2Y0HA

Crystal structure of pseudomonas aeruginosa opdl
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
389
structure length
361
Chain Sequence
LADSSAHLDLRNFYQLRDYRQSQAGNWSQGFVLRLQSGFTGGPLGFGLDATGLLGVKLPVDDYSHLGLTAKLRYSQTQLQVGILMPQLPVAFRDDVRLLPQTFDGALLTSSEIEGLTLTAGQLWKSRTRESDDMYIMGRDKAHASDEFNLAGATYAFTPRLSASYYYGQLKDIYRQHYLGLLHTLPLGEGLSLRSDLRYFDSGEDGAAISGPVDNRNLNAMLTLRAGAHAFGIGVQKMIGNDAFPVLNGYTTPYVANLMAYQTFTRPQEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRDIDRGAGRADDSEWERNTDLSYVIQSGPLKSVALKWRNITYRSRYGADLDENRFIVNYTLKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas Aeruginosa Opdl
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords PROBABLE PORIN
total genus 92
structure length 361
sequence length 389
ec nomenclature
pdb deposition date 2010-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2y0hA01
4KR8A 2XE5A 3POUA 4FSPA 3T0SA 1OSMA 4KRAA 3VZUX 4FMSA 1GFMA 4RJWA 3SYSA 1BH3A 4RJXA 2XG6A 3POXA 4LSIA 5DL8A 3K19A 5DL5A 4FSOA 4FRTA 2XE3A 1H6S1 4FT6A 2K4TA 4D5UA 2O4VA 3EMNX 5JDPA 3POQA 1MPFA 2QTKA 2OMFA 3VZTX 4KR4A 3O0EA 4GCSA 3PORA 3NSGA 5DL6A 5DL7A 3A2SX 3HWBA 4JFBA 3WI5A 3WI4A 4AUIA 2Y0HA 7PRNA 1E54A 3VY8X 3FYXA 5PRNA 3SZVA 1BT9A 3UU2A 6PRNA 4C69X 3JTYA 3SY9A 2Y0KA 8PRNA 2J4UP 4FRXA 3SYBA 2Y0LA 2FGRA 2FGQX 3SZDA 4D65A 5FVNA 2PORA 1GFPA 1GFNA 1PHOA 3UPGA 1HXXA 2ODJA 3VZWX 3SY7A 3VY9X 4D64A 1OPFA 1GFQA 4GCQA 3T20A 2PRNA 4FOZA 3PRNA 1GFOA 2XE2A 4BUMX 4GCPA 2J1NA 2ZFGA 2XE1A 1HXTA 2Y2XA 2ZLDA 1HXUA 4LSEA 4LSHA 3HW9A 3T24A 1PRNA 4LSFA
chains in the Genus database with same CATH superfamily
2KXPA 4G76A 4KR8A 2M07A 2XE5A 3LK42 3POUA 3PGRA 5ADXL 2KZ7A 4AKMA 4AKRB 2MNHA 4O3WA 2JMMA 3BRZA 4FSPA 1ORMA 3T0SA 3PF1A 2YPVA 3AAAA 4RLBA 4UB8O 4FUVA 4AYEC 2W81C 2Y7SA 2N2MA 1OSMA 3BS0A 4KRAA 2WJRA 3DWNA 5G3AA 3VZUX 1S5LO 2M06A 1Q9GA 4FMSA 1GFMA 3TZGA 4RJWA 2IWVA 3DA3A 5KAIO 5B66O 3SYSA 2KC0A 4GF4A 4FZMA 3NJTA 3UAQA 4AZLA 1BH3A 5KAFO 4RJXA 2XG6A 3AA7A 3KVDD 3POXA 4XNLA 5AFUK 1ZHZA 2KDYA 3AA7B 4LSIA 3K19A 4FRTA 2XE3A 1ZHYA 4FSOA 5DL5A 2K4TA 1H6S1 3QRAA 2AXTO 4FT6A 4N75A 2O4VA 4PUXA 4UB6O 4D5UA 3EMNX 5JDPA 3POQA 3PQSA 3VE1A 1MPFA 2QTKA 2R8AA 2F1CX 5AFUL 2OMFA 3VZTX 4KR4A 2WJQA 5T5FA 3DA4A 4K3CA 5GV0A 3O0EA 2XTRA 2LFUA 4GCSA 4GHBA 4Z3TA 2F1TA 3LK3B 2XTQA 3NSGA 