1QJ9A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
b'ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The structure of the outer membrane protein OmpX from Escherichia coli reveals possible mechanisms of virulence.
pubmed rcsb
source organism Escherichia coli
molecule tags Integral membrane protein
total genus 39
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj9A00
1P4TA 2N2MA 2LHFA 1THQA 3QRCA 1QJPA 2F1VA 1MM4A 2MNHA 2MHLA 1Q9FA 2M07A 2X27X 1QJ8A 1Q9GA 2K0LA 3GP6A 1BXWA 2M06A 1ORMA 2JMMA 1QJ9A 2N2LA 3G7GA 1G90A 2F1TA 3QRAA 2GE4A 2ERVA 4PUXA 3C5OA 4RLCA 1MM5A
chains in the Genus database with same CATH superfamily
2N2MA 4GF4A 3DWNA 4O3ZA 3AA0B 1QJPA 3AA1B 4QQ1A 3WU2O 4K3CA 5JDPA 4D64A 3A2SX 4AZLA 2KC0A 1PHOA 2M07A 1OSMA 3LK41 2YNKA 4N58A 1MPFA 2R89A 4PR7A 5D5DA 3AA6A 3DZMA 3PRNA 3AAEA 2Y0HA 3EMNX 2W80C 2KZ7A 3SYBA 3SYSA 1HXTA 2PRNA 2WVPA 3POXA 2OMFA 1GFQA 4K3BA 2IWVA 4RLBA 3UPGA 3LK2B 2R88A 3JCUO 3T24A 4AYDC 4C4VB 4O49A 4AKRA 2O4VA 4RL9A 5DL6A 3AAAA 3DA4A 4F4BA 5TISO 2GE4A 2ERVA 4XNKA 4B61A 3AA0A 3C5OA 1OPFA 3AA1A 2R4OA 3PF1A 5G26A 3FYXA 2IWWA 4FZNA 4FSPA 1P4TA 3RBHA 4LSHA 1H6S1 2Y0KA 3AAAB 4N59A 4GCQA 2XMXA 5AFUK 3AA7B 2XE1A 3KVDD 2J1NA 4N75A 3SY7A 4GCPA 2YPVA 1QJ8A 3HWBA 1Q9GA 4JCHA 4O4XA 3T0SA 3HOEA 2K0LA 4G75A 4KR8A 3GP6A 3VZUX 1IZNB 3WI5A 4FZLA 1GFPA 2ODJA 3SY9A 5ADXK 1GFNA 2W81C 4AFKA 1GFMA 3LK2A 2FGRA 3WI4A 5T5FA 4U9CA 2XE5A 4AYMC 4C4VA 3PORA 1ORMA 2JMMA 1QJ9A 4IL6O 2R4NA 4AYEC 4Z3TA 2R4PA 3UAQA 3O0EA 5H2FO 2KXPB 5IYUA 1T16A 3HOLA 3SZDA 5DL5A 4FUVA 5G38A 3POQA 2KDYA 2Y2XA 2AXTO 4LSFA 4PUXA 3V8UA 3A0BO 1T1LA 4FZMA 3VY9X 1MM5A 3AA7A 5G3AA 2LHFA 3QRCA 4XNLA 4D65A 2F1VA 4RJWA 4O4UA 2X9KA 2MNHA 1IZNA 4FRTA 4C00A 5B5EO 2ZLDA 3PQSA 7PRNA 2X27X 4UB8O 2XE2A 5AFUL 5GV0A 1HXUA 1S5LO 4N74A 3PGRA 3BRZA 4AYID 3VE1A 4AYNA 3SZVA 1BXWA 3VE2A 1ZHZA 4FRXA 2LFUA 2KXPA 2M06A 4GHBA 4LSEA 5GTIO 3KZIO 3VY8X 4FMSA 5ADXL 5FVNA 2N2LA 2F1CX 2ZFGA 6PRNA 4E1TA 