5B5EO

Crystal structure analysis of photosystem ii complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
molecule tags Electron transport, photosynthesis
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 50
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b5eO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b5eO02
1S5LO 5G38A 5GTIO 3A0BO 3WU2O 2AXTO 5G39A 5H2FO 5KAFO 5B66O 5G3AA 5KAIO 4UB6O 5E79O 3KZIO 3JCUO 4PJ0O 5B5EO 5GTHO 5TISO 3A0HO 4UB8O 4IL6O
chains in the Genus database with same CATH superfamily
4U9CA 3SY9A 2K0LA 3BS0A 5DL7A 2KZ7B 3AA0B 5GTIO 1ZHZA 3AAEA 3LK3B 4LSIA 4O3ZA 3A0BO 3LK42 3PQUA 4GHBA 4PUXA 3VE2A 2YNKA 1ORMA 2XTRA 1MM4A 4AKRA 4BUMX 5ADXK 5H2FO 1GFQA 2R88A 5B66O 3AAAA 2LFUA 3K19A 2F1TA 3DA3A 4O49A 4KR8A 5AFUK 4G76A 3AA1B 5KAIO 5DL8A 4QQ1A 4JFBA 3UU2A 2PORA 3NSGA 3NJTA 2J1NA 2X9KA 4CTDA 4FESA 4FUVA 3SZVA 3POUA 3WI5A 2ODJA 4AZLA 4LSFA 5IYUA 1QJ9A 2O4VA 1QJ8A 4F4BA 2JMMA 2M06A 3WI4A 1PRNA 2QTKA 4FMSA 4RLCA 1GFNA 2R4OA 3PORA 2XE5A 2IWVA 3VY8X 5G26A 4AYNA 1BT9A 2R89A 4AUIA 2ZLDA 2KXPB 1S5LO 3HWBA 1MM5A 2WJQA 3AA0A 3QRCA 3JTYA 3PF1A 1ZHYA 4GCSA 4FZMA 4AFKA 1E54A 3DWOX 4FRTA 2AXTO 3SZDA 4Z3TA 4KRAA 5D5DA 3T24A 3VZUX 5FVNA 2MNHA 2R4NA 3HW9A 3VY9X 4XNLA 4B61A 3PRNA 2J4UP 4UB6O 2Y0LA 1THQA 2R4LA 4FZNA 4GF4A 1QJPA 3JCUO 5PRNA 1ZHWA 2M07A 3G7GA 2ERVA 4AKMA 5ADXL 4RJWA 1MPFA 2Y0HA 4N75A 3AA7A 4E1SA 4D65A 1GFOA 3KVDD 4UB8O 5JDPA 2IWWA 4AKRB 2XE3A 1BXWA 3DZMA 3DWNA 3POXA 3FYXA 3AA6B 2XE2A 1PHOA 3LK3A 3LK41 5T5FA 4C4VB 5G38A 2F1CX 3HOLA 4C69X 3AA6A 4AYEC 2R4PA 3TZGA 4KR4A 3AAAB 4RL9A 3SYSA 3T20A 3WU2O 4O3XB 2R8AA 2ZFGA 4K3CA 4N58A 1HXXA 5G3AA 4GCQA 4N74A 3PGUA 4O3YA 5DL6A 3O0EA 8PRNA 1P4TA 5E79O 3VZTX 4AYMC 3KZIO 1ZHXA 3POQA 4G75A 2WVPA 4O4XA 2F1VA 3QRAA 5AFUL 1YS5A 3A2SX 2X27X 4FQEA 2XMXA 2KXPA 4K3BA 2MHLA 2N2MA 2KDYA 3SYBA 2Y2XA 2JQYA 5EE2A 3BRYA 3UAQA 4C00A 3A0HO 3GP6A 3AAEB 4D64A 4FRXA 1HXTA 2Y7SA 1GFPA 2LHFA 2FGRA 4FSPA 4O3WA 4IL6O 2Y0KA 7PRNA 4GCPA 1T1LA 3BRZA 1H6S1 3PGSA 3V8UA 6PRNA 3VE1A 2K4TA 3LK2B 4FZLA 5DL5A 