3PORA 5DL6A 2N2LA 5DL7A 3V8UA 3WU2O 1MM5A 3A2SX 1QJ8A 3HWBA 4O3XB 5GTHO 1IZNB 2KZ7B 5H2FO 4JFBA 3RBHA 4B61A 4RLCA 3WI5A 2KXPB 3WI4A 2MHLA 2ERVA 4LSFA 4AUIA 3AAAB 4C00A 2Y0HA 4AYID 4G75A 1G90A 5E79O 5G39A 4PJ0O 1IZNA 7PRNA 1E54A 4U9CA 3PGUA 3VY8X 1MM4A 4AKRA 3FYXA 1QJ9A 2R88A 3JCUO 5G26A 5PRNA 4N74A 3LK3A 3QRCA 3SZVA 4XNKA 4AFKA 1ZHWA 3DWOX 4IL6O 1BXWA 1BT9A 1ZHTA 2GE4A 3LK41 3PQUA 2LHFA 4FZLA 2IWWA 4FESA 3UU2A 6PRNA 3A0BO 4C69X 3JTYA 3SY9A 5B5EO 5IYUA 2R4OA 4PR7A 3AA6A 2Y0KA 3DZMA 8PRNA 3C5OA 3AAEA 5D5DA 4O4XA 2J4UP 3AA1B 4FRXA 3SYBA 3GP6A 3PGSA 2R4LA 1Q9FA 4C4VA 2Y0LA 5EE2A 2W80C 2FGRA 2FGQX 2K0LA 2X27X 2YNKA 4O3YA 4JCHA 5TISO 5FVNA 1THQA 3BRYA 2R4NA 4D65A 2PORA 4AYDC 1GFPA 1GFNA 1PHOA 3UPGA 1HXXA 3HOEA 3AAEB 4AYMC 1ZHXA 2ODJA 4O49A 3VZWX 4E1TA 3SY7A 3AA6B 3VY9X 4D64A 1OPFA 1GFQA 3KZIO 4K3BA 2WVPA 2F1VA 4GCQA 1P4TA 4C4VB 3LK2B 4FZNA 4QQ1A 3VE2A 3AA1A 2PRNA 3T20A 4FOZA 3PRNA 1GFOA 2XE2A 4N58A 4FQEA 3T24A 5G38A 3AA0A 4BUMX 3HOLA 1QJPA 4GCPA 5GTIO 4F4BA 2X9KA 2J1NA 2ZFGA 1YS5A 2XE1A 4O3ZA 3SZDA 2R89A 5DL8A 5ADXK 1HXTA 2Y2XA 2ZLDA 2JQYA 3AA0B 4CTDA 1HXUA 4O4UA 3A0HO 4LSEA 3G7GA 4AYNA 4E1SA 4N59A 2R4PA 3LK2A 4LSHA 1T1LA 4RL9A 3HW9A 1T16A 1PRNA 2XMXA
chains in the Genus database with same CATH topology
2KXPA 4G76A 4KR8A 2M07A 2XE5A 3LK42 3POUA 5ADXL 2KZ7A 4AKMA 4AKRB 2MNHA 4O3WA 2JMMA 4FSPA 1ORMA 3T0SA 2YPVA 3AAAA 4RLBA 4FUVA 4AYEC 2W81C 2Y7SA 2N2MA 1OSMA 4KRAA 3VZUX 2M06A 1Q9GA 4FMSA 1GFMA 3TZGA 4RJWA 3DA3A 3SYSA 2KC0A 4GF4A 4FZMA 3UAQA 4AZLA 1BH3A 4RJXA 2XG6A 3AA7A 3KVDD 3POXA 4XNLA 5AFUK 1ZHZA 2KDYA 3AA7B 4LSIA 3K19A 4FRTA 2XE3A 1ZHYA 4FSOA 5DL5A 2K4TA 1H6S1 3QRAA 4FT6A 4D5UA 2O4VA 4PUXA 3EMNX 5JDPA 3POQA 3PQSA 3VE1A 1MPFA 2QTKA 5AFUL 2OMFA 3VZTX 4KR4A 5T5FA 3DA4A 5GV0A 3O0EA 2XTRA 2LFUA 4GCSA 4GHBA 4Z3TA 2F1TA 3LK3B 2XTQA 3NSGA 3PORA 5DL6A 2N2LA 5DL7A 3V8UA 1MM5A 3A2SX 1QJ8A 3HWBA 4O3XB 1IZNB 2KZ7B 4JFBA 3RBHA 4B61A 4RLCA 3WI5A 2KXPB 3WI4A 2MHLA 2ERVA 4LSFA 4AUIA 3AAAB 2Y0HA 4AYID 4G75A 1G90A 1IZNA 7PRNA 1E54A 4U9CA 3VY8X 4AKRA 1MM4A 3FYXA 1QJ9A 5PRNA 5G26A 3SZVA 3LK3A 3QRCA 4XNKA 4AFKA 1ZHWA 1BXWA 1BT9A 1ZHTA 2GE4A 3LK41 3PQUA 2LHFA 4FZLA 4FESA 3UU2A 6PRNA 4C69X 3JTYA 3SY9A 5IYUA 3AA6A 2Y0KA 8PRNA 3C5OA 3AAEA 5D5DA 4O4XA 2J4UP 3AA1B 4FRXA 3SYBA 3GP6A 1Q9FA 