5B5EO

Crystal structure analysis of photosystem ii complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 50
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b5eO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b5eO02
2AXTO 4IL6O 3WU2O 5B5EO 3A0BO 5KAFO 5KAIO 3A0HO 5TISO 5B66O 4UB8O 5E79O 5G38A 5GTIO 5GTHO 4PJ0O 3JCUO 4UB6O 3KZIO 5H2FO 5G3AA 1S5LO 5G39A
chains in the Genus database with same CATH superfamily
1GFMA 1ZHTA 1HXTA 4IL6O 4RJXA 4U9CA 5DL5A 1MPFA 3HOEA 3TZGA 4AKMA 5B5EO 2J4UP 1T16A 2ZFGA 2XMXA 3LK42 4AYMC 2PRNA 3AA7A 2F1TA 5KAIO 4K3BA 2X27X 2XG6A 3K19A 4G75A 3WI5A 5AFUL 1Q9FA 4UB8O 2KXPA 1ZHZA 2R4PA 2WVPA 4GF4A 4JCHA 3SYBA 5GTHO 2JQYA 3AAAB 5DL8A 1Q9GA 2IWVA 2N2LA 3POUA 3POQA 4PJ0O 3T24A 2WJRA 4FT6A 2R89A 3WI4A 5T5FA 4N75A 1OSMA 4B61A 3BS0A 2XTRA 1S5LO 4GCQA 4N59A 2GE4A 3A2SX 4AYEC 2QTKA 4N58A 2LFUA 4O4UA 2Y0HA 4FMSA 3DA3A 4FRTA 2N2MA 1GFPA 3HOLA 3LK3B 4BUMX 5ADXK 4AYID 2O4VA 3PQSA 4FOZA 2OMFA 3AAEB 4C4VB 3BRZA 4F4BA 2MHLA 4CTDA 3A0HO 2KZ7B 2ODJA 1HXUA 4FSOA 1MM5A 4AFKA 4FSPA 2LHFA 2Y0LA 3AA0A 4KRAA 4KR4A 2R4NA 1ZHXA 3PQUA 3SZDA 5DL7A 4LSIA 3JCUO 4O3YA 1BXWA 4AKRB 4AYDC 1IZNB 2W80C 3DA4A 3PGUA 5GV0A 3AA6B 3POXA 2ERVA 3KZIO 5H2FO 3LK2A 4O49A 2J1NA 4AYNA 2KDYA 3NJTA 4O4XA 1GFQA 1HXXA 2FGRA 4FZNA 2AXTO 5ADXL 4G76A 3AA1B 4GCSA 3JTYA 3VY8X 2ZLDA 4JFBA 3A0BO 3VE2A 5G26A 5KAFO 3SYSA 2K4TA 4FESA 1GFNA 2YNKA 5B66O 3AA7B 4RJWA 1QJPA 4FUVA 3SY7A 8PRNA 3HWBA 4FZMA 4LSHA 5D5DA 5E79O 4AUIA 3V8UA 4LSEA 4N74A 2YPVA 4D64A 3PORA 4GHBA 4KR8A 4E1SA 3AAAA 3KVDD 5FVNA 4D5UA 2KXPB 1ZHYA 3PGSA 2Y7SA 2FGQX 4O3WA 4QQ1A 3SY9A 2WJQA 3UU2A 5JDPA 2X9KA 4K3CA 2PORA 3VZTX 1OPFA 4UB6O 3VZWX 3PGRA 2KC0A 1T1LA 3GP6A 1G90A 3PRNA 5G3AA 1H6S1 2XE5A 3UPGA 4RL9A 2F1CX 3LK41 3C5OA 6PRNA 5G39A 3RBHA 1THQA 3DWOX 1MM4A 2R88A 3LK3A 4O3ZA 4XNKA 3SZVA 3NSGA 4FRXA 2M07A 4XNLA 3AAEA 3UAQA 3WU2O 4C4VA 4D65A 1YS5A 5EE2A 1PHOA 4AZLA 4C69X 4Z3TA 2XE1A 2XE2A 2R8AA 2KZ7A 4PR7A 5PRNA 2IWWA 1BT9A 3DWNA 2R4LA 5TISO 2R4OA 4RLBA 3QRAA 2Y2XA 