5B5EO

Crystal structure analysis of photosystem ii complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 50
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b5eO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b5eO02
3WU2O 5GTHO 5GTIO 3A0BO 5B66O 4PJ0O 5G39A 5H2FO 1S5LO 5TISO 3JCUO 5G3AA 5KAIO 5B5EO 5KAFO 4IL6O 4UB6O 3KZIO 2AXTO 3A0HO 4UB8O 5E79O 5G38A
chains in the Genus database with same CATH superfamily
4XNLA 2FGQX 2GE4A 3UAQA 5GTIO 2KXPA 2WJQA 4AKRA 4C00A 2J4UP 1OPFA 1HXUA 3VY8X 4O3YA 3GP6A 5T5FA 3TZGA 2QTKA 3G7GA 4K3BA 5DL8A 3UU2A 2MHLA 3JCUO 3LK2B 4AUIA 2Y0KA 2KZ7A 3QRAA 4FZMA 4B61A 4FESA 4GCQA 1OSMA 2M07A 8PRNA 1QJPA 3PGRA 4U9CA 2KDYA 1GFQA 1G90A 3AAEA 2KXPB 1BH3A 2XTQA 4FQEA 4AKRB 3T20A 1ORMA 4C4VA 3KZIO 1Q9GA 2AXTO 3SZVA 3UPGA 2R4LA 4N74A 1ZHZA 3A0HO 1QJ8A 4LSFA 6PRNA 3AAAA 4N59A 4RJWA 4BUMX 4CTDA 1T16A 2KZ7B 3LK2A 4O3WA 5E79O 1Q9FA 2XE2A 4RL9A 2F1CX 3A2SX 2XMXA 3DZMA 3AAEB 4F4BA 3A0BO 2XG6A 3DWNA 2YNKA 3HWBA 3K19A 1BT9A 2ERVA 4G76A 4PJ0O 4LSIA 5G26A 1BXWA 2R8AA 2N2MA 1GFMA 3HOEA 4FSOA 1S5LO 1HXTA 2R4NA 2Y2XA 3AA1A 4FT6A 3AAAB 5G39A 3V8UA 4AYNA 4Z3TA 4GF4A 5ADXK 3DWOX 2LFUA 2K0LA 3VZUX 3AA7A 4FZLA 4RJXA 2F1VA 3WI5A 4FMSA 5B5EO 2PRNA 3BS0A 4IL6O 4E1SA 2R4PA 4G75A 4UB6O 5AFUK 3NJTA 3PQUA 3HOLA 4O4XA 2IWVA 2K4TA 3C5OA 3PRNA 2PORA 4PR7A 5EE2A 3RBHA 4E1TA 4KR8A 2R4OA 2Y7SA 4KR4A 3AA1B 4GCSA 4LSHA 3PGSA 3FYXA 2M06A 3SZDA 3VE2A 3VY9X 5G38A 2R88A 2ODJA 1H6S1 3AA7B 5IYUA 2ZFGA 4AFKA 4O3XB 3VE1A 1ZHWA 3AA0A 1MPFA 2J1NA 5D5DA 3POXA 5PRNA 3PGUA 2W80C 3LK42 7PRNA 3PORA 2JMMA 3T24A 5H2FO 2OMFA 3QRCA 3KVDD 2WVPA 4AZLA 3LK3A 4FSPA 5DL5A 5G3AA 5KAIO 3WI4A 3HW9A 1P4TA 4D65A 4N58A 4PUXA 4C4VB 4JCHA 5KAFO 3VZWX 1T1LA 1ZHYA 5JDPA 2WJRA 4JFBA 2XTRA 3AA0B 4C69X 2XE3A 2W81C 2N2LA 1THQA 4GCPA 1QJ9A 3LK3B 4UB8O 1GFOA 1PRNA 3DA3A 2Y0HA 2Y0LA 3POQA 4FRTA 3SY9A 3VZTX 5GV0A 4FZNA 3O0EA 3WU2O 3NSGA 4QQ1A 2R89A 3EMNX 4FOZA 5FVNA 3SY7A 5GTHO 2XE5A 1MM4A 4K3CA 2YPVA 3JTYA 5B66O 1GFPA 2F1TA 4RLBA 1MM5A 3POUA 