2Y0HA

Crystal structure of pseudomonas aeruginosa opdl
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
389
structure length
361
Chain Sequence
LADSSAHLDLRNFYQLRDYRQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLTSSEIEGLTLTAGQLWKSRTRESDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASYYYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTLRAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSRYGADLDENRFIVNYTLKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas Aeruginosa Opdl
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords PROBABLE PORIN
total genus 92
structure length 361
sequence length 389
ec nomenclature
pdb deposition date 2010-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2y0hA01
1HXTA 3POXA 3VY9X 2QTKA 1HXXA 1GFMA 1BH3A 5DL5A 3PRNA 3PORA 4AUIA 3A2SX 5FVNA 2Y0LA 4RJWA 2Y0KA 3EMNX 3T0SA 3SZVA 1GFNA 4D65A 4LSHA 2Y2XA 1OSMA 3SY9A 2XE1A 8PRNA 2PRNA 2FGRA 3SYSA 4KR4A 2XE2A 4RJXA 1E54A 4KRAA 2ODJA 3SY7A 1H6S1 4LSFA 3NSGA 3VZWX 3WI5A 3HW9A 4C69X 4D64A 1GFQA 1MPFA 2J4UP 1PRNA 2ZLDA 3WI4A 3JTYA 3K19A 3VY8X 4FRTA 3SZDA 4FT6A 3VZUX 3T24A 1GFPA 2Y0HA 6PRNA 1BT9A 4GCSA 5DL8A 2XE5A 4FMSA 7PRNA 3UU2A 2FGQX 3T20A 2ZFGA 4FOZA 4D5UA 3HWBA 3POUA 1OPFA 2XE3A 5DL6A 2OMFA 3FYXA 2PORA 5PRNA 4BUMX 3UPGA 4FRXA 4GCQA 2K4TA 4KR8A 1PHOA 2XG6A 4GCPA 3SYBA 4JFBA 3POQA 2J1NA 4LSEA 4FSPA 4LSIA 1HXUA 3VZTX 2O4VA 4FSOA 1GFOA 5JDPA 3O0EA 5DL7A
chains in the Genus database with same CATH superfamily
3QRAA 1HXTA 1ZHTA 3JCUO 1MM5A 3POXA 4G76A 3RBHA 3DA4A 4O3ZA 1QJPA 1QJ9A 3VY9X 3AA6B 2F1VA 4N74A 2QTKA 1HXXA 3DA3A 4N59A 1GFMA 4RLCA 1BH3A 2IWWA 2KZ7B 4AYID 3BRYA 4O3XB 2AXTO 2KC0A 2KXPA 3PRNA 5DL5A 2F1TA 3PORA 1BXWA 3LK3A 4U9CA 5TISO 5B5EO 4AUIA 3A2SX 1QJ8A 5ADXK 3C5OA 5GTIO 4AZLA 3PGUA 5FVNA 2Y0LA 4RJWA 2Y0KA 3EMNX 4E1TA 4K3BA 3QRCA 3T0SA 3VE2A 2K0LA 3SZVA 4AFKA 1P4TA 2WJRA 4C4VA 4FZNA 1GFNA 2JMMA 4D65A 4O3YA 3PQSA 1Q9FA 4CTDA 4LSHA 5G38A 3AAAA 4O4XA 4FQEA 2Y2XA 4O3WA 1OSMA 2R4OA 2XE1A 3A0HO 3PF1A 3SY9A 1IZNB 8PRNA 2PRNA 2FGRA 3SYSA 3WU2O 4KR4A 2R88A 3KZIO 3VE1A 3HOLA 2YNKA 4PJ0O 3KVDD 2XE2A 4RJXA 5EE2A 1E54A 3GP6A 4KRAA 3AAEB 2ODJA 4FESA 1THQA 3SY7A 1H6S1 4LSFA 3UAQA 2X27X 2YPVA 1YS5A 3NSGA 3A0BO 3PGSA 3VZWX 3WI5A 3HW9A 4FUVA 4C69X 