1PRNA 2JQYA 4KRAA 5EE2A 1GFOA 3G7GA 2XTQA 5DL7A 3JTYA 4C69X 3VZTX 3BRYA 2R8AA 3PGSA 4KR4A 5KAIO 4CTDA 4RJXA 1ZHXA 2WJQA 4O3XB 5DL8A 4RLCA 3VZWX 3LK3A 8PRNA 1YS5A 1THQA 1BH3A 4LSIA 5B66O 2R4LA 4UB6O 4FQEA 1MM4A 4O3YA 5KAFO 2MHLA 2Y0LA 2XTRA 1HXXA 1Q9FA 3LK3B 3A0HO 2QTKA 2K4TA 3T20A 5PRNA 4FESA 2FGQX 3UU2A 5E79O 4O3WA 1ZHYA 2J4UP 4E1SA 4BUMX 1ZHWA 3LK42 3POUA 1ZHTA 2PORA 3AA6B 2WJRA 4GCSA 4G76A 3AAEB 3HW9A 5GTHO 2KZ7B 3TZGA 3DA3A 3PQUA 1BT9A 3DWOX 4FOZA 4AUIA 4D5UA 4JFBA 3NJTA 4AKMA 1G90A 2F1TA 1E54A 2XG6A 3QRAA 4FSOA 2Y7SA 4FT6A 5G39A 3NSGA 3BS0A 4PJ0O 3PGUA 3K19A 4AKRB 2XE3A
chains in the Genus database with same CATH topology
2N2MA 4GF4A 4O3ZA 3AA0B 1QJPA 3AA1B 4QQ1A 5JDPA 4D64A 3A2SX 4AZLA 2KC0A 1PHOA 2M07A 1OSMA 3LK41 2YNKA 4N58A 1MPFA 5D5DA 3AA6A 3PRNA 3AAEA 2Y0HA 3EMNX 2W80C 2KZ7A 3SYBA 3SYSA 1HXTA 2PRNA 3POXA 2OMFA 1GFQA 4RLBA 3UPGA 3LK2B 3T24A 4AYDC 4O49A 4AKRA 2O4VA 4RL9A 5DL6A 3AAAA 3DA4A 4F4BA 2GE4A 2ERVA 4XNKA 4B61A 3AA0A 3C5OA 1OPFA 3AA1A 5G26A 3FYXA 4FZNA 4FSPA 1P4TA 3RBHA 4LSHA 1H6S1 2Y0KA 3AAAB 4N59A 4GCQA 2XMXA 5AFUK 3AA7B 2XE1A 3KVDD 2J1NA 3SY7A 4GCPA 2YPVA 1QJ8A 3HWBA 1Q9GA 4JCHA 4O4XA 3T0SA 3HOEA 2K0LA 4G75A 4KR8A 3GP6A 3VZUX 1IZNB 3WI5A 4FZLA 1GFPA 2ODJA 3SY9A 5ADXK 1GFNA 2W81C 4AFKA 1GFMA 3LK2A 2FGRA 3WI4A 5T5FA 4U9CA 2XE5A 4AYMC 3PORA 1ORMA 2JMMA 1QJ9A 4AYEC 4Z3TA 3UAQA 3O0EA 2KXPB 5IYUA 3HOLA 3SZDA 5DL5A 4FUVA 3POQA 2KDYA 2Y2XA 4PUXA 4LSFA 3V8UA 4FZMA 3VY9X 1MM5A 3AA7A 2LHFA 3QRCA 4XNLA 4D65A 2F1VA 4RJWA 4O4UA 2MNHA 1IZNA 4FRTA 2ZLDA 3PQSA 7PRNA 2X27X 5AFUL 2XE2A 5GV0A 1HXUA 4AYID 3VE1A 4AYNA 3SZVA 1BXWA 3VE2A 1ZHZA 4FRXA 2LFUA 2KXPA 2M06A 4GHBA 4LSEA 3VY8X 4FMSA 5ADXL 5FVNA 2N2LA 2ZFGA 6PRNA 4E1TA 1PRNA 4KRAA 5EE2A 1GFOA 3G7GA 2XTQA 5DL7A 3JTYA 4C69X 3VZTX 4KR4A 4RJXA 1ZHXA 4O3XB 5DL8A 4RLCA 3VZWX 3LK3A 8PRNA 1YS5A 1THQA 1BH3A 4LSIA 1MM4A 4O3YA 2MHLA 2Y0LA 2XTRA 1HXXA 1Q9FA 3LK3B 2QTKA 2K4TA 3T20A 5PRNA 4FESA 2FGQX 3UU2A 4O3WA 