3BRYA 7PRNA 5G38A 2XE3A 3VZUX 5GTIO 5AFUK 1ORMA 5DL6A 3QRCA 2XTQA 3HW9A 3LK2B 4GCPA 4E1TA 5IYUA 1QJ9A 3DZMA 1BH3A 3AA0B 3PF1A 4PUXA 1PRNA 1IZNA 4AKRA 2F1VA 3O0EA 1P4TA 2Y0KA 3AA6A 2M06A 3VE1A 1GFOA 4RLCA 1ZHWA 1QJ8A 2W81C 3VY9X 4C00A 3G7GA 2K0LA 3EMNX 4FZLA 4FQEA 4O3XB 1E54A 2JMMA 3T20A 3T0SA 2MNHA 4LSFA 3AA1A 3FYXA
chains in the Genus database with same CATH topology
2AXTO 4IL6O 3WU2O 5B5EO 3A0BO 5KAFO 5KAIO 3A0HO 5TISO 5B66O 4UB8O 5E79O 5G38A 5GTIO 5GTHO 4PJ0O 3JCUO 4UB6O 3KZIO 5H2FO 5G3AA 1S5LO 5G39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT O;  4IL6 O;  3WU2 O;  5B5E O;  3A0B O;  5KAF O;  5KAI O;  3A0H O;  5TIS O;  5B66 O;  4UB8 O;  5E79 O;  5G38 A;  5GTI O;  5GTH O;  4PJ0 O;  3JCU O;  4UB6 O;  3KZI O;  5H2F O;  5G3A A;  1S5L O;  5G39 A; 
#chains in the Genus database with same CATH topology
 1GFM A;  1ZHT A;  1HXT A;  4IL6 O;  4RJX A;  4U9C A;  5DL5 A;  1MPF A;  3HOE A;  3TZG A;  4AKM A;  5B5E O;  2J4U P;  1T16 A;  2ZFG A;  2XMX A;  3LK4 2;  4AYM C;  2PRN A;  3AA7 A;  2F1T A;  5KAI O;  4K3B A;  2X27 X;  2XG6 A;  3K19 A;  4G75 A;  3WI5 A;  5AFU L;  1Q9F A;  4UB8 O;  2KXP A;  1ZHZ A;  2R4P A;  2WVP A;  4GF4 A;  4JCH A;  3SYB A;  5GTH O;  2JQY A;  3AAA B;  5DL8 A;  1Q9G A;  2IWV A;  2N2L A;  3POU A;  3POQ A;  4PJ0 O;  3T24 A;  2WJR A;  4FT6 A;  2R89 A;  3WI4 A;  5T5F A;  4N75 A;  1OSM A;  4B61 A;  3BS0 A;  2XTR A;  1S5L O;  4GCQ A;  4N59 A;  2GE4 A;  3A2S X;  4AYE C;  2QTK A;  4N58 A;  2LFU A;  4O4U A;  2Y0H A;  4FMS A;  3DA3 A;  4FRT A;  2N2M A;  1GFP A;  3HOL A;  3LK3 B;  4BUM X;  5ADX K;  4AYI D;  2O4V A;  3PQS A;  4FOZ A;  2OMF A;  3AAE B;  4C4V B;  3BRZ A;  4F4B A;  2MHL A;  4CTD A;  3A0H O;  2KZ7 B;  2ODJ A;  1HXU A;  4FSO A;  1MM5 A;  4AFK A;  4FSP A;  2LHF A;  2Y0L A;  3AA0 A;  4KRA A;  4KR4 A;  2R4N A;  1ZHX A;  3PQU A;  3SZD A;  5DL7 A;  4LSI A;  3JCU O;  4O3Y A;  1BXW A;  4AKR B;  4AYD C;  1IZN B;  2W80 C;  3DA4 A;  3PGU A;  5GV0 A;  3AA6 B;  3POX A;  2ERV A;  3KZI O;  5H2F O;  3LK2 