1QJ9A

Crystal structure of the outer membrane protein ompx from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integral membrane protein
molecule keywords OUTER MEMBRANE PROTEIN X
publication title The structure of the outer membrane protein OmpX from Escherichia coli reveals possible mechanisms of virulence.
pubmed rcsb
source organism Escherichia coli
total genus 39
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1999-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qj9A00
2GE4A 3G7GA 2F1TA 1P4TA 3C5OA 4RLCA 1BXWA 2M06A 2M07A 2N2MA 2X27X 2LHFA 2K0LA 1ORMA 1Q9GA 2F1VA 1MM5A 2N2LA 2MHLA 1QJ9A 3QRCA 3QRAA 3GP6A 4PUXA 2MNHA 1Q9FA 1MM4A 1THQA 2JMMA 1QJ8A 1QJPA 2ERVA 1G90A
chains in the Genus database with same CATH superfamily
4C69X 4AKRA 5IYUA 3SY9A 7PRNA 4O4UA 3NJTA 3DWOX 1GFPA 3SZVA 2F1TA 3A2SX 3PGUA 2IWWA 2FGRA 5AFUL 5KAFO 3VZWX 2KZ7B 2Y2XA 1BXWA 2M07A 2X27X 3PRNA 4RJWA 1PHOA 3AA6B 3T24A 1T1LA 3HOEA 3LK2A 3AA7B 4FESA 4JCHA 5JDPA 2O4VA 2ODJA 2XE2A 5PRNA 2W80C 3AAEA 2YPVA 3POXA 1MPFA 2MHLA 3PF1A 2YNKA 1ZHYA 3GP6A 4AYMC 5D5DA 4AYID 2R4OA 3K19A 5G38A 4GHBA 5KAIO 4RLBA 3EMNX 4K3BA 2MNHA 2F1CX 1IZNA 5B5EO 3AA0B 3PQUA 1HXTA 4FSOA 3RBHA 3SZDA 5EE2A 4AFKA 2OMFA 4FSPA 4AYNA 2KZ7A 4O49A 5AFUK 4D5UA 3LK41 2XE5A 2GE4A 2ZFGA 4F4BA 3AA6A 3G7GA 1BH3A 2R8AA 4U9CA 3AA7A 4C00A 2Y7SA 4AYDC 1OSMA 4AZLA 4GCPA 5G3AA 3DWNA 1BT9A 2FGQX 8PRNA 4BUMX 2KXPB 2LFUA 3DA3A 2K0LA 4FZLA 4GF4A 4O3ZA 1Q9GA 5H2FO 2XMXA 2JQYA 2F1VA 1MM5A 4E1TA 2XE1A 3HWBA 3FYXA 4GCSA 3LK3B 3QRAA 4D65A 2R89A 3AA0A 4XNLA 4PR7A 3AAAA 1HXXA 5GTIO 2Y0LA 5TISO 3BS0A 2PRNA 3A0HO 4FRXA 4CTDA 5FVNA 3WI5A 4AKMA 3TZGA 6PRNA 4UB6O 1MM4A 3NSGA 2PORA 3BRYA 4LSFA 3VY8X 1GFQA 1PRNA 1QJPA 2ERVA 2R4LA 2XG6A 4FMSA 4XNKA 5E79O 5GTHO 3JCUO 1G90A 4N58A 3T0SA 2R4NA 4KRAA 1P4TA 2KXPA 4KR4A 3C5OA 4C4VB 4FQEA 1T16A 2J1NA 3HW9A 4RLCA 4UB8O 2WVPA 3BRZA 4G76A 5DL5A 3SY7A 2N2MA 4PJ0O 3UPGA 1E54A 4AYEC 3JTYA 2WJRA 2LHFA 3KZIO 1ZHZA 2Y0KA 3LK3A 