4O49A 4AYEC 1IZNA 5TISO 3AA6A 4AYID 3DA4A 2X9KA 4AYMC 2JQYA 5ADXL 2XE1A 1ZHTA 4RLCA 3BRZA 1HXXA 3PF1A 4GHBA 4AYDC 4O3ZA 2MNHA 4D64A 3BRYA 1GFNA 4FUVA 4N75A 1ZHXA 2X27X 1YS5A 4XNKA 4AKMA 2FGRA 1E54A 5DL6A 3PQSA 3SYBA 5AFUL 3LK41 2LHFA 1IZNB 4O4UA 4D5UA 5DL7A 4FRXA 2IWWA 3AA6B 2O4VA 3SYSA 1PHOA 4LSEA 2KC0A 2ZLDA 3T0SA 4KRAA
chains in the Genus database with same CATH topology
3WU2O 5GTHO 5GTIO 3A0BO 5B66O 4PJ0O 5G39A 5H2FO 1S5LO 5TISO 3JCUO 5G3AA 5KAIO 5B5EO 5KAFO 4IL6O 4UB6O 3KZIO 2AXTO 3A0HO 4UB8O 5E79O 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 O;  5GTH O;  5GTI O;  3A0B O;  5B66 O;  4PJ0 O;  5G39 A;  5H2F O;  1S5L O;  5TIS O;  3JCU O;  5G3A A;  5KAI O;  5B5E O;  5KAF O;  4IL6 O;  4UB6 O;  3KZI O;  2AXT O;  3A0H O;  4UB8 O;  5E79 O;  5G38 A; 
#chains in the Genus database with same CATH topology
 4XNL A;  2FGQ X;  2GE4 A;  3UAQ A;  5GTI O;  2KXP A;  2WJQ A;  4AKR A;  4C00 A;  2J4U P;  1OPF A;  1HXU A;  3VY8 X;  4O3Y A;  3GP6 A;  5T5F A;  3TZG A;  2QTK A;  3G7G A;  4K3B A;  5DL8 A;  3UU2 A;  2MHL A;  3JCU O;  3LK2 B;  4AUI A;  2Y0K A;  2KZ7 A;  3QRA A;  4FZM A;  4B61 A;  4FES A;  4GCQ A;  1OSM A;  2M07 A;  8PRN A;  1QJP A;  3PGR A;  4U9C A;  2KDY A;  1GFQ A;  1G90 A;  3AAE A;  2KXP B;  1BH3 A;  2XTQ A;  4FQE A;  4AKR B;  3T20 A;  1ORM A;  4C4V A;  3KZI O;  1Q9G A;  2AXT O;  3SZV A;  3UPG A;  2R4L A;  4N74 A;  1ZHZ A;  3A0H O;  1QJ8 A;  4LSF A;  6PRN A;  3AAA A;  4N59 A;  4RJW A;  4BUM X;  4CTD A;  1T16 A;  2KZ7 B;  3LK2 A;  4O3W A;  5E79 O;  1Q9F A;  2XE2 A;  4RL9 A;  2F1C X;  3A2S X;  2XMX A;  3DZM A;  3AAE B;  4F4B A;  3A0B O;  2XG6 A;  3DWN A;  2YNK A;  3HWB A;  3K19 A;  1BT9 A;  2ERV A;  4G76 A;  4PJ0 O;  4LSI A;  5G26 A;  1BXW A;  2R8A A;  2N2M A;  1GFM A;  3HOE A;  4FSO A;  1S5L O;  1HXT A;  2R4N A;  2Y2X A;  3AA1 A;  4FT6 A;  3AAA B;  5G39 A;  3V8U A;  4AYN A;  4Z3T A;  4GF4 A;  5ADX K;  3DWO X;  2LFU A;  2K0L A;  3VZU X;  3AA7 A;  4FZL A;  4RJX A;  2F1V A;  3WI5 A;  4FMS A;  5B5E O;  