2Y0HA

Crystal structure of pseudomonas aeruginosa opdl
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
389
structure length
361
Chain Sequence
LADSSAHLDLRNFYQLRDYRQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLTSSEIEGLTLTAGQLWKSRTRESDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASYYYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTLRAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSRYGADLDENRFIVNYTLKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROBABLE PORIN
publication title Crystal Structure of Pseudomonas Aeruginosa Opdl
rcsb
source organism Pseudomonas aeruginosa
total genus 92
structure length 361
sequence length 389
ec nomenclature
pdb deposition date 2010-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2y0hA01
3PORA 4D64A 1GFQA 4LSHA 2O4VA 1PHOA 2XG6A 3HWBA 5DL7A 3K19A 3POUA 3SYBA 3VZTX 4FSPA 3WI4A 3PRNA 5JDPA 1GFOA 3SYSA 1OPFA 1BT9A 2ZLDA 6PRNA 1HXTA 4LSIA 4D65A 3O0EA 3HW9A 4C69X 5DL6A 2PRNA 3POQA 4KR4A 4RJWA 3UU2A 3VY9X 2XE3A 2FGRA 3WI5A 4JFBA 1PRNA 1BH3A 3JTYA 3SZVA 4FT6A 1H6S1 2Y0HA 4BUMX 3SY9A 3T20A 3VZWX 3T0SA 2Y0KA 3SY7A 1OSMA 4GCQA 4FMSA 3FYXA 3A2SX 2XE1A 2J4UP 4FOZA 4FRTA 4AUIA 4RJXA 1E54A 4D5UA 3VY8X 7PRNA 2Y2XA 1GFPA 8PRNA 2PORA 4KR8A 5FVNA 3SZDA 2ODJA 4FRXA 4LSFA 5PRNA 3POXA 2FGQX 5DL8A 3NSGA 2OMFA 3EMNX 4GCPA 1HXXA 2XE5A 1HXUA 1GFNA 2J1NA 1GFMA 4LSEA 2Y0LA 2ZFGA 3T24A 1MPFA 3UPGA 5DL5A 2XE2A 4GCSA 4KRAA 3VZUX 2QTKA 2K4TA 4FSOA
chains in the Genus database with same CATH superfamily
3PORA 4D64A 4GHBA 2IWWA 1GFQA 2X27X 4LSHA 2O4VA 3NJTA 1PHOA 2XG6A 2M06A 4AYDC 2KDYA 1IZNB 3AA1A 1THQA 3HOLA 4FESA 4C00A 3HWBA 2XTRA 3AAAA 1ZHWA 5AFUL 3V8UA 4G76A 2R89A 3K19A 2AXTO 3POUA 4RL9A 5DL7A 3SYBA 1T1LA 4F4BA 3VZTX 5GV0A 4O3YA 2WJRA 4RLBA 3VE1A 4FSPA 5G39A 3WI4A 2R88A 3PRNA 5ADXK 5JDPA 4AYMC 1GFOA 4N75A 4O4UA 3SYSA 5B5EO 3QRAA 2W80C 3PGUA 3GP6A 4K3CA 4E1SA 1OPFA 4PJ0O 3AAEA 2KXPB 4CTDA 3PGSA 1BT9A 2R4OA 3UPGA 2WVPA 2ZLDA 2XMXA 3PGRA 3PQUA 2JQYA 4FZMA 5KAFO 4UB6O 1HXTA 6PRNA 1IZNA 5EE2A 5IYUA 1QJ8A 2MHLA 4LSIA 1S5LO 1ZHXA 2N2LA 3LK41 4JCHA 3O0EA 4D65A 2MNHA 1Q9GA 3TZGA 5G3AA 3HW9A 3WU2O 4C69X 5DL6A 3G7GA 1P4TA 2PRNA 4G75A 5G38A 1ZHTA 2LFUA 3KZIO 3POQA 1MM4A 2ERVA 3JCUO 3AA7A 2M07A 3HOEA 4KR4A 4RJWA 