3BS0A

Crystal structure of the p. putida toluene transporter todx
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
432
structure length
414
Chain Sequence
DLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHDSHGAEAKSSTGPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVQTTEMLRQSHSQINAVVSYSKNFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TodX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transport protein
total genus 88
structure length 414
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bs0A00
2R8AA 1T1LA 2R4LA 2R89A 3DWNA 3PF1A 3BRYA 1T16A 2R4PA 3PGSA 3PGRA 3PGUA 3BRZA 3BS0A 2R4OA 2R4NA 3DWOX 2R88A
chains in the Genus database with same CATH superfamily
2JMMA 3VE1A 4C00A 3AAAB 1HXTA 1HXUA 1T16A 3DA4A 2ZFGA 2Y0KA 3SYBA 2KXPA 1ZHYA 2MNHA 3POUA 4FUVA 4LSFA 5D5DA 4C4VA 4IL6O 2JQYA 1HXXA 4CTDA 1GFOA 3SZDA 1QJPA 2ERVA 1GFNA 5ADXL 4O4UA 3A0HO 2N2MA 3BRZA 4E1SA 2WVPA 2Y0LA 2YNKA 3KVDD 4GCQA 2FGRA 1THQA 4LSEA 4PR7A 2F1CX 3EMNX 4FT6A 3HOLA 3HWBA 5KAIO 4FSOA 3NSGA 2Y0HA 4O3XB 3PORA 4AZLA 1GFPA 5IYUA 3WI5A 5FVNA 1ZHZA 1MM5A 2IWWA 1G90A 5AFUK 2YPVA 1IZNA 2R89A 4N75A 2M06A 5T5FA 2W80C 1S5LO 2R4PA 4G75A 3T20A 4AYNA 3BS0A 7PRNA 4FQEA 3VZUX 2XTQA 2XE1A 4O4XA 2XE3A 2KXPB 4K3CA 4O3YA 1PHOA 3LK2A 2R4LA 4RLCA 3AAEA 4D64A 4U9CA 3V8UA 5EE2A 5DL6A 1H6S1 5ADXK 3AA1A 3AA7B 3HW9A 4GHBA 4FZLA 2W81C 4PUXA 5G39A 3JTYA 5KAFO 1ZHWA 1T1LA 3PGSA 4JFBA 3T0SA 3VY9X 3LK41 5B5EO 3POQA 3QRCA 4N58A 4E1TA 3RBHA 3VY8X 2IWVA 2X27X 1QJ8A 2F1TA 1MPFA 3TZGA 4AYEC 3WU2O 4Z3TA 4RJXA 1Q9GA 2KZ7A 5DL7A 4B61A 1GFQA 2KDYA 4FOZA 3UPGA 1GFMA 3FYXA 3JCUO 4QQ1A 5E79O 5H2FO 3QRAA 5G38A 2Y2XA 3PF1A 4AKMA 2J4UP 3K19A 1OSMA 1ZHXA 2M07A 3PQSA 3NJTA 4AFKA 3SY9A 3AA0A 1BT9A 4RLBA 4AKRA 3VZTX 5PRNA 2O4VA 1BXWA 2Y7SA 5DL8A 4KRAA 3AA6A 3PRNA 4FESA 3C5OA 4GCPA 4KR8A 4AYDC 3O0EA 3AAAA 2LFUA 3LK3A 4N59A 2R88A 3DWNA 4LSIA 4AUIA 5B66O 5G3AA 5DL5A 2PRNA 3VZWX 3GP6A 3A2SX 1PRNA 5G26A 4O3WA 3SY7A 2FGQX 4RL9A 2R4OA 2XMXA 4FZNA 4F4BA 4UB8O 1Q9FA 2AXTO 4PJ0O 3WI4A 2GE4A 3AA6B 3KZIO 3A0BO 1QJ9A 4FMSA 