4FT6A 2XTQA 2QTKA 3POQA 2N2LA 4KR8A 5GV0A 4G75A 3O0EA 3AAEB 3QRCA 4N75A 4LSEA 2AXTO 5G26A 4PUXA 4O3WA 4O3YA 3PQSA 3DZMA 3PGRA 4N59A 5DL6A 2WJQA 3VZTX 3AA1B 2J4UP 4LSIA 2XTRA 2IWVA 4FZNA 3SYBA 1QJ8A 5B66O 1H6S1 1GFMA 4C4VA 2Y0HA 1IZNB 3VZUX 3A0BO 3SYSA 4D64A 3POUA 1GFOA 1YS5A 1ZHXA 2KDYA 3DA4A 3VY9X 3WI4A 4B61A 2W81C 5DL8A 1GFNA 3HOLA 4AKRB 3VE2A 4O4XA 2M06A 5ADXK 3PGSA 1ZHWA 4E1SA 1OPFA 3PORA 4FOZA 4FZMA 4Z3TA 2K4TA 5G39A 4QQ1A 4JFBA 2KC0A 1S5LO 1ORMA 2R88A 5DL7A 3V8UA 1ZHTA 2X9KA 2XE3A 3LK2B 4IL6O 4GCQA 1QJ9A 3AA1A 4FUVA 4RL9A 4RJXA 4N74A 3T20A 3LK42 3KVDD 4LSHA 3WU2O 1Q9FA 4FRTA 5ADXL 4K3CA 3UAQA 1THQA 3AAAB 2R4PA 1HXUA 2JMMA 5T5FA 3UU2A 4AUIA 4O3XB 3VE1A 2ZLDA
chains in the Genus database with same CATH topology
4C69X 4AKRA 5IYUA 3SY9A 7PRNA 4O4UA 1GFPA 3SZVA 2F1TA 3A2SX 2FGRA 5AFUL 3VZWX 2KZ7B 2Y2XA 1BXWA 2M07A 2X27X 3PRNA 4RJWA 1PHOA 3AA6B 3T24A 3HOEA 3LK2A 4FESA 3AA7B 4JCHA 5JDPA 2O4VA 2ODJA 2XE2A 5PRNA 2W80C 3AAEA 2YPVA 3POXA 1MPFA 2MHLA 2YNKA 1ZHYA 3GP6A 4AYMC 5D5DA 4AYID 3K19A 4GHBA 4RLBA 3EMNX 2MNHA 1IZNA 3AA0B 3PQUA 1HXTA 4FSOA 3RBHA 3SZDA 5EE2A 4AFKA 2OMFA 4FSPA 4AYNA 2KZ7A 4O49A 5AFUK 4D5UA 3LK41 2XE5A 2GE4A 2ZFGA 4F4BA 3AA6A 3G7GA 1BH3A 4U9CA 3AA7A 2Y7SA 4AYDC 1OSMA 4AZLA 4GCPA 1BT9A 2FGQX 8PRNA 4BUMX 2KXPB 2LFUA 3DA3A 2K0LA 4FZLA 4GF4A 4O3ZA 1Q9GA 2XMXA 2F1VA 1MM5A 4E1TA 2XE1A 3HWBA 3FYXA 4GCSA 3LK3B 3QRAA 4D65A 3AA0A 4XNLA 3AAAA 1HXXA 2Y0LA 5ADXK 4FRXA 2PRNA 6PRNA 5FVNA 3WI5A 4AKMA 3TZGA 1MM4A 3NSGA 2PORA 4LSFA 3VY8X 1GFQA 1PRNA 1QJPA 2XG6A 2ERVA 4FMSA 1G90A 4XNKA 4N58A 3T0SA 4KRAA 1P4TA 2KXPA 4KR4A 3C5OA 2J1NA 3HW9A 4RLCA 3SY7A 3UPGA 4G76A 5DL5A 2N2MA 1E54A 4AYEC 3JTYA 2LHFA 1ZHZA 2Y0KA 3LK3A 4FT6A 2XTQA 2QTKA 3POQA 2N2LA 4KR8A 5GV0A 4G75A 3O0EA 3AAEB 3QRCA 4LSEA 5G26A 4PUXA 4O3WA 4O3YA 3PQSA 2J4UP 4N59A 3VZTX 5DL6A 3AA1B 4LSIA 2XTRA 4FZNA 3SYBA 1QJ8A 1H6S1 1GFMA 2Y0HA 1IZNB 3VZUX 3SYSA 4D64A 3POUA 1GFOA 1YS5A 1ZHXA 2KDYA 3DA4A 3VY9X 3WI4A 4B61A 2W81C 5DL8A 