2PRN A;  3BS0 A;  4IL6 O;  4E1S A;  2R4P A;  4G75 A;  4UB6 O;  5AFU K;  3NJT A;  3PQU A;  3HOL A;  4O4X A;  2IWV A;  2K4T A;  3C5O A;  3PRN A;  2POR A;  4PR7 A;  5EE2 A;  3RBH A;  4E1T A;  4KR8 A;  2R4O A;  2Y7S A;  4KR4 A;  3AA1 B;  4GCS A;  4LSH A;  3PGS A;  3FYX A;  2M06 A;  3SZD A;  3VE2 A;  3VY9 X;  5G38 A;  2R88 A;  2ODJ A;  1H6S 1;  3AA7 B;  5IYU A;  2ZFG A;  4AFK A;  4O3X B;  3VE1 A;  1ZHW A;  3AA0 A;  1MPF A;  2J1N A;  5D5D A;  3POX A;  5PRN A;  3PGU A;  2W80 C;  3LK4 2;  7PRN A;  3POR A;  2JMM A;  3T24 A;  5H2F O;  2OMF A;  3QRC A;  3KVD D;  2WVP A;  4AZL A;  3LK3 A;  4FSP A;  5DL5 A;  5G3A A;  5KAI O;  3WI4 A;  3HW9 A;  1P4T A;  4D65 A;  4N58 A;  4PUX A;  4C4V B;  4JCH A;  5KAF O;  3VZW X;  1T1L A;  1ZHY A;  5JDP A;  2WJR A;  4JFB A;  2XTR A;  3AA0 B;  4C69 X;  2XE3 A;  2W81 C;  2N2L A;  1THQ A;  4GCP A;  1QJ9 A;  3LK3 B;  4UB8 O;  1GFO A;  1PRN A;  3DA3 A;  2Y0H A;  2Y0L A;  3POQ A;  4FRT A;  3SY9 A;  3VZT X;  5GV0 A;  4FZN A;  3O0E A;  3WU2 O;  3NSG A;  4QQ1 A;  2R89 A;  3EMN X;  4FOZ A;  5FVN A;  3SY7 A;  5GTH O;  2XE5 A;  1MM4 A;  4K3C A;  2YPV A;  3JTY A;  5B66 O;  1GFP A;  2F1T A;  4RLB A;  1MM5 A;  3POU A;  4O49 A;  4AYE C;  1IZN A;  5TIS O;  3AA6 A;  4AYI D;  3DA4 A;  2X9K A;  4AYM C;  2JQY A;  5ADX L;  2XE1 A;  1ZHT A;  4RLC A;  3BRZ A;  1HXX A;  3PF1 A;  4GHB A;  4AYD C;  4O3Z A;  2MNH A;  4D64 A;  3BRY A;  1GFN A;  4FUV A;  4N75 A;  1ZHX A;  2X27 X;  1YS5 A;  4XNK A;  4AKM A;  2FGR A;  1E54 A;  5DL6 A;  3PQS A;  3SYB A;  5AFU L;  3LK4 1;  2LHF A;  1IZN B;  4O4U A;  4D5U A;  5DL7 A;  4FRX A;  2IWW A;  3AA6 B;  2O4V A;  3SYS A;  1PHO A;  4LSE A;  2KC0 A;  2ZLD A;  3T0S A;  4KRA A; 
#chains in the Genus database with same CATH homology
 3WU2 O;  5GTH O;  5GTI O;  3A0B O;  5B66 O;  4PJ0 O;  5G39 A;  5H2F O;  1S5L O;  5TIS O;  3JCU O;  5G3A A;  5KAI O;  5B5E O;  5KAF O;  4IL6 O;  4UB6 O;  3KZI O;  2AXT O;  3A0H O;  4UB8 O;  5E79 O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...