3BS0A

Crystal structure of the p. putida toluene transporter todx
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
432
structure length
414
Chain Sequence
b'DLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHDSHGAEAKSSTGPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVQTTEMLRQSHSQINAVVSYSKNFHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TodX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transport protein
total genus 88
structure length 414
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bs0A00
2R4PA 3DWOX 2R4LA 2R4NA 2R88A 3PGRA 3BRYA 3PGSA 2R4OA 1T1LA 3DWNA 3BS0A 2R89A 1T16A 3BRZA 2R8AA 3PGUA 3PF1A
chains in the Genus database with same CATH superfamily
3AA1A 3QRCA 2WVPA 2YPVA 1ZHZA 4AUIA 5ADXL 5JDPA 2KZ7A 5G39A 3VZUX 4E1SA 4FRXA 3T24A 3AA0B 3VZTX 4IL6O 3SY7A 3A0BO 5PRNA 1S5LO 2R4PA 2Y0HA 5KAFO 1Q9FA 3O0EA 4FMSA 4XNLA 4G75A 4PJ0O 4RLBA 4JFBA 4LSIA 1THQA 2N2LA 3A0HO 4N58A 2KC0A 4AKRB 3UAQA 3LK3B 4K3CA 2R4NA 4XNKA 4FRTA 1MM4A 2IWWA 3DA4A 5H2FO 1OSMA 5GTHO 4GCQA 1QJ9A 4O3WA 5FVNA 5G3AA 4AZLA 3DWOX 2F1CX 2QTKA 2GE4A 3SYBA 2KDYA 2PORA 3POUA 5B66O 1P4TA 2YNKA 1ZHTA 4Z3TA 1GFQA 3KZIO 5IYUA 1YS5A 1MM5A 2Y0LA 3PQSA 3PF1A 4FSOA 4GCSA 2R4LA 4GF4A 4LSHA 5DL7A 5AFUK 4G76A 5EE2A 3BRYA 2O4VA 2J1NA 3PQUA 4O49A 2ERVA 3AA7A 4GCPA 4AKRA 4AYEC 1BH3A 2ZFGA 3LK3A 5DL6A 5T5FA 3HWBA 2FGQX 5ADXK 5TISO 1IZNB 1PRNA 2W80C 2ZLDA 2LHFA 2JQYA 2K4TA 2XG6A 3PORA 5D5DA 4AKMA 3JTYA 4AFKA 2XTRA 4FESA 5G38A 3SZVA 1GFMA 2ODJA 4LSEA 2WJRA 3DA3A 1QJPA 3SY9A 5GV0A 3AA7B 3POQA 4UB8O 3LK2B 2R88A 3PGRA 4UB6O 1BT9A 3DWNA 3C5OA 4BUMX 2M07A 4FOZA 2F1VA 4JCHA 2MNHA 2XMXA 1PHOA 4LSFA 4O4XA 3DZMA 1E54A 3VZWX 4RL9A 4FZNA 4N74A 3WU2O 4CTDA 3VY9X 4C4VB 2XE1A 2FGRA 4RJXA 2LFUA 1HXXA 4KR4A 1IZNA 4GHBA 1GFPA 3HOLA 4O3YA 3UPGA 3POXA 3VE2A 2W81C 1T16A 3AAAB 1MPFA 2R8AA 1Q9GA 3WI4A 2PRNA 4E1TA 3LK2A 4K3BA 4AYDC 2XE5A 4C69X 2IWVA 2N2MA 1GFNA 4RLCA 6PRNA 1ZHYA 3LK41 1QJ8A 4AYMC 1BXWA 1HXTA 3KVDD 2WJQA 5E79O 1G90A 5G26A 4FQEA 4FUVA 4O4UA 4O3XB 4C4VA 3TZGA 1HXUA 3V8UA 2XE3A 4D65A 