1ZHYA 2J4UP 4E1SA 4BUMX 1ZHWA 3LK42 3POUA 1ZHTA 2PORA 3AA6B 4GCSA 4G76A 3AAEB 3HW9A 2KZ7B 3TZGA 3DA3A 3PQUA 1BT9A 4FOZA 4AUIA 4D5UA 4JFBA 4AKMA 1G90A 2F1TA 1E54A 2XG6A 3QRAA 4FSOA 2Y7SA 4FT6A 3NSGA 3K19A 4AKRB 2XE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4T A;  2N2M A;  2LHF A;  1THQ A;  3QRC A;  1QJP A;  2F1V A;  1MM4 A;  2MNH A;  2MHL A;  1Q9F A;  2M07 A;  2X27 X;  1QJ8 A;  1Q9G A;  2K0L A;  3GP6 A;  1BXW A;  2M06 A;  1ORM A;  2JMM A;  1QJ9 A;  2N2L A;  3G7G A;  1G90 A;  2F1T A;  3QRA A;  2GE4 A;  2ERV A;  4PUX A;  3C5O A;  4RLC A;  1MM5 A; 
#chains in the Genus database with same CATH topology
 2N2M A;  4GF4 A;  3DWN A;  4O3Z A;  3AA0 B;  1QJP A;  3AA1 B;  4QQ1 A;  3WU2 O;  4K3C A;  5JDP A;  4D64 A;  3A2S X;  4AZL A;  2KC0 A;  1PHO A;  2M07 A;  1OSM A;  3LK4 1;  2YNK A;  4N58 A;  1MPF A;  2R89 A;  4PR7 A;  5D5D A;  3AA6 A;  3DZM A;  3PRN A;  3AAE A;  2Y0H A;  3EMN X;  2W80 C;  2KZ7 A;  3SYB A;  3SYS A;  1HXT A;  2PRN A;  2WVP A;  3POX A;  2OMF A;  1GFQ A;  4K3B A;  2IWV A;  4RLB A;  3UPG A;  3LK2 B;  2R88 A;  3JCU O;  3T24 A;  4AYD C;  4C4V B;  4O49 A;  4AKR A;  2O4V A;  4RL9 A;  5DL6 A;  3AAA A;  3DA4 A;  4F4B A;  5TIS O;  2GE4 A;  2ERV A;  4XNK A;  4B61 A;  3AA0 A;  3C5O A;  1OPF A;  3AA1 A;  2R4O A;  3PF1 A;  5G26 A;  3FYX A;  2IWW A;  4FZN A;  4FSP A;  1P4T A;  3RBH A;  4LSH A;  1H6S 1;  2Y0K A;  3AAA B;  4N59 A;  4GCQ A;  2XMX A;  5AFU K;  3AA7 B;  2XE1 A;  3KVD D;  2J1N A;  4N75 A;  3SY7 A;  4GCP A;  2YPV A;  1QJ8 A;  3HWB A;  1Q9G A;  4JCH A;  4O4X A;  3T0S A;  3HOE A;  2K0L A;  4G75 A;  4KR8 A;  3GP6 A;  3VZU X;  1IZN B;  3WI5 A;  4FZL A;  1GFP A;  2ODJ A;  3SY9 A;  5ADX K;  1GFN A;  2W81 C;  4AFK A;  1GFM A;  3LK2 A;  2FGR A;  3WI4 A;  5T5F A;  4U9C A;  2XE5 A;  4AYM C;  4C4V A;  3POR A;  1ORM A;  2JMM A;  1QJ9 A;  4IL6 O;  2R4N A;  4AYE C;  4Z3T A;  2R4P A;  3UAQ A;  3O0E A;  5H2F O;  2KXP B;  5IYU A;  1T16 A;  3HOL A;  3SZD A;  5DL5 