1GFNA 3HOLA 4AKRB 3VE2A 4O4XA 2M06A 1ZHWA 4E1SA 1OPFA 3PORA 4FOZA 4FZMA 4Z3TA 2K4TA 4QQ1A 4JFBA 2KC0A 1ORMA 5DL7A 3V8UA 1ZHTA 2XE3A 3LK2B 4GCQA 1QJ9A 3AA1A 4FUVA 4RL9A 4RJXA 3T20A 3LK42 3KVDD 4LSHA 1Q9FA 4FRTA 5ADXL 3UAQA 1THQA 3AAAB 1HXUA 2JMMA 5T5FA 3UU2A 4AUIA 4O3XB 3VE1A 2ZLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE4 A;  3G7G A;  2F1T A;  1P4T A;  3C5O A;  4RLC A;  1BXW A;  2M06 A;  2M07 A;  2N2M A;  2X27 X;  2LHF A;  2K0L A;  1ORM A;  1Q9G A;  2F1V A;  1MM5 A;  2N2L A;  2MHL A;  1QJ9 A;  3QRC A;  3QRA A;  3GP6 A;  4PUX A;  2MNH A;  1Q9F A;  1MM4 A;  1THQ A;  2JMM A;  1QJ8 A;  1QJP A;  2ERV A;  1G90 A; 
#chains in the Genus database with same CATH topology
 4C69 X;  4AKR A;  5IYU A;  3SY9 A;  7PRN A;  4O4U A;  3NJT A;  3DWO X;  1GFP A;  3SZV A;  2F1T A;  3A2S X;  3PGU A;  2IWW A;  2FGR A;  5AFU L;  5KAF O;  3VZW X;  2KZ7 B;  2Y2X A;  1BXW A;  2M07 A;  2X27 X;  3PRN A;  4RJW A;  1PHO A;  3AA6 B;  3T24 A;  1T1L A;  3HOE A;  3LK2 A;  3AA7 B;  4FES A;  4JCH A;  5JDP A;  2O4V A;  2ODJ A;  2XE2 A;  5PRN A;  2W80 C;  3AAE A;  2YPV A;  3POX A;  1MPF A;  2MHL A;  3PF1 A;  2YNK A;  1ZHY A;  3GP6 A;  4AYM C;  5D5D A;  4AYI D;  2R4O A;  3K19 A;  5G38 A;  4GHB A;  5KAI O;  4RLB A;  3EMN X;  4K3B A;  2MNH A;  2F1C X;  1IZN A;  5B5E O;  3AA0 B;  3PQU A;  1HXT A;  4FSO A;  3RBH A;  3SZD A;  5EE2 A;  4AFK A;  2OMF A;  4FSP A;  4AYN A;  2KZ7 A;  4O49 A;  5AFU K;  4D5U A;  3LK4 1;  2XE5 A;  2GE4 A;  2ZFG A;  4F4B A;  3AA6 A;  3G7G A;  1BH3 A;  2R8A A;  4U9C A;  3AA7 A;  4C00 A;  2Y7S A;  4AYD C;  1OSM A;  4AZL A;  4GCP A;  5G3A A;  3DWN A;  1BT9 A;  2FGQ X;  8PRN A;  4BUM X;  2KXP B;  2LFU A;  3DA3 A;  2K0L A;  4FZL A;  4GF4 A;  4O3Z A;  1Q9G A;  5H2F O;  2XMX A;  2JQY A;  2F1V A;  1MM5 A;  4E1T A;  2XE1 A;  3HWB A;  3FYX A;  4GCS A;  3LK3 B;  3QRA A;  4D65 A;  2R89 A;  3AA0 A;  4XNL A;  4PR7 A;  3AAA A;  1HXX A;  5GTI O;  2Y0L A;  5TIS O;  3BS0 A;  2PRN A;  3A0H O;  4FRX A;  4CTD