4IL6O 2XE3A 4XNLA 3UU2A 3VY9X 4O49A 2R4PA 2R8AA 2FGRA 2N2MA 3AA7B 4UB8O 5D5DA 3WI5A 4AKRB 4JFBA 1PRNA 1BH3A 2XTQA 1ZHZA 2KXPA 5ADXL 1Q9FA 5H2FO 3KVDD 3JTYA 2YPVA 4FUVA 4QQ1A 4C4VB 4FZNA 3SZVA 4FT6A 1H6S1 2Y0HA 3C5OA 2F1TA 3DZMA 2JMMA 2X9KA 4BUMX 3SY9A 4O3WA 3BRYA 3T20A 3AA6B 3VZWX 2R4LA 3LK3A 4U9CA 5TISO 2KZ7A 2Y0KA 4O4XA 1OSMA 4GCQA 3SY7A 3T0SA 4FMSA 3FYXA 2K0LA 3A2SX 2XE1A 3LK3B 4FZLA 2KZ7B 4XNKA 4FOZA 4AYNA 4AZLA 2J4UP 1QJ9A 3DA4A 1YS5A 4FRTA 4AFKA 4AUIA 4RJXA 2IWVA 3AA0A 3QRCA 4AYEC 1E54A 4D5UA 3VY8X 7PRNA 2Y2XA 4B61A 3AA0B 4AKRA 5KAIO 1G90A 1GFPA 4O3XB 8PRNA 4AYID 2PORA 4KR8A 5FVNA 3SZDA 2ODJA 4FRXA 4LSFA 5PRNA 4C4VA 4FQEA 2FGQX 3POXA 2WJQA 3DWNA 2OMFA 2W81C 3NSGA 4N59A 4O3ZA 5DL8A 2YNKA 2F1CX 4N74A 3RBHA 3EMNX 4GCPA 5GTHO 3A0BO 5AFUK 3DWOX 3DA3A 3PQSA 3AA6A 4E1TA 1T16A 2GE4A 1HXXA 3BS0A 2XE5A 3AA1B 1ORMA 5B66O 3PF1A 4GF4A 1MM5A 1HXUA 3AAAB 1GFNA 3UAQA 2KC0A 1QJPA 2J1NA 3BRZA 2F1VA 3A0HO 5GTIO 1GFMA 4LSEA 2Y0LA 2ZFGA 4PR7A 3T24A 1MPFA 5G26A 4N58A 2XE2A 4PUXA 4RLCA 3LK2A 5DL5A 2Y7SA 4AKMA 4GCSA 2R4NA 4KRAA 5E79O 2LHFA 2QTKA 3VE2A 3VZUX 4Z3TA 3LK2B 1ZHYA 2K4TA 5T5FA 3LK42 4K3BA 3AAEB 1BXWA 4FSOA
chains in the Genus database with same CATH topology
3PORA 4D64A 4GHBA 1GFQA 2X27X 4LSHA 2O4VA 1PHOA 2XG6A 2M06A 4AYDC 2KDYA 1IZNB 3AA1A 1THQA 3HOLA 4FESA 3HWBA 2XTRA 3AAAA 1ZHWA 5AFUL 3V8UA 4G76A 5DL7A 3K19A 3POUA 4RL9A 3SYBA 5GV0A 4F4BA 3VZTX 4O3YA 4RLBA 3VE1A 4FSPA 3WI4A 3PRNA 5ADXK 5JDPA 4AYMC 1GFOA 3SYSA 4O4UA 3QRAA 2W80C 3GP6A 4E1SA 1OPFA 3AAEA 2KXPB 1BT9A 3UPGA 3PQUA 2ZLDA 2XMXA 4FZMA 6PRNA 1HXTA 1IZNA 5EE2A 5IYUA 1QJ8A 2MHLA 4LSIA 1ZHXA 2N2LA 3LK41 4JCHA 3O0EA 4D65A 2MNHA 1Q9GA 3TZGA 3HW9A 4C69X 5DL6A 3G7GA 1P4TA 2PRNA 4G75A 1ZHTA 2LFUA 3POQA 1MM4A 2ERVA 4KR4A 3AA7A 2M07A 3HOEA 4RJWA 4XNLA 3UU2A 2XE3A 3VY9X 4O49A 5D5DA 2FGRA 2N2MA 3AA7B 3WI5A 4AKRB 4JFBA 1PRNA 1BH3A 2XTQA 1ZHZA 2KXPA 5ADXL 1Q9FA 3KVDD 3JTYA 2YPVA 4FUVA 4QQ1A 4FZNA 3SZVA 4FT6A 1H6S1 2Y0HA 3C5OA 2F1TA 2JMMA 4BUMX 3SY9A 4O3WA 3T20A 3AA6B 3VZWX 3LK3A 4U9CA 2KZ7A 2Y0KA 4O4XA 1OSMA 4GCQA 3SY7A 3T0SA 4FMSA 3FYXA 2K0LA 3A2SX 2XE1A 3LK3B 4FZLA 2KZ7B 4XNKA 4FOZA 4AYNA 4AZLA 2J4UP 1QJ9A 3DA4A 1YS5A 4FRTA 4AFKA 4AUIA 4RJXA 3AA0A 3QRCA 4AYEC 1E54A 4D5UA 3VY8X 7PRNA 2Y2XA 4B61A 3AA0B 4AKRA 1G90A 