1QJ9A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the outer membrane protein OmpX from Escherichia coli reveals possible mechanisms of virulence.
pubmed rcsb
source organism Escherichia coli
molecule tags Integral membrane protein
molecule keywords OUTER MEMBRANE PROTEIN X
total genus 39
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj9A00
2N2LA 3G7GA 3GP6A 2JMMA 4PUXA 1Q9GA 2F1TA 2F1VA 4RLCA 2LHFA 2GE4A 2M07A 1QJ8A 3QRAA 1G90A 2MNHA 2N2MA 1BXWA 2ERVA 2M06A 1P4TA 2MHLA 1Q9FA 1MM4A 2K0LA 3C5OA 1ORMA 1QJ9A 1THQA 1QJPA 1MM5A 2X27X 3QRCA
chains in the Genus database with same CATH superfamily
1HXUA 3VY8X 1ZHZA 7PRNA 3UAQA 3PGUA 4IL6O 2XE1A 2Y0KA 2Y0LA 3AAAA 3SZDA 3DZMA 4PUXA 3LK41 2ZLDA 3FYXA 3HWBA 4G76A 4AKRA 1Q9GA 1OPFA 2XTQA 4FZLA 4K3CA 4JCHA 5T5FA 3SY7A 3PF1A 4F4BA 2OMFA 3LK3A 2W80C 4Z3TA 1BT9A 3HW9A 3WI4A 3VZWX 3BRYA 6PRNA 3AA1B 2X9KA 4N74A 1T16A 4FRXA 3TZGA 3VE1A 1ZHXA 3KZIO 4C4VA 1ZHWA 2Y7SA 3A2SX 2KC0A 3HOEA 3AA0B 3VE2A 4FT6A 1GFOA 3PQUA 4O4XA 2KZ7B 3LK42 4BUMX 4C69X 5DL6A 5JDPA 1GFQA 4FQEA 1MM4A 4O3XB 2R4OA 2K0LA 4FSPA 3SY9A 4D65A 3C5OA 4JFBA 4D5UA 3PQSA 2R4PA 8PRNA 2PRNA 1QJ9A 3K19A 3LK2A 1ZHYA 3AA6B 3PRNA 4GHBA 4O3ZA 2XMXA 2PORA 2ODJA 3A0HO 1HXTA 4N59A 4O3WA 5GV0A 3NSGA 3V8UA 5G39A 2JMMA 3AAEB 1ZHTA 3UU2A 4FOZA 4RL9A 4AYID 5ADXL 2AXTO 3RBHA 3AA6A 4GCSA 3AA1A 2YPVA 3SYBA 2LFUA 4AUIA 2R88A 5DL8A 4B61A 3T20A 4FESA 2LHFA 3UPGA 2R8AA 2GE4A 2WVPA 3QRAA 4AYDC 2Y0HA 3POUA 4XNKA 4AKMA 4N75A 2KZ7A 2F1CX 5GTHO 4RLBA 4FRTA 3O0EA 3PGRA 4D64A 3VY9X 5FVNA 5AFUL 4KR4A 2JQYA 4O4UA 3BRZA 1ORMA 4CTDA 2QTKA 2Y2XA 1IZNA 4PR7A 5PRNA 1E54A 4FZMA 4O3YA 4GCQA 3G7GA 3A0BO 3GP6A 3AAEA 5EE2A 3SZVA 1MPFA 2O4VA 3DWOX 4LSFA 1GFMA 3JTYA 2KXPA 4N58A 4PJ0O 2XE2A 4AYEC 4RJWA 2XE3A 4E1SA 3HOLA 5TISO 3NJTA 2FGRA 4AYMC 3PGSA 2XTRA 1QJ8A 3DA4A 2YNKA 3DA3A 5KAIO 5DL5A 4FMSA 5IYUA 3DWNA 1BXWA 1T1LA 4O49A 2ERVA 1P4TA 4FSOA 2R89A 4C4VB 4KRAA 1Q9FA 5GTIO 5G26A 5H2FO 1GFPA 