A;  5FVN A;  3WI5 A;  4AKM A;  3TZG A;  6PRN A;  4UB6 O;  1MM4 A;  3NSG A;  2POR A;  3BRY A;  4LSF A;  3VY8 X;  1GFQ A;  1PRN A;  1QJP A;  2ERV A;  2R4L A;  2XG6 A;  4FMS A;  4XNK A;  5E79 O;  5GTH O;  3JCU O;  1G90 A;  4N58 A;  3T0S A;  2R4N A;  4KRA A;  1P4T A;  2KXP A;  4KR4 A;  3C5O A;  4C4V B;  4FQE A;  1T16 A;  2J1N A;  3HW9 A;  4RLC A;  4UB8 O;  2WVP A;  3BRZ A;  4G76 A;  5DL5 A;  3SY7 A;  2N2M A;  4PJ0 O;  3UPG A;  1E54 A;  4AYE C;  3JTY A;  2WJR A;  2LHF A;  3KZI O;  1ZHZ A;  2Y0K A;  3LK3 A;  4FT6 A;  2XTQ A;  2QTK A;  3POQ A;  2N2L A;  4KR8 A;  5GV0 A;  4G75 A;  3O0E A;  3AAE B;  3QRC A;  4N75 A;  4LSE A;  2AXT O;  5G26 A;  4PUX A;  4O3W A;  4O3Y A;  3PQS A;  3DZM A;  3PGR A;  4N59 A;  5DL6 A;  2WJQ A;  3VZT X;  3AA1 B;  2J4U P;  4LSI A;  2XTR A;  2IWV A;  4FZN A;  3SYB A;  1QJ8 A;  5B66 O;  1H6S 1;  1GFM A;  4C4V A;  2Y0H A;  1IZN B;  3VZU X;  3A0B O;  3SYS A;  4D64 A;  3POU A;  1GFO A;  1YS5 A;  1ZHX A;  2KDY A;  3DA4 A;  3VY9 X;  3WI4 A;  4B61 A;  2W81 C;  5DL8 A;  1GFN A;  3HOL A;  4AKR B;  3VE2 A;  4O4X A;  2M06 A;  5ADX K;  3PGS A;  1ZHW A;  4E1S A;  1OPF A;  3POR A;  4FOZ A;  4FZM A;  4Z3T A;  2K4T A;  5G39 A;  4QQ1 A;  4JFB A;  2KC0 A;  1S5L O;  1ORM A;  2R88 A;  5DL7 A;  3V8U A;  1ZHT A;  2X9K A;  2XE3 A;  3LK2 B;  4IL6 O;  4GCQ A;  1QJ9 A;  3AA1 A;  4FUV A;  4RL9 A;  4RJX A;  4N74 A;  3T20 A;  3LK4 2;  3KVD D;  4LSH A;  3WU2 O;  1Q9F A;  4FRT A;  5ADX L;  4K3C A;  3UAQ A;  1THQ A;  3AAA B;  2R4P A;  1HXU A;  2JMM A;  5T5F A;  3UU2 A;  4AUI A;  4O3X B;  3VE1 A;  2ZLD A; 
#chains in the Genus database with same CATH homology
 4C69 X;  4AKR A;  5IYU A;  3SY9 A;  7PRN A;  4O4U A;  1GFP A;  3SZV A;  2F1T A;  3A2S X;  2FGR A;  5AFU L;  3VZW X;  2KZ7 B;  2Y2X A;  1BXW A;  2M07 A;  2X27 X;  3PRN A;  4RJW A;  1PHO A;  3AA6 B;  3T24 A;  3HOE A;  3LK2 A;  4FES A;  3AA7 B;  4JCH A;  5JDP A;  2O4V A;  2ODJ A;  2XE2 A;  5PRN A;  2W80 C;  3AAE A;  2YPV A;  3POX A;  1MPF