4PR7A 2KXPB 1ZHWA 4AKRA 3AA1B 3DWNA 4G75A 4GHBA 2KZ7A 4RLBA 4XNLA 1GFQA 1T16A 1MPFA 1IZNA 4K3CA 3PQUA 4PUXA 4XNKA 4AYEC 1PRNA 4QQ1A 4AKMA 2ZLDA 2J4UP 3WI4A 3JTYA 3K19A 2JQYA 1ORMA 3VY8X 4FRTA 3SZDA 3LK42 5G39A 4FT6A 5ADXL 3VZUX 2IWVA 2LHFA 4AYMC 1T1LA 3T24A 4UB6O 4AYNA 4C00A 3LK3B 1ZHYA 1GFPA 4E1SA 3AAEA 3AA0A 5GV0A 5B66O 4FZMA 5T5FA 2Y0HA 5D5DA 2MHLA 1G90A 2R4PA 1BT9A 3LK2B 4GCSA 6PRNA 5DL8A 2XE5A 4FMSA 7PRNA 5GTHO 3UU2A 2FGQX 3T20A 1ZHZA 4N75A 5G3AA 2ZFGA 4GF4A 4FOZA 4C4VB 5AFUK 4JCHA 2F1CX 4D5UA 2GE4A 2W81C 3AA1A 2XMXA 3G7GA 3HWBA 3POUA 4B61A 1OPFA 2XE3A 5H2FO 4N58A 5DL6A 3NJTA 2OMFA 2WJQA 1ZHXA 3FYXA 2PORA 5PRNA 2XTQA 4BUMX 2Y7SA 4UB8O 5IYUA 3DZMA 4F4BA 4D64A 3UPGA 1S5LO 3BS0A 5E79O 2R89A 4FRXA 4GCQA 3DWOX 4AKRB 4RL9A 2M07A 2N2LA 2K4TA 2X9KA 2W80C 5AFUL 3LK2A 3AA6A 2R4NA 4FZLA 2WVPA 2N2MA 4IL6O 4KR8A 5G26A 1PHOA 5KAFO 2XG6A 4GCPA 2MNHA 3SYBA 3V8UA 2M06A 4JFBA 3POQA 2J1NA 3AAAB 4LSEA 4FSPA 2LFUA 3AA7A 1HXUA 1MM4A 3LK41 4LSIA 3VZTX 3HOEA 4Z3TA 1Q9GA 2O4VA 2ERVA 3PGRA 4FSOA 1GFOA 4AYDC 3TZGA 3BRZA 2XTRA 3AA0B 2R8AA 3O0EA 4O4UA 5JDPA 3AA7B 2R4LA 4O49A 5DL7A 5KAIO 2KDYA
chains in the Genus database with same CATH topology
3QRAA 1HXTA 1ZHTA 1MM5A 3POXA 4G76A 3RBHA 3DA4A 4O3ZA 1QJPA 1QJ9A 3VY9X 3AA6B 2F1VA 2QTKA 1HXXA 3DA3A 4N59A 1GFMA 4RLCA 1BH3A 2KZ7B 4AYID 4O3XB 2KC0A 3PRNA 2KXPA 5DL5A 2F1TA 3PORA 1BXWA 3LK3A 4U9CA 4AUIA 3A2SX 1QJ8A 5ADXK 3C5OA 4AZLA 5FVNA 2Y0LA 4RJWA 2Y0KA 3EMNX 4E1TA 3QRCA 3T0SA 3VE2A 2K0LA 3SZVA 4AFKA 1P4TA 4FZNA 1GFNA 2JMMA 4D65A 4O3YA 3PQSA 1Q9FA 4LSHA 3AAAA 4O4XA 2Y2XA 4O3WA 1OSMA 3SY9A 2XE1A 1IZNB 8PRNA 2PRNA 2FGRA 3SYSA 4KR4A 3VE1A 3HOLA 2YNKA 5EE2A 3KVDD 2XE2A 4RJXA 1E54A 3GP6A 4KRAA 3AAEB 2ODJA 4FESA 1THQA 3SY7A 1H6S1 4LSFA 3UAQA 2X27X 2YPVA 1YS5A 3NSGA 3VZWX 3WI5A 3HW9A 4FUVA 4C69X 2KXPB 1ZHWA 4AKRA 3AA1B 4D64A 4G75A 4GHBA 2KZ7A 4RLBA 4XNLA 1GFQA 1MPFA 1IZNA 4PUXA 3PQUA 4XNKA 4AYEC 1PRNA 4QQ1A 4AKMA 2ZLDA 2J4UP 3WI4A 3JTYA 3K19A 1ORMA 3VY8X 4FRTA 3SZDA 3LK42 5ADXL 4FT6A 3VZUX 2LHFA 4AYNA 4AYMC 3T24A 4E1SA 3LK3B 1ZHYA 1GFPA 3AAEA 3AA0A 5GV0A 4FZMA 5T5FA 2Y0HA 5D5DA 2MHLA 1G90A 6PRNA 1BT9A 3LK2B 4GCSA 5DL8A 2XE5A 4FMSA 7PRNA 3UU2A 2FGQX 3T20A 1ZHZA 2ZFGA 4GF4A 4FOZA 5AFUK 4JCHA 4D5UA 2GE4A 2W81C 3AA1A 2XMXA 3G7GA 