2Y0LA 5EE2A 2W80C 2FGRA 2FGQX 2K0LA 2X27X 2YNKA 4O3YA 4JCHA 3SZDA 5FVNA 1THQA 4D65A 2PORA 4AYDC 1GFPA 1GFNA 1PHOA 3UPGA 1HXXA 3HOEA 3AAEB 4AYMC 1ZHXA 2ODJA 4O49A 3VZWX 4E1TA 3SY7A 3AA6B 3VY9X 4D64A 1OPFA 1GFQA 2F1VA 4GCQA 1P4TA 3LK2B 4FZNA 4QQ1A 3VE2A 3AA1A 2PRNA 3T20A 4FOZA 3PRNA 1GFOA 2XE2A 4N58A 3AA0A 4BUMX 3HOLA 1QJPA 4GCPA 4F4BA 2J1NA 2ZFGA 1YS5A 2XE1A 4O3ZA 5DL8A 5ADXK 1HXTA 2Y2XA 2ZLDA 3AA0B 1HXUA 4O4UA 4LSEA 3G7GA 4AYNA 4E1SA 4N59A 3LK2A 4LSHA 4RL9A 3HW9A 3T24A 1PRNA 2XMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KR8 A;  2XE5 A;  3POU A;  4FSP A;  3T0S A;  1OSM A;  4KRA A;  3VZU X;  4FMS A;  1GFM A;  4RJW A;  3SYS A;  1BH3 A;  4RJX A;  2XG6 A;  3POX A;  4LSI A;  5DL8 A;  3K19 A;  5DL5 A;  4FSO A;  4FRT A;  2XE3 A;  1H6S 1;  4FT6 A;  2K4T A;  4D5U A;  2O4V A;  3EMN X;  5JDP A;  3POQ A;  1MPF A;  2QTK A;  2OMF A;  3VZT X;  4KR4 A;  3O0E A;  4GCS A;  3POR A;  3NSG A;  5DL6 A;  5DL7 A;  3A2S X;  3HWB A;  4JFB A;  3WI5 A;  3WI4 A;  4AUI A;  2Y0H A;  7PRN A;  1E54 A;  3VY8 X;  3FYX A;  5PRN A;  3SZV A;  1BT9 A;  3UU2 A;  6PRN A;  4C69 X;  3JTY A;  3SY9 A;  2Y0K A;  8PRN A;  2J4U P;  4FRX A;  3SYB A;  2Y0L A;  2FGR A;  2FGQ X;  3SZD A;  4D65 A;  5FVN A;  2POR A;  1GFP A;  1GFN A;  1PHO A;  3UPG A;  1HXX A;  2ODJ A;  3VZW X;  3SY7 A;  3VY9 X;  4D64 A;  1OPF A;  1GFQ A;  4GCQ A;  3T20 A;  2PRN A;  4FOZ A;  3PRN A;  1GFO A;  2XE2 A;  4BUM X;  4GCP A;  2J1N A;  2ZFG A;  2XE1 A;  1HXT A;  2Y2X A;  2ZLD A;  1HXU A;  4LSE A;  4LSH A;  3HW9 A;  3T24 A;  1PRN A;  4LSF A; 
#chains in the Genus database with same CATH topology
 2KXP A;  4G76 A;  4KR8 A;  2M07 A;  2XE5 A;  3LK4 2;  3POU A;  3PGR A;  5ADX L;  2KZ7 A;  4AKM A;  4AKR B;  2MNH A;  4O3W A;  2JMM A;  3BRZ A;  4FSP A;  1ORM A;  3T0S A;  3PF1 A;  2YPV A;  3AAA A;  4RLB A;  4UB8 O;  4FUV A;  4AYE C;  2W81 C;  2Y7S A;  2N2M A;  1OSM A;  3BS0 A;  4KRA A;  2WJR A;  3DWN A;  5G3A A;  3VZU X;  1S5L O;  2M06 A;  1Q9G A;  4FMS A;  1GFM A;  3TZG A;  4RJW A;  2IWV A;  3DA3 A;  5KAI O;  5B66 O;  3SYS A;  2KC0 A;  4GF4 A;  4FZM A;  3NJT A;  3UAQ A;  4AZL A;  1BH3 A;  5KAF O;  4RJX A;  2XG6 A;  3AA7 A;  3KVD D;  3POX A;  4XNL A;  5AFU K;  1ZHZ A;  2KDY A;  3AA7 B;  4LSI A;  3K19 A;  4FRT A;  2XE3 A;  1ZHY A;  4FSO A;  