A;  2MHL A;  2YNK A;  1ZHY A;  3GP6 A;  4AYM C;  5D5D A;  4AYI D;  3K19 A;  4GHB A;  4RLB A;  3EMN X;  2MNH A;  1IZN A;  3AA0 B;  3PQU A;  1HXT A;  4FSO A;  3RBH A;  3SZD A;  5EE2 A;  4AFK A;  2OMF A;  4FSP A;  4AYN A;  2KZ7 A;  4O49 A;  5AFU K;  4D5U A;  3LK4 1;  2XE5 A;  2GE4 A;  2ZFG A;  4F4B A;  3AA6 A;  3G7G A;  1BH3 A;  4U9C A;  3AA7 A;  2Y7S A;  4AYD C;  1OSM A;  4AZL A;  4GCP A;  1BT9 A;  2FGQ X;  8PRN A;  4BUM X;  2KXP B;  2LFU A;  3DA3 A;  2K0L A;  4FZL A;  4GF4 A;  4O3Z A;  1Q9G A;  2XMX A;  2F1V A;  1MM5 A;  4E1T A;  2XE1 A;  3HWB A;  3FYX A;  4GCS A;  3LK3 B;  3QRA A;  4D65 A;  3AA0 A;  4XNL A;  3AAA A;  1HXX A;  2Y0L A;  5ADX K;  4FRX A;  2PRN A;  6PRN A;  5FVN A;  3WI5 A;  4AKM A;  3TZG A;  1MM4 A;  3NSG A;  2POR A;  4LSF A;  3VY8 X;  1GFQ A;  1PRN A;  1QJP A;  2XG6 A;  2ERV A;  4FMS A;  1G90 A;  4XNK A;  4N58 A;  3T0S A;  4KRA A;  1P4T A;  2KXP A;  4KR4 A;  3C5O A;  2J1N A;  3HW9 A;  4RLC A;  3SY7 A;  3UPG A;  4G76 A;  5DL5 A;  2N2M A;  1E54 A;  4AYE C;  3JTY A;  2LHF A;  1ZHZ A;  2Y0K A;  3LK3 A;  4FT6 A;  2XTQ A;  2QTK A;  3POQ A;  2N2L A;  4KR8 A;  5GV0 A;  4G75 A;  3O0E A;  3AAE B;  3QRC A;  4LSE A;  5G26 A;  4PUX A;  4O3W A;  4O3Y A;  3PQS A;  2J4U P;  4N59 A;  3VZT X;  5DL6 A;  3AA1 B;  4LSI A;  2XTR A;  4FZN A;  3SYB A;  1QJ8 A;  1H6S 1;  1GFM A;  2Y0H A;  1IZN B;  3VZU X;  3SYS A;  4D64 A;  3POU A;  1GFO A;  1YS5 A;  1ZHX A;  2KDY A;  3DA4 A;  3VY9 X;  3WI4 A;  4B61 A;  2W81 C;  5DL8 A;  1GFN A;  3HOL A;  4AKR B;  3VE2 A;  4O4X A;  2M06 A;  1ZHW A;  4E1S A;  1OPF A;  3POR A;  4FOZ A;  4FZM A;  4Z3T A;  2K4T A;  4QQ1 A;  4JFB A;  2KC0 A;  1ORM A;  5DL7 A;  3V8U A;  1ZHT A;  2XE3 A;  3LK2 B;  4GCQ A;  1QJ9 A;  3AA1 A;  4FUV A;  4RL9 A;  4RJX A;  3T20 A;  3LK4 2;  3KVD D;  4LSH A;  1Q9F A;  4FRT A;  5ADX L;  3UAQ A;  1THQ A;  3AAA B;  1HXU A;  2JMM A;  5T5F A;  3UU2 A;  4AUI A;  4O3X B;  3VE1 A;  2ZLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...