3BS0A 1YS5A 3VZTX 4C00A 1HXXA 2R4LA 1THQA 5B66O 2J1NA 5DL7A 4AKRB 3POXA 4RJXA 5G3AA 5AFUK 2IWWA 2N2LA 2WJRA 3AAAB 4GCPA 3WU2O 4KR8A 3AA0A 5E79O 3SYSA 4LSHA 2F1TA 3VZUX 2F1VA 3KVDD 1GFNA 2KDYA 3WI5A 4RLCA 1PRNA 2XE5A 2XG6A 2ZFGA 3JCUO 2M07A 3LK3B 3PORA 3T24A 3EMNX 2J4UP 2MNHA 1G90A 5KAFO 4FZNA 1BH3A 4K3BA 4U9CA 4UB8O 1OSMA 2R4NA 2N2MA 5ADXK 4AFKA 2FGQX 4QQ1A 1QJPA 3AA7B 3AA7A 5D5DA 4AZLA 4UB6O 2M06A 3T0SA 3POQA 4LSEA 5B5EO 2MHLA 4G75A 4LSIA 1IZNB 4E1TA 4FUVA 4GF4A 2X27X 2IWVA 3LK2B 1PHOA 4AYNA 4XNLA 1S5LO 5G38A 2WJQA 1H6S1 2K4TA 2W81C 1MM5A 2KXPB 3QRCA
chains in the Genus database with same CATH topology
1HXUA 3VY8X 1ZHZA 7PRNA 3UAQA 2XE1A 2Y0KA 2Y0LA 3AAAA 3SZDA 4PUXA 4AKMA 3LK41 2ZLDA 3FYXA 3HWBA 4G76A 4AKRA 1Q9GA 1OPFA 2XTQA 4FZLA 4JCHA 5T5FA 3SY7A 4F4BA 2OMFA 3LK3A 2W80C 4Z3TA 1BT9A 3HW9A 3WI4A 3VZWX 6PRNA 3AA1B 4FRXA 3TZGA 3VE1A 1ZHXA 1ZHWA 2Y7SA 3A2SX 2KC0A 3HOEA 3AA0B 3VE2A 4FT6A 1GFOA 3PQUA 4O4XA 2KZ7B 3LK42 4BUMX 4C69X 5DL6A 5JDPA 1GFQA 1MM4A 4O3XB 2K0LA 4FSPA 3SY9A 4D65A 3C5OA 4JFBA 4D5UA 3PQSA 8PRNA 2PRNA 1QJ9A 3K19A 3LK2A 1ZHYA 3AA6B 3PRNA 4GHBA 4O3ZA 2XMXA 2PORA 2ODJA 5GV0A 1HXTA 4N59A 4O3WA 3NSGA 3V8UA 2JMMA 3AAEB 1ZHTA 3UU2A 4FOZA 4RL9A 4AYID 5ADXL 3RBHA 3AA6A 4GCSA 3AA1A 2YPVA 3SYBA 2LFUA 4AUIA 5DL8A 3T20A 4B61A 3UPGA 4FESA 2LHFA 2GE4A 3QRAA 4AYDC 2Y0HA 3POUA 4XNKA 2KZ7A 4RLBA 4FRTA 3O0EA 4D64A 3VY9X 5FVNA 5AFUL 4KR4A 4O4UA 1ORMA 2Y2XA 2QTKA 1IZNA 5PRNA 1E54A 4FZMA 4O3YA 4GCQA 3G7GA 3GP6A 3AAEA 5EE2A 3SZVA 1MPFA 2O4VA 4LSFA 1GFMA 3JTYA 2KXPA 4N58A 2XE2A 4AYEC 4RJWA 2XE3A 4E1SA 3HOLA 2FGRA 4AYMC 2XTRA 1QJ8A 3DA4A 2YNKA 3DA3A 5DL5A 4FMSA 5IYUA 1BXWA 4O49A 2ERVA 1P4TA 4FSOA 4KRAA 1Q9FA 5G26A 1GFPA 1YS5A 3VZTX 1HXXA 1THQA 2J1NA 5DL7A 4AKRB 3POXA 4RJXA 5AFUK 2N2LA 3AAAB 4GCPA 4KR8A 3AA0A 3SYSA 4LSHA 2F1TA 3VZUX 2F1VA 3KVDD 1GFNA 2KDYA 3WI5A 4RLCA 1PRNA 2XE5A 2XG6A 2ZFGA 3LK3B 2M07A 3PORA 3T24A 3EMNX 2J4UP 2MNHA 1G90A 4FZNA 1BH3A 4U9CA 