5B5EO

Crystal structure analysis of photosystem ii complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 50
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b5eO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b5eO02
5TISO 5G39A 5KAIO 5KAFO 3WU2O 5G3AA 5G38A 3KZIO 4UB8O 4IL6O 5GTIO 3A0BO 5B66O 5E79O 1S5LO 2AXTO 3A0HO 5GTHO 5B5EO 5H2FO 4UB6O 3JCUO 4PJ0O
chains in the Genus database with same CATH superfamily
1GFPA 3HW9A 4FMSA 4G76A 1BT9A 3SY7A 3KVDD 8PRNA 1QJPA 2LFUA 5G39A 4AKRA 4RLCA 4O3YA 3DWNA 1ZHYA 2JMMA 1ZHXA 4GCQA 1PHOA 3BRZA 3AA6A 3SYSA 2Y0KA 4N59A 5KAFO 4KR8A 2XMXA 4K3BA 1T16A 4AYEC 2K0LA 4KR4A 3EMNX 4LSHA 4UB8O 4RJXA 2X27X 3BRYA 3T0SA 2R4NA 3A0BO 7PRNA 4D5UA 2M06A 3BS0A 3T24A 4RJWA 1H6S1 3LK3A 1YS5A 2XE3A 1S5LO 4FSOA 5E79O 2FGRA 4O4UA 2MNHA 2AXTO 3A0HO 3AA7A 4FOZA 4KRAA 3SY9A 5GTHO 4XNKA 3TZGA 2IWWA 3VZTX 2F1VA 4FUVA 4FZMA 4AYDC 3AA1B 1ZHTA 5G26A 4PR7A 2Y2XA 3POUA 2KZ7A 3O0EA 3AAEB 2XTQA 3AAAA 3C5OA 3JTYA 4AYID 1HXTA 1ZHZA 2WJRA 4GHBA 3PQSA 3VE1A 1ORMA 4O3WA 3T20A 3DWOX 4C00A 3AA0A 3V8UA 2F1TA 4AYMC 3PORA 2X9KA 1GFMA 1QJ8A 2R4OA 3WI4A 4C4VA 4FSPA 5GTIO 4LSEA 4N58A 3AA6B 4FT6A 2XTRA 2PORA 4AUIA 4Z3TA 3UPGA 1MM5A 4FESA 2K4TA 4PUXA 3WI5A 4D64A 1Q9GA 2WJQA 1IZNB 1GFOA 1ZHWA 2GE4A 1BXWA 3NJTA 5B5EO 5H2FO 3PGRA 4FZLA 4FQEA 2KC0A 5JDPA 2WVPA 4D65A 1E54A 3JCUO 3LK2B 3AA7B 4O4XA 4PJ0O 3VE2A 6PRNA 2XE2A 5T5FA 1G90A 4E1TA 2KDYA 3DZMA 3UAQA 3SZDA 4RLBA 4BUMX 4FRXA 1Q9FA 2ODJA 2R89A 3POXA 4CTDA 2KZ7B 3UU2A 2Y0LA 3AAEA 3FYXA 4U9CA 2ZFGA 2IWVA 3PRNA 5GV0A 5G3AA 1MM4A 4GCSA 2FGQX 2LHFA 1MPFA 3LK41 2KXPA 3QRAA 4N74A 4O3XB 1BH3A 1OSMA 2R4PA 3AA0B 3VZUX 4G75A 5AFUK 4JFBA 3PF1A 2ZLDA 4RL9A 5FVNA 2MHLA 5AFUL 4AYNA 4C4VB 5DL6A 3GP6A 3HOLA 4AKMA 1QJ9A 1GFQA 1HXXA 2JQYA 4JCHA 4LSFA 4O3ZA 5DL8A 2YPVA 3LK42 2Y0HA 4AKRB 2ERVA 2XE1A 2O4VA 4FRTA 1IZNA 5ADXL 5ADXK 5DL5A 1T1LA 5TISO 2R8AA 4F4BA 1PRNA 2N2MA 1GFNA 5D5DA 2R88A 5IYUA 5KAIO 1OPFA 3LK2A 4AZLA 3PGSA 4XNLA 4QQ1A 3SYBA 3SZVA 3VY8X 4B61A 3WU2O 3K19A 3HOEA 