2QTKA 4RJWA 2WJRA 4O3ZA 2MHLA 1IZNB 3G7GA 3PGUA 3T24A 4G76A 4O49A 1ORMA 4GCSA 5JDPA 4KR4A 4AKRB 2F1VA 3SYSA 5GTIO 2PORA 3LK2B 3PQUA 2N2LA 3AAEB 4FRTA 2K4TA 4LSHA 4C69X 2ODJA 2OMFA 4XNLA 2KC0A 1BH3A 2R8AA 3LK3B 3HOEA 3SZVA 3AA1B 4UB6O 4C4VB 5GV0A 3UAQA 4K3BA 4AYID 2XE5A 5TISO 3AA7A 3DA3A 2X9KA 3UU2A 3LK42 6PRNA 3VE2A 3DWOX 2KZ7B 3DZMA 4N74A 4GF4A 4XNKA 2J1NA 1MM4A 3BRYA 4D5UA 3POXA 2LHFA 3PGRA 1OPFA 4BUMX 1YS5A 2WJQA 4D65A 1E54A 4JCHA 2R4NA 5GTHO 2ZLDA 4FZMA 1ZHTA 2XE2A 2K0LA 2XG6A 3AA0B 4FRXA 1P4TA 8PRNA 4AYMC 4FSPA 5AFUL 2XTRA
chains in the Genus database with same CATH topology
2R8AA 1T1LA 2R4LA 2R89A 3DWNA 3PF1A 3BRYA 1T16A 2R4PA 3PGSA 3PGRA 3PGUA 3BRZA 3BS0A 2R4OA 2R4NA 3DWOX 2R88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8A A;  1T1L A;  2R4L A;  2R89 A;  3DWN A;  3PF1 A;  3BRY A;  1T16 A;  2R4P A;  3PGS A;  3PGR A;  3PGU A;  3BRZ A;  3BS0 A;  2R4O A;  2R4N A;  3DWO X;  2R88 A; 
#chains in the Genus database with same CATH topology
 2JMM A;  3VE1 A;  4C00 A;  3AAA B;  1HXT A;  1HXU A;  1T16 A;  3DA4 A;  2ZFG A;  2Y0K A;  3SYB A;  2KXP A;  1ZHY A;  2MNH A;  3POU A;  4FUV A;  4LSF A;  5D5D A;  4C4V A;  4IL6 O;  2JQY A;  1HXX A;  4CTD A;  1GFO A;  3SZD A;  1QJP A;  2ERV A;  1GFN A;  5ADX L;  4O4U A;  3A0H O;  2N2M A;  3BRZ A;  4E1S A;  2WVP A;  2Y0L A;  2YNK A;  3KVD D;  4GCQ A;  2FGR A;  1THQ A;  4LSE A;  4PR7 A;  2F1C X;  3EMN X;  4FT6 A;  3HOL A;  3HWB A;  5KAI O;  4FSO A;  3NSG A;  2Y0H A;  4O3X B;  3POR A;  4AZL A;  1GFP A;  5IYU A;  3WI5 A;  5FVN A;  1ZHZ A;  1MM5 A;  2IWW A;  1G90 A;  5AFU K;  2YPV A;  1IZN A;  2R89 A;  4N75 A;  2M06 A;  5T5F A;  2W80 C;  1S5L O;  2R4P A;  4G75 A;  3T20 A;  4AYN A;  3BS0 A;  7PRN A;  4FQE A;  3VZU X;  2XTQ A;  2XE1 A;  4O4X A;  2XE3 A;  2KXP B;  4K3C A;  4O3Y A;  1PHO A;  3LK2 A;  2R4L A;  4RLC A;  3AAE A;  4D64 A;  4U9C A;  3V8U A;  5EE2 A;  5DL6 A;  1H6S 1;  5ADX K;  3AA1 A;  3AA7 B;  3HW9 A;  4GHB A;  4FZL A;  2W81 C;  4PUX A;  5G39 A;  3JTY A;  5KAF O;  1ZHW A;  1T1L A;  3PGS A;  4JFB A;  3T0S A;  