3HWBA 3POUA 4B61A 1OPFA 2XE3A 4N58A 5DL6A 2OMFA 1ZHXA 3FYXA 2PORA 5PRNA 2XTQA 4BUMX 2Y7SA 5IYUA 4F4BA 3UPGA 4FRXA 4GCQA 4AKRB 4RL9A 2M07A 2N2LA 2K4TA 2W80C 5AFUL 3LK2A 3AA6A 4FZLA 5G26A 2N2MA 4KR8A 1PHOA 2XG6A 4GCPA 2MNHA 3SYBA 3V8UA 2M06A 4JFBA 3POQA 2J1NA 3AAAB 4LSEA 4FSPA 2LFUA 3AA7A 1HXUA 1MM4A 3LK41 4LSIA 3VZTX 3HOEA 4Z3TA 1Q9GA 2O4VA 2ERVA 4FSOA 4AYDC 1GFOA 3TZGA 2XTRA 3AA0B 4O4UA 5JDPA 3AA7B 3O0EA 4O49A 5DL7A 2KDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXT A;  3POX A;  3VY9 X;  2QTK A;  1HXX A;  1GFM A;  1BH3 A;  5DL5 A;  3PRN A;  3POR A;  4AUI A;  3A2S X;  5FVN A;  2Y0L A;  4RJW A;  2Y0K A;  3EMN X;  3T0S A;  3SZV A;  1GFN A;  4D65 A;  4LSH A;  2Y2X A;  1OSM A;  3SY9 A;  2XE1 A;  8PRN A;  2PRN A;  2FGR A;  3SYS A;  4KR4 A;  2XE2 A;  4RJX A;  1E54 A;  4KRA A;  2ODJ A;  3SY7 A;  1H6S 1;  4LSF A;  3NSG A;  3VZW X;  3WI5 A;  3HW9 A;  4C69 X;  4D64 A;  1GFQ A;  1MPF A;  2J4U P;  1PRN A;  2ZLD A;  3WI4 A;  3JTY A;  3K19 A;  3VY8 X;  4FRT A;  3SZD A;  4FT6 A;  3VZU X;  3T24 A;  1GFP A;  2Y0H A;  6PRN A;  1BT9 A;  4GCS A;  5DL8 A;  2XE5 A;  4FMS A;  7PRN A;  3UU2 A;  2FGQ X;  3T20 A;  2ZFG A;  4FOZ A;  4D5U A;  3HWB A;  3POU A;  1OPF A;  2XE3 A;  5DL6 A;  2OMF A;  3FYX A;  2POR A;  5PRN A;  4BUM X;  3UPG A;  4FRX A;  4GCQ A;  2K4T A;  4KR8 A;  1PHO A;  2XG6 A;  4GCP A;  3SYB A;  4JFB A;  3POQ A;  2J1N A;  4LSE A;  4FSP A;  4LSI A;  1HXU A;  3VZT X;  2O4V A;  4FSO A;  1GFO A;  5JDP A;  3O0E A;  5DL7 A; 
#chains in the Genus database with same CATH topology
 3QRA A;  1HXT A;  1ZHT A;  3JCU O;  1MM5 A;  3POX A;  4G76 A;  3RBH A;  3DA4 A;  4O3Z A;  1QJP A;  1QJ9 A;  3VY9 X;  3AA6 B;  2F1V A;  4N74 A;  2QTK A;  1HXX A;  3DA3 A;  4N59 A;  1GFM A;  4RLC A;  1BH3 A;  2IWW A;  2KZ7 B;  4AYI D;  3BRY A;  4O3X B;  2AXT O;  2KC0 A;  2KXP A;  3PRN A;  5DL5 A;  2F1T A;  3POR A;  1BXW A;  3LK3 A;  4U9C A;  5TIS O;  5B5E O;  4AUI A;  3A2S X;  1QJ8 A;  5ADX K;  3C5O A;  5GTI O;  4AZL A;  3PGU A;  5FVN A;  2Y0L A;  4RJW A;  2Y0K A;  3EMN X;  4E1T A;  4K3B A;  3QRC A;  3T0S A;  3VE2 A;  2K0L A;  3SZV A;  4AFK A;  1P4T A;  2WJR A;  4C4V A;  4FZN A;  1GFN A;  2JMM A;  4D65 A;  4O3Y A;  3PQS A;  1Q9F A;  4CTD A;  4LSH A;  5G38 A;  3AAA A;  4O4X A;  4FQE