5DL5 A;  2K4T A;  1H6S 1;  3QRA A;  2AXT O;  4FT6 A;  4N75 A;  2O4V A;  4PUX A;  4UB6 O;  4D5U A;  3EMN X;  5JDP A;  3POQ A;  3PQS A;  3VE1 A;  1MPF A;  2QTK A;  2R8A A;  2F1C X;  5AFU L;  2OMF A;  3VZT X;  4KR4 A;  2WJQ A;  5T5F A;  3DA4 A;  4K3C A;  5GV0 A;  3O0E A;  2XTR A;  2LFU A;  4GCS A;  4GHB A;  4Z3T A;  2F1T A;  3LK3 B;  2XTQ A;  3NSG A;  3POR A;  5DL6 A;  2N2L A;  5DL7 A;  3V8U A;  3WU2 O;  1MM5 A;  3A2S X;  1QJ8 A;  3HWB A;  4O3X B;  5GTH O;  1IZN B;  2KZ7 B;  5H2F O;  4JFB A;  3RBH A;  4B61 A;  4RLC A;  3WI5 A;  2KXP B;  3WI4 A;  2MHL A;  2ERV A;  4LSF A;  4AUI A;  3AAA B;  4C00 A;  2Y0H A;  4AYI D;  4G75 A;  1G90 A;  5E79 O;  5G39 A;  4PJ0 O;  1IZN A;  7PRN A;  1E54 A;  4U9C A;  3PGU A;  3VY8 X;  1MM4 A;  4AKR A;  3FYX A;  1QJ9 A;  2R88 A;  3JCU O;  5G26 A;  5PRN A;  4N74 A;  3LK3 A;  3QRC A;  3SZV A;  4XNK A;  4AFK A;  1ZHW A;  3DWO X;  4IL6 O;  1BXW A;  1BT9 A;  1ZHT A;  2GE4 A;  3LK4 1;  3PQU A;  2LHF A;  4FZL A;  2IWW A;  4FES A;  3UU2 A;  6PRN A;  3A0B O;  4C69 X;  3JTY A;  3SY9 A;  5B5E O;  5IYU A;  2R4O A;  4PR7 A;  3AA6 A;  2Y0K A;  3DZM A;  8PRN A;  3C5O A;  3AAE A;  5D5D A;  4O4X A;  2J4U P;  3AA1 B;  4FRX A;  3SYB A;  3GP6 A;  3PGS A;  2R4L A;  1Q9F A;  4C4V A;  2Y0L A;  5EE2 A;  2W80 C;  2FGR A;  2FGQ X;  2K0L A;  2X27 X;  2YNK A;  4O3Y A;  4JCH A;  5TIS O;  5FVN A;  1THQ A;  3BRY A;  2R4N A;  4D65 A;  2POR A;  4AYD C;  1GFP A;  1GFN A;  1PHO A;  3UPG A;  1HXX A;  3HOE A;  3AAE B;  4AYM C;  1ZHX A;  2ODJ A;  4O49 A;  3VZW X;  4E1T A;  3SY7 A;  3AA6 B;  3VY9 X;  4D64 A;  1OPF A;  1GFQ A;  3KZI O;  4K3B A;  2WVP A;  2F1V A;  4GCQ A;  1P4T A;  4C4V B;  3LK2 B;  4FZN A;  4QQ1 A;  3VE2 A;  3AA1 A;  2PRN A;  3T20 A;  4FOZ A;  3PRN A;  1GFO A;  2XE2 A;  4N58 A;  4FQE A;  3T24 A;  5G38 A;  3AA0 A;  4BUM X;  3HOL A;  1QJP A;  4GCP A;  5GTI O;  4F4B A;  2X9K A;  2J1N A;  2ZFG A;  1YS5 A;  2XE1 A;  4O3Z A;  3SZD A;  2R89 A;  5DL8 A;  5ADX K;  1HXT A;  2Y2X A;  2ZLD A;  2JQY A;  3AA0 B;  4CTD A;  1HXU A;  4O4U A;  3A0H O;  4LSE A;  3G7G A;  4AYN A;  4E1S A;  4N59 A;  2R4P A;  3LK2 A;  4LSH A;  1T1L A;  4RL9 A;  3HW9 A;  1T16 A;  1PRN A;  2XMX A; 
#chains in the Genus database with same CATH homology