3VY9 X;  3LK4 1;  5B5E O;  3POQ A;  3QRC A;  4N58 A;  4E1T A;  3RBH A;  3VY8 X;  2IWV A;  2X27 X;  1QJ8 A;  2F1T A;  1MPF A;  3TZG A;  4AYE C;  3WU2 O;  4Z3T A;  4RJX A;  1Q9G A;  2KZ7 A;  5DL7 A;  4B61 A;  1GFQ A;  2KDY A;  4FOZ A;  3UPG A;  1GFM A;  3FYX A;  3JCU O;  4QQ1 A;  5E79 O;  5H2F O;  3QRA A;  5G38 A;  2Y2X A;  3PF1 A;  4AKM A;  2J4U P;  3K19 A;  1OSM A;  1ZHX A;  2M07 A;  3PQS A;  3NJT A;  4AFK A;  3SY9 A;  3AA0 A;  1BT9 A;  4RLB A;  4AKR A;  3VZT X;  5PRN A;  2O4V A;  1BXW A;  2Y7S A;  5DL8 A;  4KRA A;  3AA6 A;  3PRN A;  4FES A;  3C5O A;  4GCP A;  4KR8 A;  4AYD C;  3O0E A;  3AAA A;  2LFU A;  3LK3 A;  4N59 A;  2R88 A;  3DWN A;  4LSI A;  4AUI A;  5B66 O;  5G3A A;  5DL5 A;  2PRN A;  3VZW X;  3GP6 A;  3A2S X;  1PRN A;  5G26 A;  4O3W A;  3SY7 A;  2FGQ X;  4RL9 A;  2R4O A;  2XMX A;  4FZN A;  4F4B A;  4UB8 O;  1Q9F A;  2AXT O;  4PJ0 O;  3WI4 A;  2GE4 A;  3AA6 B;  3KZI O;  3A0B O;  1QJ9 A;  4FMS A;  2QTK A;  4RJW A;  2WJR A;  4O3Z A;  2MHL A;  1IZN B;  3G7G A;  3PGU A;  3T24 A;  4G76 A;  4O49 A;  1ORM A;  4GCS A;  5JDP A;  4KR4 A;  4AKR B;  2F1V A;  3SYS A;  5GTI O;  2POR A;  3LK2 B;  3PQU A;  2N2L A;  3AAE B;  4FRT A;  2K4T A;  4LSH A;  4C69 X;  2ODJ A;  2OMF A;  4XNL A;  2KC0 A;  1BH3 A;  2R8A A;  3LK3 B;  3HOE A;  3SZV A;  3AA1 B;  4UB6 O;  4C4V B;  5GV0 A;  3UAQ A;  4K3B A;  4AYI D;  2XE5 A;  5TIS O;  3AA7 A;  3DA3 A;  2X9K A;  3UU2 A;  3LK4 2;  6PRN A;  3VE2 A;  3DWO X;  2KZ7 B;  3DZM A;  4N74 A;  4GF4 A;  4XNK A;  2J1N A;  1MM4 A;  3BRY A;  4D5U A;  3POX A;  2LHF A;  3PGR A;  1OPF A;  4BUM X;  1YS5 A;  2WJQ A;  4D65 A;  1E54 A;  4JCH A;  2R4N A;  5GTH O;  2ZLD A;  4FZM A;  1ZHT A;  2XE2 A;  2K0L A;  2XG6 A;  3AA0 B;  4FRX A;  1P4T A;  8PRN A;  4AYM C;  4FSP A;  5AFU L;  2XTR A; 
#chains in the Genus database with same CATH homology
 2R8A A;  1T1L A;  2R4L A;  2R89 A;  3DWN A;  3PF1 A;  3BRY A;  1T16 A;  2R4P A;  3PGS A;  3PGR A;  3PGU A;  3BRZ A;  3BS0 A;  2R4O A;  2R4N A;  3DWO X;  2R88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...