A;  2Y2X A;  4O3W A;  1OSM A;  2R4O A;  2XE1 A;  3A0H O;  3PF1 A;  3SY9 A;  1IZN B;  8PRN A;  2PRN A;  2FGR A;  3SYS A;  3WU2 O;  4KR4 A;  2R88 A;  3KZI O;  3VE1 A;  3HOL A;  2YNK A;  4PJ0 O;  3KVD D;  2XE2 A;  4RJX A;  5EE2 A;  1E54 A;  3GP6 A;  4KRA A;  3AAE B;  2ODJ A;  4FES A;  1THQ A;  3SY7 A;  1H6S 1;  4LSF A;  3UAQ A;  2X27 X;  2YPV A;  1YS5 A;  3NSG A;  3A0B O;  3PGS A;  3VZW X;  3WI5 A;  3HW9 A;  4FUV A;  4C69 X;  4PR7 A;  2KXP B;  1ZHW A;  4AKR A;  3AA1 B;  3DWN A;  4G75 A;  4GHB A;  2KZ7 A;  4RLB A;  4XNL A;  1GFQ A;  1T16 A;  1MPF A;  1IZN A;  4K3C A;  3PQU A;  4PUX A;  4XNK A;  4AYE C;  1PRN A;  4QQ1 A;  4AKM A;  2ZLD A;  2J4U P;  3WI4 A;  3JTY A;  3K19 A;  2JQY A;  1ORM A;  3VY8 X;  4FRT A;  3SZD A;  3LK4 2;  5G39 A;  4FT6 A;  5ADX L;  3VZU X;  2IWV A;  2LHF A;  4AYM C;  1T1L A;  3T24 A;  4UB6 O;  4AYN A;  4C00 A;  3LK3 B;  1ZHY A;  1GFP A;  4E1S A;  3AAE A;  3AA0 A;  5GV0 A;  5B66 O;  4FZM A;  5T5F A;  2Y0H A;  5D5D A;  2MHL A;  1G90 A;  2R4P A;  1BT9 A;  3LK2 B;  4GCS A;  6PRN A;  5DL8 A;  2XE5 A;  4FMS A;  7PRN A;  5GTH O;  3UU2 A;  2FGQ X;  3T20 A;  1ZHZ A;  4N75 A;  5G3A A;  2ZFG A;  4GF4 A;  4FOZ A;  4C4V B;  5AFU K;  4JCH A;  2F1C X;  4D5U A;  2GE4 A;  2W81 C;  3AA1 A;  2XMX A;  3G7G A;  3HWB A;  3POU A;  4B61 A;  1OPF A;  2XE3 A;  5H2F O;  4N58 A;  5DL6 A;  3NJT A;  2OMF A;  2WJQ A;  1ZHX A;  3FYX A;  2POR A;  5PRN A;  2XTQ A;  4BUM X;  2Y7S A;  4UB8 O;  5IYU A;  3DZM A;  4F4B A;  4D64 A;  3UPG A;  1S5L O;  3BS0 A;  5E79 O;  2R89 A;  4FRX A;  4GCQ A;  3DWO X;  4AKR B;  4RL9 A;  2M07 A;  2N2L A;  2K4T A;  2X9K A;  2W80 C;  5AFU L;  3LK2 A;  3AA6 A;  2R4N A;  4FZL A;  2WVP A;  2N2M A;  4IL6 O;  4KR8 A;  5G26 A;  1PHO A;  5KAF O;  2XG6 A;  4GCP A;  2MNH A;  3SYB A;  3V8U A;  2M06 A;  4JFB A;  3POQ A;  2J1N A;  3AAA B;  4LSE A;  4FSP A;  2LFU A;  3AA7 A;  1HXU A;  1MM4 A;  3LK4 1;  4LSI A;  3VZT X;  3HOE A;  4Z3T A;  1Q9G A;  2O4V A;  2ERV A;  3PGR A;  4FSO A;  1GFO A;  4AYD C;  3TZG A;  3BRZ A;  2XTR A;  3AA0 B;  2R8A A;  3O0E A;  4O4U A;  5JDP A;  3AA7 B;  2R4L A;  4O49 A;  5DL7 A;  5KAI O;  2KDY A; 
#chains in the Genus database with same CATH homology