1GFPA 4O3XB 8PRNA 4AYID 2PORA 4KR8A 5FVNA 3SZDA 2ODJA 4FRXA 4LSFA 5PRNA 2FGQX 3POXA 5DL8A 2W81C 2OMFA 3NSGA 4N59A 4O3ZA 3RBHA 2YNKA 3EMNX 4GCPA 5AFUK 3DA3A 3PQSA 3AA6A 4E1TA 2GE4A 1HXXA 2XE5A 3AA1B 1ORMA 4GF4A 1MM5A 1HXUA 3AAAB 1GFNA 3UAQA 2KC0A 1QJPA 2J1NA 2F1VA 1GFMA 4LSEA 2Y0LA 2ZFGA 3T24A 1MPFA 5G26A 4N58A 2XE2A 4PUXA 4RLCA 3LK2A 5DL5A 2Y7SA 4AKMA 4GCSA 3VE2A 4KRAA 3VZUX 2LHFA 2QTKA 4Z3TA 3LK2B 1ZHYA 2K4TA 5T5FA 3LK42 3AAEB 1BXWA 4FSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POR A;  4D64 A;  1GFQ A;  4LSH A;  2O4V A;  1PHO A;  2XG6 A;  3HWB A;  5DL7 A;  3K19 A;  3POU A;  3SYB A;  3VZT X;  4FSP A;  3WI4 A;  3PRN A;  5JDP A;  1GFO A;  3SYS A;  1OPF A;  1BT9 A;  2ZLD A;  6PRN A;  1HXT A;  4LSI A;  4D65 A;  3O0E A;  3HW9 A;  4C69 X;  5DL6 A;  2PRN A;  3POQ A;  4KR4 A;  4RJW A;  3UU2 A;  3VY9 X;  2XE3 A;  2FGR A;  3WI5 A;  4JFB A;  1PRN A;  1BH3 A;  3JTY A;  3SZV A;  4FT6 A;  1H6S 1;  2Y0H A;  4BUM X;  3SY9 A;  3T20 A;  3VZW X;  3T0S A;  2Y0K A;  3SY7 A;  1OSM A;  4GCQ A;  4FMS A;  3FYX A;  3A2S X;  2XE1 A;  2J4U P;  4FOZ A;  4FRT A;  4AUI A;  4RJX A;  1E54 A;  4D5U A;  3VY8 X;  7PRN A;  2Y2X A;  1GFP A;  8PRN A;  2POR A;  4KR8 A;  5FVN A;  3SZD A;  2ODJ A;  4FRX A;  4LSF A;  5PRN A;  3POX A;  2FGQ X;  5DL8 A;  3NSG A;  2OMF A;  3EMN X;  4GCP A;  1HXX A;  2XE5 A;  1HXU A;  1GFN A;  2J1N A;  1GFM A;  4LSE A;  2Y0L A;  2ZFG A;  3T24 A;  1MPF A;  3UPG A;  5DL5 A;  2XE2 A;  4GCS A;  4KRA A;  3VZU X;  2QTK A;  2K4T A;  4FSO A; 
#chains in the Genus database with same CATH topology
 3POR A;  4D64 A;  4GHB A;  2IWW A;  1GFQ A;  2X27 X;  4LSH A;  2O4V A;  3NJT A;  1PHO A;  2XG6 A;  2M06 A;  4AYD C;  2KDY A;  1IZN B;  3AA1 A;  1THQ A;  3HOL A;  4FES A;  4C00 A;  3HWB A;  2XTR A;  3AAA A;  1ZHW A;  5AFU L;  3V8U A;  4G76 A;  2R89 A;  3K19 A;  2AXT O;  3POU A;  4RL9 A;  5DL7 A;  3SYB A;  1T1L A;  4F4B A;  3VZT X;  5GV0 A;  4O3Y A;  2WJR A;  4RLB A;  3VE1 A;  4FSP A;  5G39 A;  3WI4 A;  2R88 A;  3PRN A;  5ADX K;  5JDP A;  4AYM C;  1GFO A;  4N75 A;  4O4U A;  3SYS A;  5B5E O;  3QRA A;  2W80 C;  3PGU A;  3GP6 A;  4K3C A;  4E1S A;  1OPF A;  4PJ0 O;  3AAE A;  2KXP B;  4CTD A;  3PGS A;  1BT9 A;  2R4O A;  3UPG A;  2WVP A;  2ZLD A;  2XMX A;  3PGR A;  3PQU A;  