3POQA 3VZWX 2YNKA 2W80C 3PQUA 3KZIO 3LK3B 4N75A 5G38A 4IL6O 5DL7A 3RBHA 4LSIA 4C69X 2Y7SA 3VY9X 3DA3A 5B66O 3QRCA 2XG6A 1HXUA 2W81C 2N2LA 3A2SX 3NSGA 2J4UP 1THQA 3HWBA 4O49A 2QTKA 2KXPB 4E1SA 3PGUA 3AA1A 5EE2A 4AFKA 2OMFA 4GCPA 4GF4A 2F1CX 4UB6O 4K3CA 5PRNA 2PRNA 2XE5A 3AAAB 3G7GA 4FZNA 2J1NA 2M07A 3DA4A 2R4LA 1P4TA
chains in the Genus database with same CATH topology
5TISO 5G39A 5KAIO 5KAFO 3WU2O 5G3AA 5G38A 3KZIO 4UB8O 4IL6O 5GTIO 3A0BO 5B66O 5E79O 1S5LO 2AXTO 3A0HO 5GTHO 5B5EO 5H2FO 4UB6O 3JCUO 4PJ0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS O;  5G39 A;  5KAI O;  5KAF O;  3WU2 O;  5G3A A;  5G38 A;  3KZI O;  4UB8 O;  4IL6 O;  5GTI O;  3A0B O;  5B66 O;  5E79 O;  1S5L O;  2AXT O;  3A0H O;  5GTH O;  5B5E O;  5H2F O;  4UB6 O;  3JCU O;  4PJ0 O; 
#chains in the Genus database with same CATH topology
 1GFP A;  3HW9 A;  4FMS A;  4G76 A;  1BT9 A;  3SY7 A;  3KVD D;  8PRN A;  1QJP A;  2LFU A;  5G39 A;  4AKR A;  4RLC A;  4O3Y A;  3DWN A;  1ZHY A;  2JMM A;  1ZHX A;  4GCQ A;  1PHO A;  3BRZ A;  3AA6 A;  3SYS A;  2Y0K A;  4N59 A;  5KAF O;  4KR8 A;  2XMX A;  4K3B A;  1T16 A;  4AYE C;  2K0L A;  4KR4 A;  3EMN X;  4LSH A;  4UB8 O;  4RJX A;  2X27 X;  3BRY A;  3T0S A;  2R4N A;  3A0B O;  7PRN A;  4D5U A;  2M06 A;  3BS0 A;  3T24 A;  4RJW A;  1H6S 1;  3LK3 A;  1YS5 A;  2XE3 A;  1S5L O;  4FSO A;  5E79 O;  2FGR A;  4O4U A;  2MNH A;  2AXT O;  3A0H O;  3AA7 A;  4FOZ A;  4KRA A;  3SY9 A;  5GTH O;  4XNK A;  3TZG A;  2IWW A;  3VZT X;  2F1V A;  4FUV A;  4FZM A;  4AYD C;  3AA1 B;  1ZHT A;  5G26 A;  4PR7 A;  2Y2X A;  3POU A;  2KZ7 A;  3O0E A;  3AAE B;  2XTQ A;  3AAA A;  3C5O A;  3JTY A;  4AYI D;  1HXT A;  1ZHZ A;  2WJR A;  4GHB A;  3PQS A;  3VE1 A;  1ORM A;  4O3W A;  3T20 A;  3DWO X;  4C00 A;  3AA0 A;  3V8U A;  2F1T A;  4AYM C;  3POR A;  2X9K A;  1GFM A;  1QJ8 A;  2R4O A;  3WI4 A;  4C4V A;  4FSP A;  5GTI O;  4LSE A;  4N58 A;  3AA6 B;  4FT6 A;  2XTR A;  2POR A;  4AUI A;  4Z3T A;  3UPG A;  1MM5 A;  4FES A;  2K4T A;  4PUX A;  3WI5 