3NSGA 2KXPB 8PRNA 4QQ1A 2XTQA 2JMMA 3A2SX 4PUXA 1ZHXA 4D64A 3PGSA 2X27X 3AAEB 3FYXA 3VE1A 3AAAA 3HW9A 5DL5A 3SYSA 2M06A 3PRNA 3EMNX 4FZMA 5B5EO 2R4OA 4N75A 1OPFA 4AYID 1ZHWA 2K0LA 2XE2A 3AA6A 5DL8A 3T0SA 4B61A 1H6S1 3QRAA 2Y7SA 3AA1B 3HOEA 3JCUO 2KXPA 3G7GA 1T1LA 3LK42 5GTIO 2Y0KA 3RBHA 2KZ7B 3GP6A 3BRZA 4FT6A 4RJWA 4FSPA 3UU2A 4C00A 2X9KA 3AAEA 1ORMA 3AA6B 2J4UP 2Y2XA 3K19A 4F4BA 3WI5A 4U9CA 2R89A 2AXTO 2F1TA 4KR8A 3PGUA 4N59A 4O3ZA 3NJTA 3SZDA 5KAIO 5AFUL 3AA0A 4AYNA 4PR7A 4KRAA 3VY8X 3BS0A 2OMFA 7PRNA 1GFOA 4FZLA 2MHLA 4D5UA 3T20A
chains in the Genus database with same CATH topology
2R4PA 3DWOX 2R4LA 2R4NA 2R88A 3PGRA 3BRYA 3PGSA 2R4OA 1T1LA 3DWNA 3BS0A 2R89A 1T16A 3BRZA 2R8AA 3PGUA 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4P A;  3DWO X;  2R4L A;  2R4N A;  2R88 A;  3PGR A;  3BRY A;  3PGS A;  2R4O A;  1T1L A;  3DWN A;  3BS0 A;  2R89 A;  1T16 A;  3BRZ A;  2R8A A;  3PGU A;  3PF1 A; 
#chains in the Genus database with same CATH topology
 3AA1 A;  3QRC A;  2WVP A;  2YPV A;  1ZHZ A;  4AUI A;  5ADX L;  5JDP A;  2KZ7 A;  5G39 A;  3VZU X;  4E1S A;  4FRX A;  3T24 A;  3AA0 B;  3VZT X;  4IL6 O;  3SY7 A;  3A0B O;  5PRN A;  1S5L O;  2R4P A;  2Y0H A;  5KAF O;  1Q9F A;  3O0E A;  4FMS A;  4XNL A;  4G75 A;  4PJ0 O;  4RLB A;  4JFB A;  4LSI A;  1THQ A;  2N2L A;  3A0H O;  4N58 A;  2KC0 A;  4AKR B;  3UAQ A;  3LK3 B;  4K3C A;  2R4N A;  4XNK A;  4FRT A;  1MM4 A;  2IWW A;  3DA4 A;  5H2F O;  1OSM A;  5GTH O;  4GCQ A;  1QJ9 A;  4O3W A;  5FVN A;  5G3A A;  4AZL A;  3DWO X;  2F1C X;  2QTK A;  2GE4 A;  3SYB A;  2KDY A;  2POR A;  3POU A;  5B66 O;  1P4T A;  2YNK A;  1ZHT A;  4Z3T A;  1GFQ A;  3KZI O;  5IYU A;  1YS5 A;  1MM5 A;  2Y0L A;  3PQS A;  3PF1 A;  4FSO A;  4GCS A;  2R4L A;  4GF4 A;  4LSH A;  5DL7 A;  5AFU K;  4G76 A;  5EE2 A;  3BRY A;  2O4V A;  2J1N A;  3PQU A;  4O49 A;  2ERV A;  3AA7 A;  4GCP A;  4AKR A;  4AYE C;  1BH3 A;  2ZFG A;  3LK3 A;  5DL6 A;  5T5F A;  3HWB A;  2FGQ X;  5ADX K;  5TIS O;  1IZN B;  1PRN A;  2W80 C;  2ZLD A;  2LHF A;  2JQY A;  2K4T A;  2XG6 