2JQY A;  4FZM A;  5KAF O;  4UB6 O;  1HXT A;  6PRN A;  1IZN A;  5EE2 A;  5IYU A;  1QJ8 A;  2MHL A;  4LSI A;  1S5L O;  1ZHX A;  2N2L A;  3LK4 1;  4JCH A;  3O0E A;  4D65 A;  2MNH A;  1Q9G A;  3TZG A;  5G3A A;  3HW9 A;  3WU2 O;  4C69 X;  5DL6 A;  3G7G A;  1P4T A;  2PRN A;  4G75 A;  5G38 A;  1ZHT A;  2LFU A;  3KZI O;  3POQ A;  1MM4 A;  2ERV A;  3JCU O;  3AA7 A;  2M07 A;  3HOE A;  4KR4 A;  4RJW A;  4IL6 O;  2XE3 A;  4XNL A;  3UU2 A;  3VY9 X;  4O49 A;  2R4P A;  2R8A A;  2FGR A;  2N2M A;  3AA7 B;  4UB8 O;  5D5D A;  3WI5 A;  4AKR B;  4JFB A;  1PRN A;  1BH3 A;  2XTQ A;  1ZHZ A;  2KXP A;  5ADX L;  1Q9F A;  5H2F O;  3KVD D;  3JTY A;  2YPV A;  4FUV A;  4QQ1 A;  4C4V B;  4FZN A;  3SZV A;  4FT6 A;  1H6S 1;  2Y0H A;  3C5O A;  2F1T A;  3DZM A;  2JMM A;  2X9K A;  4BUM X;  3SY9 A;  4O3W A;  3BRY A;  3T20 A;  3AA6 B;  3VZW X;  2R4L A;  3LK3 A;  4U9C A;  5TIS O;  2KZ7 A;  2Y0K A;  4O4X A;  1OSM A;  4GCQ A;  3SY7 A;  3T0S A;  4FMS A;  3FYX A;  2K0L A;  3A2S X;  2XE1 A;  3LK3 B;  4FZL A;  2KZ7 B;  4XNK A;  4FOZ A;  4AYN A;  4AZL A;  2J4U P;  1QJ9 A;  3DA4 A;  1YS5 A;  4FRT A;  4AFK A;  4AUI A;  4RJX A;  2IWV A;  3AA0 A;  3QRC A;  4AYE C;  1E54 A;  4D5U A;  3VY8 X;  7PRN A;  2Y2X A;  4B61 A;  3AA0 B;  4AKR A;  5KAI O;  1G90 A;  1GFP A;  4O3X B;  8PRN A;  4AYI D;  2POR A;  4KR8 A;  5FVN A;  3SZD A;  2ODJ A;  4FRX A;  4LSF A;  5PRN A;  4C4V A;  4FQE A;  2FGQ X;  3POX A;  2WJQ A;  3DWN A;  2OMF A;  2W81 C;  3NSG A;  4N59 A;  4O3Z A;  5DL8 A;  2YNK A;  2F1C X;  4N74 A;  3RBH A;  3EMN X;  4GCP A;  5GTH O;  3A0B O;  5AFU K;  3DWO X;  3DA3 A;  3PQS A;  3AA6 A;  4E1T A;  1T16 A;  2GE4 A;  1HXX A;  3BS0 A;  2XE5 A;  3AA1 B;  1ORM A;  5B66 O;  3PF1 A;  4GF4 A;  1MM5 A;  1HXU A;  3AAA B;  1GFN A;  3UAQ A;  2KC0 A;  1QJP A;  2J1N A;  3BRZ A;  2F1V A;  3A0H O;  5GTI O;  1GFM A;  4LSE A;  2Y0L A;  2ZFG A;  4PR7 A;  3T24 A;  1MPF A;  5G26 A;  4N58 A;  2XE2 A;  4PUX A;  4RLC A;  3LK2 A;  5DL5 A;  2Y7S A;  4AKM A;  4GCS A;  2R4N A;  4KRA A;  5E79 O;  2LHF A;  2QTK A;  3VE2 A;  3VZU X;  4Z3T A;  3LK2 B;  1ZHY A;  2K4T A;  5T5F A;  3LK4 2;  4K3B A;  3AAE B;  1BXW A;  4FSO A; 
#chains in the Genus database with same CATH homology