4LSEA 4FT6A 4FSOA 3AA1A 1T16A 4PR7A 5G39A 1IZNA 5KAFO 3RBHA 4RLBA 1G90A 2XE1A 2PRNA 3C5OA 3LK2A 4RJXA 3T0SA 1Q9FA 2YPVA 3PQSA 4AYDC 3PGRA 1GFMA 4AYID 5GV0A 3DA4A 2FGQX 4N59A 4PJ0O 3SY7A 1Q9GA 3EMNX 1OPFA 2OMFA 5B5EO 2N2LA 2W81C 2WJRA 3HOEA 1IZNB 5TISO 5GTHO 2XTQA 2KC0A 4C4VA 2XG6A 4E1TA 4LSHA 1BH3A 1HXUA 4JCHA 1OSMA 4XNKA 2W80C 4O4UA 1ZHTA 3VZWX 4FOZA 3UPGA 2GE4A 2KZ7A 3AA7B 4D5UA
chains in the Genus database with same CATH topology
1S5LO 5G38A 5GTIO 3A0BO 3WU2O 2AXTO 5G39A 5H2FO 5KAFO 5B66O 5G3AA 5KAIO 4UB6O 5E79O 3KZIO 3JCUO 4PJ0O 5B5EO 5GTHO 5TISO 3A0HO 4UB8O 4IL6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L O;  5G38 A;  5GTI O;  3A0B O;  3WU2 O;  2AXT O;  5G39 A;  5H2F O;  5KAF O;  5B66 O;  5G3A A;  5KAI O;  4UB6 O;  5E79 O;  3KZI O;  3JCU O;  4PJ0 O;  5B5E O;  5GTH O;  5TIS O;  3A0H O;  4UB8 O;  4IL6 O; 
#chains in the Genus database with same CATH topology
 4U9C A;  3SY9 A;  2K0L A;  3BS0 A;  5DL7 A;  2KZ7 B;  3AA0 B;  5GTI O;  1ZHZ A;  3AAE A;  3LK3 B;  4LSI A;  4O3Z A;  3A0B O;  3LK4 2;  3PQU A;  4GHB A;  4PUX A;  3VE2 A;  2YNK A;  1ORM A;  2XTR A;  1MM4 A;  4AKR A;  4BUM X;  5ADX K;  5H2F O;  1GFQ A;  2R88 A;  5B66 O;  3AAA A;  2LFU A;  3K19 A;  2F1T A;  3DA3 A;  4O49 A;  4KR8 A;  5AFU K;  4G76 A;  3AA1 B;  5KAI O;  5DL8 A;  4QQ1 A;  4JFB A;  3UU2 A;  2POR A;  3NSG A;  3NJT A;  2J1N A;  2X9K A;  4CTD A;  4FES A;  4FUV A;  3SZV A;  3POU A;  3WI5 A;  2ODJ A;  4AZL A;  4LSF A;  5IYU A;  1QJ9 A;  2O4V A;  1QJ8 A;  4F4B A;  2JMM A;  2M06 A;  3WI4 A;  1PRN A;  2QTK A;  4FMS A;  4RLC A;  1GFN A;  2R4O A;  3POR A;  2XE5 A;  2IWV A;  3VY8 X;  5G26 A;  4AYN A;  1BT9 A;  2R89 A;  4AUI A;  2ZLD A;  2KXP B;  1S5L O;  3HWB A;  1MM5 A;  2WJQ A;  3AA0 A;  3QRC A;  3JTY A;  3PF1 A;  1ZHY A;  4GCS A;  4FZM A;  4AFK A;  1E54 A;  3DWO X;  4FRT A;  2AXT O;  3SZD A;  4Z3T A;  4KRA A;  5D5D A;  3T24 A;  3VZU X;  5FVN A;  2MNH A;  2R4N A;  3HW9 A;  3VY9 X;  4XNL A;  4B61 A;  3PRN A;  2J4U P;  4UB6 O;  2Y0L A;  1THQ A;  2R4L A;  4FZN A;  4GF4 