A;  4FUV A;  5G38 A;  3POQ A;  2KDY A;  2Y2X A;  2AXT O;  4LSF A;  4PUX A;  3V8U A;  3A0B O;  1T1L A;  4FZM A;  3VY9 X;  1MM5 A;  3AA7 A;  5G3A A;  2LHF A;  3QRC A;  4XNL A;  4D65 A;  2F1V A;  4RJW A;  4O4U A;  2X9K A;  2MNH A;  1IZN A;  4FRT A;  4C00 A;  5B5E O;  2ZLD A;  3PQS A;  7PRN A;  2X27 X;  4UB8 O;  2XE2 A;  5AFU L;  5GV0 A;  1HXU A;  1S5L O;  4N74 A;  3PGR A;  3BRZ A;  4AYI D;  3VE1 A;  4AYN A;  3SZV A;  1BXW A;  3VE2 A;  1ZHZ A;  4FRX A;  2LFU A;  2KXP A;  2M06 A;  4GHB A;  4LSE A;  5GTI O;  3KZI O;  3VY8 X;  4FMS A;  5ADX L;  5FVN A;  2N2L A;  2F1C X;  2ZFG A;  6PRN A;  4E1T A;  1PRN A;  2JQY A;  4KRA A;  5EE2 A;  1GFO A;  3G7G A;  2XTQ A;  5DL7 A;  3JTY A;  4C69 X;  3VZT X;  3BRY A;  2R8A A;  3PGS A;  4KR4 A;  5KAI O;  4CTD A;  4RJX A;  1ZHX A;  2WJQ A;  4O3X B;  5DL8 A;  4RLC A;  3VZW X;  3LK3 A;  8PRN A;  1YS5 A;  1THQ A;  1BH3 A;  4LSI A;  5B66 O;  2R4L A;  4UB6 O;  4FQE A;  1MM4 A;  4O3Y A;  5KAF O;  2MHL A;  2Y0L A;  2XTR A;  1HXX A;  1Q9F A;  3LK3 B;  3A0H O;  2QTK A;  2K4T A;  3T20 A;  5PRN A;  4FES A;  2FGQ X;  3UU2 A;  5E79 O;  4O3W A;  1ZHY A;  2J4U P;  4E1S A;  4BUM X;  1ZHW A;  3LK4 2;  3POU A;  1ZHT A;  2POR A;  3AA6 B;  2WJR A;  4GCS A;  4G76 A;  3AAE B;  3HW9 A;  5GTH O;  2KZ7 B;  3TZG A;  3DA3 A;  3PQU A;  1BT9 A;  3DWO X;  4FOZ A;  4AUI A;  4D5U A;  4JFB A;  3NJT A;  4AKM A;  1G90 A;  2F1T A;  1E54 A;  2XG6 A;  3QRA A;  4FSO A;  2Y7S A;  4FT6 A;  5G39 A;  3NSG A;  3BS0 A;  4PJ0 O;  3PGU A;  3K19 A;  4AKR B;  2XE3 A; 
#chains in the Genus database with same CATH homology
 2N2M A;  4GF4 A;  4O3Z A;  3AA0 B;  1QJP A;  3AA1 B;  4QQ1 A;  5JDP A;  4D64 A;  3A2S X;  4AZL A;  2KC0 A;  1PHO A;  2M07 A;  1OSM A;  3LK4 1;  2YNK A;  4N58 A;  1MPF A;  5D5D A;  3AA6 A;  3PRN A;  3AAE A;  2Y0H A;  3EMN X;  2W80 C;  2KZ7 A;  3SYB A;  3SYS A;  1HXT A;  2PRN A;  3POX A;  2OMF A;  1GFQ A;  4RLB A;  3UPG A;  3LK2 B;  3T24 A;  4AYD C;  4O49 A;  