 3POR A;  4D64 A;  4GHB A;  1GFQ A;  2X27 X;  4LSH A;  2O4V A;  1PHO A;  2XG6 A;  2M06 A;  4AYD C;  2KDY A;  1IZN B;  3AA1 A;  1THQ A;  3HOL A;  4FES A;  3HWB A;  2XTR A;  3AAA A;  1ZHW A;  5AFU L;  3V8U A;  4G76 A;  5DL7 A;  3K19 A;  3POU A;  4RL9 A;  3SYB A;  5GV0 A;  4F4B A;  3VZT X;  4O3Y A;  4RLB A;  3VE1 A;  4FSP A;  3WI4 A;  3PRN A;  5ADX K;  5JDP A;  4AYM C;  1GFO A;  3SYS A;  4O4U A;  3QRA A;  2W80 C;  3GP6 A;  4E1S A;  1OPF A;  3AAE A;  2KXP B;  1BT9 A;  3UPG A;  3PQU A;  2ZLD A;  2XMX A;  4FZM A;  6PRN A;  1HXT A;  1IZN A;  5EE2 A;  5IYU A;  1QJ8 A;  2MHL A;  4LSI A;  1ZHX A;  2N2L A;  3LK4 1;  4JCH A;  3O0E A;  4D65 A;  2MNH A;  1Q9G A;  3TZG A;  3HW9 A;  4C69 X;  5DL6 A;  3G7G A;  1P4T A;  2PRN A;  4G75 A;  1ZHT A;  2LFU A;  3POQ A;  1MM4 A;  2ERV A;  4KR4 A;  3AA7 A;  2M07 A;  3HOE A;  4RJW A;  4XNL A;  3UU2 A;  2XE3 A;  3VY9 X;  4O49 A;  5D5D A;  2FGR A;  2N2M A;  3AA7 B;  3WI5 A;  4AKR B;  4JFB A;  1PRN A;  1BH3 A;  2XTQ A;  1ZHZ A;  2KXP A;  5ADX L;  1Q9F A;  3KVD D;  3JTY A;  2YPV A;  4FUV A;  4QQ1 A;  4FZN A;  3SZV A;  4FT6 A;  1H6S 1;  2Y0H A;  3C5O A;  2F1T A;  2JMM A;  4BUM X;  3SY9 A;  4O3W A;  3T20 A;  3AA6 B;  3VZW X;  3LK3 A;  4U9C A;  2KZ7 A;  2Y0K A;  4O4X A;  1OSM A;  4GCQ A;  3SY7 A;  3T0S A;  4FMS A;  3FYX A;  2K0L A;  3A2S X;  2XE1 A;  3LK3 B;  4FZL A;  2KZ7 B;  4XNK A;  4FOZ A;  4AYN A;  4AZL A;  2J4U P;  1QJ9 A;  3DA4 A;  1YS5 A;  4FRT A;  4AFK A;  4AUI A;  4RJX A;  3AA0 A;  3QRC A;  4AYE C;  1E54 A;  4D5U A;  3VY8 X;  7PRN A;  2Y2X A;  4B61 A;  3AA0 B;  4AKR A;  1G90 A;  1GFP A;  4O3X B;  8PRN A;  4AYI D;  2POR A;  4KR8 A;  5FVN A;  3SZD A;  2ODJ A;  4FRX A;  4LSF A;  5PRN A;  2FGQ X;  3POX A;  5DL8 A;  2W81 C;  2OMF A;  3NSG A;  4N59 A;  4O3Z A;  3RBH A;  2YNK A;  3EMN X;  4GCP A;  5AFU K;  3DA3 A;  3PQS A;  3AA6 A;  4E1T A;  2GE4 A;  1HXX A;  2XE5 A;  3AA1 B;  1ORM A;  4GF4 A;  1MM5 A;  1HXU A;  3AAA B;  1GFN A;  3UAQ A;  2KC0 A;  1QJP A;  2J1N A;  2F1V A;  1GFM A;  4LSE A;  2Y0L A;  2ZFG A;  3T24 A;  1MPF A;  5G26 A;  4N58 A;  2XE2 A;  4PUX A;  4RLC A;  3LK2 A;  5DL5 A;  2Y7S A;  4AKM A;  4GCS A;  3VE2 A;  4KRA A;  3VZU X;  2LHF A;  2QTK A;  4Z3T A;  3LK2 B;  1ZHY A;  2K4T A;  5T5F A;  3LK4 2;  3AAE B;  1BXW A;  4FSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...