3BS0A

Crystal structure of the p. putida toluene transporter todx
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
432
structure length
414
Chain Sequence
DLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHDSHGAEAKSSTGPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVQTTEMLRQSHSQINAVVSYSKNFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transport protein
molecule keywords TodX
total genus 88
structure length 414
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bs0A00
3PGUA 3PGSA 3PF1A 1T1LA 2R4LA 3BS0A 2R8AA 3DWOX 3PGRA 2R4PA 3DWNA 1T16A 2R89A 2R4OA 2R88A 2R4NA 3BRZA 3BRYA
chains in the Genus database with same CATH superfamily
4AUIA 2ERVA 2X27X 2KZ7A 5G3AA 3DA3A 2LFUA 3NSGA 5G39A 3SZDA 1GFMA 1MPFA 1BH3A 3GP6A 2R4OA 3FYXA 4C69X 3HOLA 1H6S1 4Z3TA 5IYUA 1ZHZA 4IL6O 5AFUK 2IWWA 1PHOA 1ZHWA 2IWVA 3SY7A 3LK42 4AYNA 3PRNA 3AA6B 4FUVA 2Y0LA 3DWOX 2R4PA 3VE2A 3SY9A 3WI5A 2X9KA 3TZGA 3PQSA 2O4VA 4FZMA 4D5UA 3PGSA 1Q9FA 1MM5A 4PR7A 4AYDC 2MNHA 4FQEA 3K19A 1ZHYA 3PGRA 4E1SA 2M06A 5AFUL 2WVPA 2Y2XA 3QRCA 3HOEA 2Y7SA 4GF4A 4K3CA 4O4UA 1QJ8A 5DL8A 3UAQA 3T24A 3VZUX 4B61A 5ADXL 1MM4A 1GFPA 5PRNA 4D64A 2GE4A 3AA6A 1Q9GA 5FVNA 5B5EO 1QJ9A 3JTYA 5B66O 7PRNA 4F4BA 4PUXA 2XG6A 1GFNA 3PF1A 5KAFO 3AAEB 2N2LA 3LK3A 2W80C 5G38A 4FZNA 4AYID 4KRAA 4LSHA 3A2SX 3PQUA 2KXPA 2XMXA 4RLCA 3VZTX 3HW9A 2PORA 4UB6O 4FRXA 4XNLA 4O3XB 3T0SA 4AFKA 4JFBA 4QQ1A 4AYEC 4AZLA 1QJPA 2XE2A 4N74A 2K4TA 5GTIO 4LSEA 3AA0A 3SYBA 4AKRB 2N2MA 3VZWX 4C00A 4O3WA 2R4LA 3BS0A 4LSFA 3UU2A 3C5OA 3AA7B 4FRTA 5T5FA 4JCHA 3POXA 3LK3B 4FOZA 2ZFGA 2ZLDA 4K3BA 2R4NA 5H2FO 2Y0KA 5EE2A 1P4TA 2YNKA 2OMFA 2J4UP 1OSMA 4FESA 2M07A 4FMSA 2PRNA 2FGQX 2F1TA 3A0BO 5DL6A 3PGUA 2MHLA 3JCUO 4U9CA 1T1LA 4G75A 4N75A 2R8AA 5E79O 4FT6A 4D65A 1S5LO 3AA7A 3DZMA 3POUA 3QRAA 5DL5A 8PRNA 3SYSA 3KZIO 4GHBA 3PORA 4C4VA 4O3ZA 4AKRA 2F1VA 2KDYA 1ZHTA 1THQA 1BT9A 5G26A 2R88A 3AA1B 4RL9A 4GCQA 3DA4A 2YPVA 3HWBA 3O0EA 1IZNB 1PRNA 1GFOA 3G7GA 2KC0A 4UB8O 4XNKA 2Y0HA 2KXPB 4FSOA 4AKMA 1G90A 3BRYA 4BUMX 3RBHA 5GTHO 4KR4A 2JQYA 3AA1A 3DWNA 1T16A 1IZNA 2W81C 3KVDD 2WJRA 2FGRA 5JDPA 2AXTO 4FSPA 2XE1A 4AYMC 4RLBA 3BRZA 2XTRA 4LSIA 3UPGA 3AAAA 2R89A 2XE3A 5KAIO 3LK2A 4PJ0O 2J1NA 2K0LA 3LK41 5TISO 1OPFA 3VY8X 5ADXK 4RJWA 4GCPA 4O3YA 3WI4A 3AAEA 4FZLA 4KR8A 1GFQA 1HXXA 3AAAB 3POQA 4N59A 1ORMA 2JMMA 4N58A 3SZVA 2ODJA 3V8UA 3WU2O 5GV0A 3NJTA 4G76A 4O49A 3EMNX 4O4XA 3A0HO 5D5DA 4E1TA 2KZ7B 1HXUA 4RJXA 2XTQA 4C4VB 5DL7A 1E54A 2QTKA 3VY9X 6PRNA 1YS5A 3LK2B 1ZHXA 3VE1A 2LHFA 3AA0B 2XE5A 4GCSA 1BXWA 1HXTA 4CTDA 2WJQA 3T20A 2F1CX