A;  3POR A;  5D5D A;  4AKM A;  3JTY A;  4AFK A;  2XTR A;  4FES A;  5G38 A;  3SZV A;  1GFM A;  2ODJ A;  4LSE A;  2WJR A;  3DA3 A;  1QJP A;  3SY9 A;  5GV0 A;  3AA7 B;  3POQ A;  4UB8 O;  3LK2 B;  2R88 A;  3PGR A;  4UB6 O;  1BT9 A;  3DWN A;  3C5O A;  4BUM X;  2M07 A;  4FOZ A;  2F1V A;  4JCH A;  2MNH A;  2XMX A;  1PHO A;  4LSF A;  4O4X A;  3DZM A;  1E54 A;  3VZW X;  4RL9 A;  4FZN A;  4N74 A;  3WU2 O;  4CTD A;  3VY9 X;  4C4V B;  2XE1 A;  2FGR A;  4RJX A;  2LFU A;  1HXX A;  4KR4 A;  1IZN A;  4GHB A;  1GFP A;  3HOL A;  4O3Y A;  3UPG A;  3POX A;  3VE2 A;  2W81 C;  1T16 A;  3AAA B;  1MPF A;  2R8A A;  1Q9G A;  3WI4 A;  2PRN A;  4E1T A;  3LK2 A;  4K3B A;  4AYD C;  2XE5 A;  4C69 X;  2IWV A;  2N2M A;  1GFN A;  4RLC A;  6PRN A;  1ZHY A;  3LK4 1;  1QJ8 A;  4AYM C;  1BXW A;  1HXT A;  3KVD D;  2WJQ A;  5E79 O;  1G90 A;  5G26 A;  4FQE A;  4FUV A;  4O4U A;  4O3X B;  4C4V A;  3TZG A;  1HXU A;  3V8U A;  2XE3 A;  4D65 A;  3NSG A;  2KXP B;  8PRN A;  4QQ1 A;  2XTQ A;  2JMM A;  3A2S X;  4PUX A;  1ZHX A;  4D64 A;  3PGS A;  2X27 X;  3AAE B;  3FYX A;  3VE1 A;  3AAA A;  3HW9 A;  5DL5 A;  3SYS A;  2M06 A;  3PRN A;  3EMN X;  4FZM A;  5B5E O;  2R4O A;  4N75 A;  1OPF A;  4AYI D;  1ZHW A;  2K0L A;  2XE2 A;  3AA6 A;  5DL8 A;  3T0S A;  4B61 A;  1H6S 1;  3QRA A;  2Y7S A;  3AA1 B;  3HOE A;  3JCU O;  2KXP A;  3G7G A;  1T1L A;  3LK4 2;  5GTI O;  2Y0K A;  3RBH A;  2KZ7 B;  3GP6 A;  3BRZ A;  4FT6 A;  4RJW A;  4FSP A;  3UU2 A;  4C00 A;  2X9K A;  3AAE A;  1ORM A;  3AA6 B;  2J4U P;  2Y2X A;  3K19 A;  4F4B A;  3WI5 A;  4U9C A;  2R89 A;  2AXT O;  2F1T A;  4KR8 A;  3PGU A;  4N59 A;  4O3Z A;  3NJT A;  3SZD A;  5KAI O;  5AFU L;  3AA0 A;  4AYN A;  4PR7 A;  4KRA A;  3VY8 X;  3BS0 A;  2OMF A;  7PRN A;  1GFO A;  4FZL A;  2MHL A;  4D5U A;  3T20 A; 
#chains in the Genus database with same CATH homology
 2R4P A;  3DWO X;  2R4L A;  2R4N A;  2R88 A;  3PGR A;  3BRY A;  3PGS A;  2R4O A;  1T1L A;  3DWN A;  3BS0 A;  2R89 A;  1T16 A;  3BRZ A;  2R8A A;  3PGU A;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...