A;  1QJP A;  3JCU O;  5PRN A;  1ZHW A;  2M07 A;  3G7G A;  2ERV A;  4AKM A;  5ADX L;  4RJW A;  1MPF A;  2Y0H A;  4N75 A;  3AA7 A;  4E1S A;  4D65 A;  1GFO A;  3KVD D;  4UB8 O;  5JDP A;  2IWW A;  4AKR B;  2XE3 A;  1BXW A;  3DZM A;  3DWN A;  3POX A;  3FYX A;  3AA6 B;  2XE2 A;  1PHO A;  3LK3 A;  3LK4 1;  5T5F A;  4C4V B;  5G38 A;  2F1C X;  3HOL A;  4C69 X;  3AA6 A;  4AYE C;  2R4P A;  3TZG A;  4KR4 A;  3AAA B;  4RL9 A;  3SYS A;  3T20 A;  3WU2 O;  4O3X B;  2R8A A;  2ZFG A;  4K3C A;  4N58 A;  1HXX A;  5G3A A;  4GCQ A;  4N74 A;  3PGU A;  4O3Y A;  5DL6 A;  3O0E A;  8PRN A;  1P4T A;  5E79 O;  3VZT X;  4AYM C;  3KZI O;  1ZHX A;  3POQ A;  4G75 A;  2WVP A;  4O4X A;  2F1V A;  3QRA A;  5AFU L;  1YS5 A;  3A2S X;  2X27 X;  4FQE A;  2XMX A;  2KXP A;  4K3B A;  2MHL A;  2N2M A;  2KDY A;  3SYB A;  2Y2X A;  2JQY A;  5EE2 A;  3BRY A;  3UAQ A;  4C00 A;  3A0H O;  3GP6 A;  3AAE B;  4D64 A;  4FRX A;  1HXT A;  2Y7S A;  1GFP A;  2LHF A;  2FGR A;  4FSP A;  4O3W A;  4IL6 O;  2Y0K A;  7PRN A;  4GCP A;  1T1L A;  3BRZ A;  1H6S 1;  3PGS A;  3V8U A;  6PRN A;  3VE1 A;  2K4T A;  3LK2 B;  4FZL A;  5DL5 A;  4LSE A;  4FT6 A;  4FSO A;  3AA1 A;  1T16 A;  4PR7 A;  5G39 A;  1IZN A;  5KAF O;  3RBH A;  4RLB A;  1G90 A;  2XE1 A;  2PRN A;  3C5O A;  3LK2 A;  4RJX A;  3T0S A;  1Q9F A;  2YPV A;  3PQS A;  4AYD C;  3PGR A;  1GFM A;  4AYI D;  5GV0 A;  3DA4 A;  2FGQ X;  4N59 A;  4PJ0 O;  3SY7 A;  1Q9G A;  3EMN X;  1OPF A;  2OMF A;  5B5E O;  2N2L A;  2W81 C;  2WJR A;  3HOE A;  1IZN B;  5TIS O;  5GTH O;  2XTQ A;  2KC0 A;  4C4V A;  2XG6 A;  4E1T A;  4LSH A;  1BH3 A;  1HXU A;  4JCH A;  1OSM A;  4XNK A;  2W80 C;  4O4U A;  1ZHT A;  3VZW X;  4FOZ A;  3UPG A;  2GE4 A;  2KZ7 A;  3AA7 B;  4D5U A; 
#chains in the Genus database with same CATH homology
 1S5L O;  5G38 A;  5GTI O;  3A0B O;  3WU2 O;  2AXT O;  5G39 A;  5H2F O;  5KAF O;  5B66 O;  5G3A A;  5KAI O;  4UB6 O;  5E79 O;  3KZI O;  3JCU O;  4PJ0 O;  5B5E O;  5GTH O;  5TIS O;  3A0H O;  4UB8 O;  4IL6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...