A;  4D64 A;  1Q9G A;  2WJQ A;  1IZN B;  1GFO A;  1ZHW A;  2GE4 A;  1BXW A;  3NJT A;  5B5E O;  5H2F O;  3PGR A;  4FZL A;  4FQE A;  2KC0 A;  5JDP A;  2WVP A;  4D65 A;  1E54 A;  3JCU O;  3LK2 B;  3AA7 B;  4O4X A;  4PJ0 O;  3VE2 A;  6PRN A;  2XE2 A;  5T5F A;  1G90 A;  4E1T A;  2KDY A;  3DZM A;  3UAQ A;  3SZD A;  4RLB A;  4BUM X;  4FRX A;  1Q9F A;  2ODJ A;  2R89 A;  3POX A;  4CTD A;  2KZ7 B;  3UU2 A;  2Y0L A;  3AAE A;  3FYX A;  4U9C A;  2ZFG A;  2IWV A;  3PRN A;  5GV0 A;  5G3A A;  1MM4 A;  4GCS A;  2FGQ X;  2LHF A;  1MPF A;  3LK4 1;  2KXP A;  3QRA A;  4N74 A;  4O3X B;  1BH3 A;  1OSM A;  2R4P A;  3AA0 B;  3VZU X;  4G75 A;  5AFU K;  4JFB A;  3PF1 A;  2ZLD A;  4RL9 A;  5FVN A;  2MHL A;  5AFU L;  4AYN A;  4C4V B;  5DL6 A;  3GP6 A;  3HOL A;  4AKM A;  1QJ9 A;  1GFQ A;  1HXX A;  2JQY A;  4JCH A;  4LSF A;  4O3Z A;  5DL8 A;  2YPV A;  3LK4 2;  2Y0H A;  4AKR B;  2ERV A;  2XE1 A;  2O4V A;  4FRT A;  1IZN A;  5ADX L;  5ADX K;  5DL5 A;  1T1L A;  5TIS O;  2R8A A;  4F4B A;  1PRN A;  2N2M A;  1GFN A;  5D5D A;  2R88 A;  5IYU A;  5KAI O;  1OPF A;  3LK2 A;  4AZL A;  3PGS A;  4XNL A;  4QQ1 A;  3SYB A;  3SZV A;  3VY8 X;  4B61 A;  3WU2 O;  3K19 A;  3HOE A;  3POQ A;  3VZW X;  2YNK A;  2W80 C;  3PQU A;  3KZI O;  3LK3 B;  4N75 A;  5G38 A;  4IL6 O;  5DL7 A;  3RBH A;  4LSI A;  4C69 X;  2Y7S A;  3VY9 X;  3DA3 A;  5B66 O;  3QRC A;  2XG6 A;  1HXU A;  2W81 C;  2N2L A;  3A2S X;  3NSG A;  2J4U P;  1THQ A;  3HWB A;  4O49 A;  2QTK A;  2KXP B;  4E1S A;  3PGU A;  3AA1 A;  5EE2 A;  4AFK A;  2OMF A;  4GCP A;  4GF4 A;  2F1C X;  4UB6 O;  4K3C A;  5PRN A;  2PRN A;  2XE5 A;  3AAA B;  3G7G A;  4FZN A;  2J1N A;  2M07 A;  3DA4 A;  2R4L A;  1P4T A; 
#chains in the Genus database with same CATH homology
 5TIS O;  5G39 A;  5KAI O;  5KAF O;  3WU2 O;  5G3A A;  5G38 A;  3KZI O;  4UB8 O;  4IL6 O;  5GTI O;  3A0B O;  5B66 O;  5E79 O;  1S5L O;  2AXT O;  3A0H O;  5GTH O;  5B5E O;  5H2F O;  4UB6 O;  3JCU O;  4PJ0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...