A;  4O49 A;  2J1N A;  4AYN A;  2KDY A;  3NJT A;  4O4X A;  1GFQ A;  1HXX A;  2FGR A;  4FZN A;  2AXT O;  5ADX L;  4G76 A;  3AA1 B;  4GCS A;  3JTY A;  3VY8 X;  2ZLD A;  4JFB A;  3A0B O;  3VE2 A;  5G26 A;  5KAF O;  3SYS A;  2K4T A;  4FES A;  1GFN A;  2YNK A;  5B66 O;  3AA7 B;  4RJW A;  1QJP A;  4FUV A;  3SY7 A;  8PRN A;  3HWB A;  4FZM A;  4LSH A;  5D5D A;  5E79 O;  4AUI A;  3V8U A;  4LSE A;  4N74 A;  2YPV A;  4D64 A;  3POR A;  4GHB A;  4KR8 A;  4E1S A;  3AAA A;  3KVD D;  5FVN A;  4D5U A;  2KXP B;  1ZHY A;  3PGS A;  2Y7S A;  2FGQ X;  4O3W A;  4QQ1 A;  3SY9 A;  2WJQ A;  3UU2 A;  5JDP A;  2X9K A;  4K3C A;  2POR A;  3VZT X;  1OPF A;  4UB6 O;  3VZW X;  3PGR A;  2KC0 A;  1T1L A;  3GP6 A;  1G90 A;  3PRN A;  5G3A A;  1H6S 1;  2XE5 A;  3UPG A;  4RL9 A;  2F1C X;  3LK4 1;  3C5O A;  6PRN A;  5G39 A;  3RBH A;  1THQ A;  3DWO X;  1MM4 A;  2R88 A;  3LK3 A;  4O3Z A;  4XNK A;  3SZV A;  3NSG A;  4FRX A;  2M07 A;  4XNL A;  3AAE A;  3UAQ A;  3WU2 O;  4C4V A;  4D65 A;  1YS5 A;  5EE2 A;  1PHO A;  4AZL A;  4C69 X;  4Z3T A;  2XE1 A;  2XE2 A;  2R8A A;  2KZ7 A;  4PR7 A;  5PRN A;  2IWW A;  1BT9 A;  3DWN A;  2R4L A;  5TIS O;  2R4O A;  4RLB A;  3QRA A;  2Y2X A;  3BRY A;  7PRN A;  5G38 A;  2XE3 A;  3VZU X;  5GTI O;  5AFU K;  1ORM A;  5DL6 A;  3QRC A;  2XTQ A;  3HW9 A;  3LK2 B;  4GCP A;  4E1T A;  5IYU A;  1QJ9 A;  3DZM A;  1BH3 A;  3AA0 B;  3PF1 A;  4PUX A;  1PRN A;  1IZN A;  4AKR A;  2F1V A;  3O0E A;  1P4T A;  2Y0K A;  3AA6 A;  2M06 A;  3VE1 A;  1GFO A;  4RLC A;  1ZHW A;  1QJ8 A;  2W81 C;  3VY9 X;  4C00 A;  3G7G A;  2K0L A;  3EMN X;  4FZL A;  4FQE A;  4O3X B;  1E54 A;  2JMM A;  3T20 A;  3T0S A;  2MNH A;  4LSF A;  3AA1 A;  3FYX A; 
#chains in the Genus database with same CATH homology
 2AXT O;  4IL6 O;  3WU2 O;  5B5E O;  3A0B O;  5KAF O;  5KAI O;  3A0H O;  5TIS O;  5B66 O;  4UB8 O;  5E79 O;  5G38 A;  5GTI O;  5GTH O;  4PJ0 O;  3JCU O;  4UB6 O;  3KZI O;  5H2F O;  5G3A A;  1S5L O;  5G39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...