 2KXP A;  4G76 A;  4KR8 A;  2M07 A;  2XE5 A;  3LK4 2;  3POU A;  5ADX L;  2KZ7 A;  4AKM A;  4AKR B;  2MNH A;  4O3W A;  2JMM A;  4FSP A;  1ORM A;  3T0S A;  2YPV A;  3AAA A;  4RLB A;  4FUV A;  4AYE C;  2W81 C;  2Y7S A;  2N2M A;  1OSM A;  4KRA A;  3VZU X;  2M06 A;  1Q9G A;  4FMS A;  1GFM A;  3TZG A;  4RJW A;  3DA3 A;  3SYS A;  2KC0 A;  4GF4 A;  4FZM A;  3UAQ A;  4AZL A;  1BH3 A;  4RJX A;  2XG6 A;  3AA7 A;  3KVD D;  3POX A;  4XNL A;  5AFU K;  1ZHZ A;  2KDY A;  3AA7 B;  4LSI A;  3K19 A;  4FRT A;  2XE3 A;  1ZHY A;  4FSO A;  5DL5 A;  2K4T A;  1H6S 1;  3QRA A;  4FT6 A;  4D5U A;  2O4V A;  4PUX A;  3EMN X;  5JDP A;  3POQ A;  3PQS A;  3VE1 A;  1MPF A;  2QTK A;  5AFU L;  2OMF A;  3VZT X;  4KR4 A;  5T5F A;  3DA4 A;  5GV0 A;  3O0E A;  2XTR A;  2LFU A;  4GCS A;  4GHB A;  4Z3T A;  2F1T A;  3LK3 B;  2XTQ A;  3NSG A;  3POR A;  5DL6 A;  2N2L A;  5DL7 A;  3V8U A;  1MM5 A;  3A2S X;  1QJ8 A;  3HWB A;  4O3X B;  1IZN B;  2KZ7 B;  4JFB A;  3RBH A;  4B61 A;  4RLC A;  3WI5 A;  2KXP B;  3WI4 A;  2MHL A;  2ERV A;  4LSF A;  4AUI A;  3AAA B;  2Y0H A;  4AYI D;  4G75 A;  1G90 A;  1IZN A;  7PRN A;  1E54 A;  4U9C A;  3VY8 X;  4AKR A;  1MM4 A;  3FYX A;  1QJ9 A;  5PRN A;  5G26 A;  3SZV A;  3LK3 A;  3QRC A;  4XNK A;  4AFK A;  1ZHW A;  1BXW A;  1BT9 A;  1ZHT A;  2GE4 A;  3LK4 1;  3PQU A;  2LHF A;  4FZL A;  4FES A;  3UU2 A;  6PRN A;  4C69 X;  3JTY A;  3SY9 A;  5IYU A;  3AA6 A;  2Y0K A;  8PRN A;  3C5O A;  3AAE A;  5D5D A;  4O4X A;  2J4U P;  3AA1 B;  4FRX A;  3SYB A;  3GP6 A;  1Q9F A;  2Y0L A;  5EE2 A;  2W80 C;  2FGR A;  2FGQ X;  2K0L A;  2X27 X;  2YNK A;  4O3Y A;  4JCH A;  3SZD A;  5FVN A;  1THQ A;  4D65 A;  2POR A;  4AYD C;  1GFP A;  1GFN A;  1PHO A;  3UPG A;  1HXX A;  3HOE A;  3AAE B;  4AYM C;  1ZHX A;  2ODJ A;  4O49 A;  3VZW X;  4E1T A;  3SY7 A;  3AA6 B;  3VY9 X;  4D64 A;  1OPF A;  1GFQ A;  2F1V A;  4GCQ A;  1P4T A;  3LK2 B;  4FZN A;  4QQ1 A;  3VE2 A;  3AA1 A;  2PRN A;  3T20 A;  4FOZ A;  3PRN A;  1GFO A;  2XE2 A;  4N58 A;  3AA0 A;  4BUM X;  3HOL A;  1QJP A;  4GCP A;  4F4B A;  2J1N A;  2ZFG A;  1YS5 A;  2XE1 A;  4O3Z A;  5DL8 A;  5ADX K;  1HXT A;  2Y2X A;  2ZLD A;  3AA0 B;  1HXU A;  4O4U A;  4LSE A;  3G7G A;  4AYN A;  4E1S A;  4N59 A;  3LK2 A;  4LSH A;  4RL9 A;  3HW9 A;  3T24 A;  1PRN A;  2XMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...