5ADXK 1OSMA 2N2MA 4AFKA 2FGQX 4QQ1A 1QJPA 3AA7B 3AA7A 5D5DA 4AZLA 3T0SA 2M06A 3POQA 4LSEA 2MHLA 4G75A 4LSIA 1IZNB 4E1TA 4FUVA 4GF4A 2X27X 3LK2B 1PHOA 4AYNA 4XNLA 1H6S1 2K4TA 2W81C 1MM5A 2KXPB 3QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2L A;  3G7G A;  3GP6 A;  2JMM A;  4PUX A;  1Q9G A;  2F1T A;  2F1V A;  4RLC A;  2LHF A;  2GE4 A;  2M07 A;  1QJ8 A;  3QRA A;  1G90 A;  2MNH A;  2N2M A;  1BXW A;  2ERV A;  2M06 A;  1P4T A;  2MHL A;  1Q9F A;  1MM4 A;  2K0L A;  3C5O A;  1ORM A;  1QJ9 A;  1THQ A;  1QJP A;  1MM5 A;  2X27 X;  3QRC A; 
#chains in the Genus database with same CATH topology
 1HXU A;  3VY8 X;  1ZHZ A;  7PRN A;  3UAQ A;  3PGU A;  4IL6 O;  2XE1 A;  2Y0K A;  2Y0L A;  3AAA A;  3SZD A;  3DZM A;  4PUX A;  3LK4 1;  2ZLD A;  3FYX A;  3HWB A;  4G76 A;  4AKR A;  1Q9G A;  1OPF A;  2XTQ A;  4FZL A;  4K3C A;  4JCH A;  5T5F A;  3SY7 A;  3PF1 A;  4F4B A;  2OMF A;  3LK3 A;  2W80 C;  4Z3T A;  1BT9 A;  3HW9 A;  3WI4 A;  3VZW X;  3BRY A;  6PRN A;  3AA1 B;  2X9K A;  4N74 A;  1T16 A;  4FRX A;  3TZG A;  3VE1 A;  1ZHX A;  3KZI O;  4C4V A;  1ZHW A;  2Y7S A;  3A2S X;  2KC0 A;  3HOE A;  3AA0 B;  3VE2 A;  4FT6 A;  1GFO A;  3PQU A;  4O4X A;  2KZ7 B;  3LK4 2;  4BUM X;  4C69 X;  5DL6 A;  5JDP A;  1GFQ A;  4FQE A;  1MM4 A;  4O3X B;  2R4O A;  2K0L A;  4FSP A;  3SY9 A;  4D65 A;  3C5O A;  4JFB A;  4D5U A;  3PQS A;  2R4P A;  8PRN A;  2PRN A;  1QJ9 A;  3K19 A;  3LK2 A;  1ZHY A;  3AA6 B;  3PRN A;  4GHB A;  4O3Z A;  2XMX A;  2POR A;  2ODJ A;  3A0H O;  1HXT A;  4N59 A;  4O3W A;  5GV0 A;  3NSG A;  3V8U A;  5G39 A;  2JMM A;  3AAE B;  1ZHT A;  3UU2 A;  4FOZ A;  4RL9 A;  4AYI D;  5ADX L;  2AXT O;  3RBH A;  3AA6 A;  4GCS A;  3AA1 A;  2YPV A;  3SYB A;  2LFU A;  4AUI A;  2R88 A;  5DL8 A;  4B61 A;  3T20 A;  4FES A;  2LHF A;  3UPG A;  2R8A A;  2GE4 A;  2WVP A;  3QRA A;  4AYD C;  2Y0H A;  3POU A;  4XNK A;  4AKM A;  4N75 A;  2KZ7 A;  2F1C X;  5GTH O;  4RLB A;  4FRT A;  3O0E A;  3PGR