  4F4B A;  3AA1 B;  1HXT A;  4AUI A;  8PRN A;  3RBH A;  5GV0 A;  3PRN A;  3VY8 X;  2M06 A;  3SY9 A;  3AAA B;  4AKR A;  2J1N A;  1PHO A;  4RL9 A;  1MM4 A;  3A2S X;  3VZU X;  2KZ7 B;  4B61 A;  4AYN A;  1HXX A;  2FGQ X;  5JDP A;  4N58 A;  3VZT X;  4BUM X;  3WI4 A;  3AA6 A;  3POX A;  1BXW A;  4C69 X;  2ZFG A;  3T0S A;  1HXU A;  1ZHT A;  2Y0K A;  1IZN A;  5DL6 A;  2KC0 A;  3T20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...