 3QRA A;  1HXT A;  1ZHT A;  1MM5 A;  3POX A;  4G76 A;  3RBH A;  3DA4 A;  4O3Z A;  1QJP A;  1QJ9 A;  3VY9 X;  3AA6 B;  2F1V A;  2QTK A;  1HXX A;  3DA3 A;  4N59 A;  1GFM A;  4RLC A;  1BH3 A;  2KZ7 B;  4AYI D;  4O3X B;  2KC0 A;  3PRN A;  2KXP A;  5DL5 A;  2F1T A;  3POR A;  1BXW A;  3LK3 A;  4U9C A;  4AUI A;  3A2S X;  1QJ8 A;  5ADX K;  3C5O A;  4AZL A;  5FVN A;  2Y0L A;  4RJW A;  2Y0K A;  3EMN X;  4E1T A;  3QRC A;  3T0S A;  3VE2 A;  2K0L A;  3SZV A;  4AFK A;  1P4T A;  4FZN A;  1GFN A;  2JMM A;  4D65 A;  4O3Y A;  3PQS A;  1Q9F A;  4LSH A;  3AAA A;  4O4X A;  2Y2X A;  4O3W A;  1OSM A;  3SY9 A;  2XE1 A;  1IZN B;  8PRN A;  2PRN A;  2FGR A;  3SYS A;  4KR4 A;  3VE1 A;  3HOL A;  2YNK A;  5EE2 A;  3KVD D;  2XE2 A;  4RJX A;  1E54 A;  3GP6 A;  4KRA A;  3AAE B;  2ODJ A;  4FES A;  1THQ A;  3SY7 A;  1H6S 1;  4LSF A;  3UAQ A;  2X27 X;  2YPV A;  1YS5 A;  3NSG A;  3VZW X;  3WI5 A;  3HW9 A;  4FUV A;  4C69 X;  2KXP B;  1ZHW A;  4AKR A;  3AA1 B;  4D64 A;  4G75 A;  4GHB A;  2KZ7 A;  4RLB A;  4XNL A;  1GFQ A;  1MPF A;  1IZN A;  4PUX A;  3PQU A;  4XNK A;  4AYE C;  1PRN A;  4QQ1 A;  4AKM A;  2ZLD A;  2J4U P;  3WI4 A;  3JTY A;  3K19 A;  1ORM A;  3VY8 X;  4FRT A;  3SZD A;  3LK4 2;  5ADX L;  4FT6 A;  3VZU X;  2LHF A;  4AYN A;  4AYM C;  3T24 A;  4E1S A;  3LK3 B;  1ZHY A;  1GFP A;  3AAE A;  3AA0 A;  5GV0 A;  4FZM A;  5T5F A;  2Y0H A;  5D5D A;  2MHL A;  1G90 A;  6PRN A;  1BT9 A;  3LK2 B;  4GCS A;  5DL8 A;  2XE5 A;  4FMS A;  7PRN A;  3UU2 A;  2FGQ X;  3T20 A;  1ZHZ A;  2ZFG A;  4GF4 A;  4FOZ A;  5AFU K;  4JCH A;  4D5U A;  2GE4 A;  2W81 C;  3AA1 A;  2XMX A;  3G7G A;  3HWB A;  3POU A;  4B61 A;  1OPF A;  2XE3 A;  4N58 A;  5DL6 A;  2OMF A;  1ZHX A;  3FYX A;  2POR A;  5PRN A;  2XTQ A;  4BUM X;  2Y7S A;  5IYU A;  4F4B A;  3UPG A;  4FRX A;  4GCQ A;  4AKR B;  4RL9 A;  2M07 A;  2N2L A;  2K4T A;  2W80 C;  5AFU L;  3LK2 A;  3AA6 A;  4FZL A;  5G26 A;  2N2M A;  4KR8 A;  1PHO A;  2XG6 A;  4GCP A;  2MNH A;  3SYB A;  3V8U A;  2M06 A;  4JFB A;  3POQ A;  2J1N A;  3AAA B;  4LSE A;  4FSP A;  2LFU A;  3AA7 A;  1HXU A;  1MM4 A;  3LK4 1;  4LSI A;  3VZT X;  3HOE A;  4Z3T A;  1Q9G A;  2O4V A;  2ERV A;  4FSO A;  4AYD C;  1GFO A;  3TZG A;  2XTR A;  3AA0 B;  4O4U A;  5JDP A;  3AA7 B;  3O0E A;  4O49 A;  5DL7 A;  2KDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...