A;  4D64 A;  3VY9 X;  5FVN A;  5AFU L;  4KR4 A;  2JQY A;  4O4U A;  3BRZ A;  1ORM A;  4CTD A;  2QTK A;  2Y2X A;  1IZN A;  4PR7 A;  5PRN A;  1E54 A;  4FZM A;  4O3Y A;  4GCQ A;  3G7G A;  3A0B O;  3GP6 A;  3AAE A;  5EE2 A;  3SZV A;  1MPF A;  2O4V A;  3DWO X;  4LSF A;  1GFM A;  3JTY A;  2KXP A;  4N58 A;  4PJ0 O;  2XE2 A;  4AYE C;  4RJW A;  2XE3 A;  4E1S A;  3HOL A;  5TIS O;  3NJT A;  2FGR A;  4AYM C;  3PGS A;  2XTR A;  1QJ8 A;  3DA4 A;  2YNK A;  3DA3 A;  5KAI O;  5DL5 A;  4FMS A;  5IYU A;  3DWN A;  1BXW A;  1T1L A;  4O49 A;  2ERV A;  1P4T A;  4FSO A;  2R89 A;  4C4V B;  4KRA A;  1Q9F A;  5GTI O;  5G26 A;  5H2F O;  1GFP A;  3BS0 A;  1YS5 A;  3VZT X;  4C00 A;  1HXX A;  2R4L A;  1THQ A;  5B66 O;  2J1N A;  5DL7 A;  4AKR B;  3POX A;  4RJX A;  5G3A A;  5AFU K;  2IWW A;  2N2L A;  2WJR A;  3AAA B;  4GCP A;  3WU2 O;  4KR8 A;  3AA0 A;  5E79 O;  3SYS A;  4LSH A;  2F1T A;  3VZU X;  2F1V A;  3KVD D;  1GFN A;  2KDY A;  3WI5 A;  4RLC A;  1PRN A;  2XE5 A;  2XG6 A;  2ZFG A;  3JCU O;  2M07 A;  3LK3 B;  3POR A;  3T24 A;  3EMN X;  2J4U P;  2MNH A;  1G90 A;  5KAF O;  4FZN A;  1BH3 A;  4K3B A;  4U9C A;  4UB8 O;  1OSM A;  2R4N A;  2N2M A;  5ADX K;  4AFK A;  2FGQ X;  4QQ1 A;  1QJP A;  3AA7 B;  3AA7 A;  5D5D A;  4AZL A;  4UB6 O;  2M06 A;  3T0S A;  3POQ A;  4LSE A;  5B5E O;  2MHL A;  4G75 A;  4LSI A;  1IZN B;  4E1T A;  4FUV A;  4GF4 A;  2X27 X;  2IWV A;  3LK2 B;  1PHO A;  4AYN A;  4XNL A;  1S5L O;  5G38 A;  2WJQ A;  1H6S 1;  2K4T A;  2W81 C;  1MM5 A;  2KXP B;  3QRC A; 
#chains in the Genus database with same CATH homology
 1HXU A;  3VY8 X;  1ZHZ A;  7PRN A;  3UAQ A;  2XE1 A;  2Y0K A;  2Y0L A;  3AAA A;  3SZD A;  4PUX A;  4AKM A;  3LK4 1;  2ZLD A;  3FYX A;  3HWB A;  4G76 A;  4AKR A;  1Q9G A;  1OPF A;  2XTQ A;  4FZL A;  4JCH A;  5T5F A;  3SY7 A;  4F4B A;  2OMF A;  3LK3 A;  2W80 C;  4Z3T A;  1BT9 A;  3HW9 A;  3WI4 A;  3VZW X;  6PRN A;  3AA1 B;  4FRX A;  3TZG A;  3VE1 A;  1ZHX A;  1ZHW