4AKR A;  2O4V A;  4RL9 A;  5DL6 A;  3AAA A;  3DA4 A;  4F4B A;  2GE4 A;  2ERV A;  4XNK A;  4B61 A;  3AA0 A;  3C5O A;  1OPF A;  3AA1 A;  5G26 A;  3FYX A;  4FZN A;  4FSP A;  1P4T A;  3RBH A;  4LSH A;  1H6S 1;  2Y0K A;  3AAA B;  4N59 A;  4GCQ A;  2XMX A;  5AFU K;  3AA7 B;  2XE1 A;  3KVD D;  2J1N A;  3SY7 A;  4GCP A;  2YPV A;  1QJ8 A;  3HWB A;  1Q9G A;  4JCH A;  4O4X A;  3T0S A;  3HOE A;  2K0L A;  4G75 A;  4KR8 A;  3GP6 A;  3VZU X;  1IZN B;  3WI5 A;  4FZL A;  1GFP A;  2ODJ A;  3SY9 A;  5ADX K;  1GFN A;  2W81 C;  4AFK A;  1GFM A;  3LK2 A;  2FGR A;  3WI4 A;  5T5F A;  4U9C A;  2XE5 A;  4AYM C;  3POR A;  1ORM A;  2JMM A;  1QJ9 A;  4AYE C;  4Z3T A;  3UAQ A;  3O0E A;  2KXP B;  5IYU A;  3HOL A;  3SZD A;  5DL5 A;  4FUV A;  3POQ A;  2KDY A;  2Y2X A;  4PUX A;  4LSF A;  3V8U A;  4FZM A;  3VY9 X;  1MM5 A;  3AA7 A;  2LHF A;  3QRC A;  4XNL A;  4D65 A;  2F1V A;  4RJW A;  4O4U A;  2MNH A;  1IZN A;  4FRT A;  2ZLD A;  3PQS A;  7PRN A;  2X27 X;  5AFU L;  2XE2 A;  5GV0 A;  1HXU A;  4AYI D;  3VE1 A;  4AYN A;  3SZV A;  1BXW A;  3VE2 A;  1ZHZ A;  4FRX A;  2LFU A;  2KXP A;  2M06 A;  4GHB A;  4LSE A;  3VY8 X;  4FMS A;  5ADX L;  5FVN A;  2N2L A;  2ZFG A;  6PRN A;  4E1T A;  1PRN A;  4KRA A;  5EE2 A;  1GFO A;  3G7G A;  2XTQ A;  5DL7 A;  3JTY A;  4C69 X;  3VZT X;  4KR4 A;  4RJX A;  1ZHX A;  4O3X B;  5DL8 A;  4RLC A;  3VZW X;  3LK3 A;  8PRN A;  1YS5 A;  1THQ A;  1BH3 A;  4LSI A;  1MM4 A;  4O3Y A;  2MHL A;  2Y0L A;  2XTR A;  1HXX A;  1Q9F A;  3LK3 B;  2QTK A;  2K4T A;  3T20 A;  5PRN A;  4FES A;  2FGQ X;  3UU2 A;  4O3W A;  1ZHY A;  2J4U P;  4E1S A;  4BUM X;  1ZHW A;  3LK4 2;  3POU A;  1ZHT A;  2POR A;  3AA6 B;  4GCS A;  4G76 A;  3AAE B;  3HW9 A;  2KZ7 B;  3TZG A;  3DA3 A;  3PQU A;  1BT9 A;  4FOZ A;  4AUI A;  4D5U A;  4JFB A;  4AKM A;  1G90 A;  2F1T A;  1E54 A;  2XG6 A;  3QRA A;  4FSO A;  2Y7S A;  4FT6 A;  3NSG A;  3K19 A;  4AKR B;  2XE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...