A;  2Y7S A;  3A2S X;  2KC0 A;  3HOE A;  3AA0 B;  3VE2 A;  4FT6 A;  1GFO A;  3PQU A;  4O4X A;  2KZ7 B;  3LK4 2;  4BUM X;  4C69 X;  5DL6 A;  5JDP A;  1GFQ A;  1MM4 A;  4O3X B;  2K0L A;  4FSP A;  3SY9 A;  4D65 A;  3C5O A;  4JFB A;  4D5U A;  3PQS A;  8PRN A;  2PRN A;  1QJ9 A;  3K19 A;  3LK2 A;  1ZHY A;  3AA6 B;  3PRN A;  4GHB A;  4O3Z A;  2XMX A;  2POR A;  2ODJ A;  5GV0 A;  1HXT A;  4N59 A;  4O3W A;  3NSG A;  3V8U A;  2JMM A;  3AAE B;  1ZHT A;  3UU2 A;  4FOZ A;  4RL9 A;  4AYI D;  5ADX L;  3RBH A;  3AA6 A;  4GCS A;  3AA1 A;  2YPV A;  3SYB A;  2LFU A;  4AUI A;  5DL8 A;  3T20 A;  4B61 A;  3UPG A;  4FES A;  2LHF A;  2GE4 A;  3QRA A;  4AYD C;  2Y0H A;  3POU A;  4XNK A;  2KZ7 A;  4RLB A;  4FRT A;  3O0E A;  4D64 A;  3VY9 X;  5FVN A;  5AFU L;  4KR4 A;  4O4U A;  1ORM A;  2Y2X A;  2QTK A;  1IZN A;  5PRN A;  1E54 A;  4FZM A;  4O3Y A;  4GCQ A;  3G7G A;  3GP6 A;  3AAE A;  5EE2 A;  3SZV A;  1MPF A;  2O4V A;  4LSF A;  1GFM A;  3JTY A;  2KXP A;  4N58 A;  2XE2 A;  4AYE C;  4RJW A;  2XE3 A;  4E1S A;  3HOL A;  2FGR A;  4AYM C;  2XTR A;  1QJ8 A;  3DA4 A;  2YNK A;  3DA3 A;  5DL5 A;  4FMS A;  5IYU A;  1BXW A;  4O49 A;  2ERV A;  1P4T A;  4FSO A;  4KRA A;  1Q9F A;  5G26 A;  1GFP A;  1YS5 A;  3VZT X;  1HXX A;  1THQ A;  2J1N A;  5DL7 A;  4AKR B;  3POX A;  4RJX A;  5AFU K;  2N2L A;  3AAA B;  4GCP A;  4KR8 A;  3AA0 A;  3SYS A;  4LSH A;  2F1T A;  3VZU X;  2F1V A;  3KVD D;  1GFN A;  2KDY A;  3WI5 A;  4RLC A;  1PRN A;  2XE5 A;  2XG6 A;  2ZFG A;  3LK3 B;  2M07 A;  3POR A;  3T24 A;  3EMN X;  2J4U P;  2MNH A;  1G90 A;  4FZN A;  1BH3 A;  4U9C A;  5ADX K;  1OSM A;  2N2M A;  4AFK A;  2FGQ X;  4QQ1 A;  1QJP A;  3AA7 B;  3AA7 A;  5D5D A;  4AZL A;  3T0S A;  2M06 A;  3POQ A;  4LSE A;  2MHL A;  4G75 A;  4LSI A;  1IZN B;  4E1T A;  4FUV A;  4GF4 A;  2X27 X;  3LK2 B;  1PHO A;  4AYN A;  4XNL A;  1H6S 1;  2K4T A;  2W81 C;  1MM5 A;  2KXP B;  3QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...