chains in the Genus database with same CATH topology
3PGUA 3PGSA 3PF1A 1T1LA 2R4LA 3BS0A 2R8AA 3DWOX 3PGRA 2R4PA 3DWNA 1T16A 2R89A 2R4OA 2R88A 2R4NA 3BRZA 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGU A;  3PGS A;  3PF1 A;  1T1L A;  2R4L A;  3BS0 A;  2R8A A;  3DWO X;  3PGR A;  2R4P A;  3DWN A;  1T16 A;  2R89 A;  2R4O A;  2R88 A;  2R4N A;  3BRZ A;  3BRY A; 
#chains in the Genus database with same CATH topology
 4AUI A;  2ERV A;  2X27 X;  2KZ7 A;  5G3A A;  3DA3 A;  2LFU A;  3NSG A;  5G39 A;  3SZD A;  1GFM A;  1MPF A;  1BH3 A;  3GP6 A;  2R4O A;  3FYX A;  4C69 X;  3HOL A;  1H6S 1;  4Z3T A;  5IYU A;  1ZHZ A;  4IL6 O;  5AFU K;  2IWW A;  1PHO A;  1ZHW A;  2IWV A;  3SY7 A;  3LK4 2;  4AYN A;  3PRN A;  3AA6 B;  4FUV A;  2Y0L A;  3DWO X;  2R4P A;  3VE2 A;  3SY9 A;  3WI5 A;  2X9K A;  3TZG A;  3PQS A;  2O4V A;  4FZM A;  4D5U A;  3PGS A;  1Q9F A;  1MM5 A;  4PR7 A;  4AYD C;  2MNH A;  4FQE A;  3K19 A;  1ZHY A;  3PGR A;  4E1S A;  2M06 A;  5AFU L;  2WVP A;  2Y2X A;  3QRC A;  3HOE A;  2Y7S A;  4GF4 A;  4K3C A;  4O4U A;  1QJ8 A;  5DL8 A;  3UAQ A;  3T24 A;  3VZU X;  4B61 A;  5ADX L;  1MM4 A;  1GFP A;  5PRN A;  4D64 A;  2GE4 A;  3AA6 A;  1Q9G A;  5FVN A;  5B5E O;  1QJ9 A;  3JTY A;  5B66 O;  7PRN A;  4F4B A;  4PUX A;  2XG6 A;  1GFN A;  3PF1 A;  5KAF O;  3AAE B;  2N2L A;  3LK3 A;  2W80 C;  5G38 A;  4FZN A;  4AYI D;  4KRA A;  4LSH A;  3A2S X;  3PQU A;  2KXP A;  2XMX A;  4RLC A;  3VZT X;  3HW9 A;  2POR A;  4UB6 O;  4FRX A;  4XNL A;  4O3X B;  3T0S A;  4AFK A;  4JFB A;  4QQ1 A;  4AYE C;  4AZL A;  1QJP A;  2XE2 A;  4N74 A;  2K4T A;  5GTI O;  4LSE A;  3AA0 A;  3SYB A;  4AKR B;  2N2M A;  3VZW X;  4C00 A;  4O3W A;  2R4L A;  3BS0 A;  4LSF A;  3UU2 A;  3C5O A;  3AA7 B;  4FRT A;  5T5F A;  4JCH A;  3POX A;  3LK3 B;  4FOZ A;  2ZFG A;  2ZLD A;  4K3B A;  2R4N A;  5H2F O;  2Y0K A;  5EE2 A;  1P4T A;  2YNK A;  2OMF A;  2J4U P;  1OSM A;  4FES A;  2M07 A;  4FMS A;  2PRN A;  2FGQ X;  2F1T A;  3A0B O;  5DL6 A;  3PGU A;  2MHL A;  3JCU O;  4U9C A;  1T1L A;  4G75 A;  4N75 A;  2R8A A;  5E79 O;  4FT6 A;  4D65 A;  1S5L O;  3AA7 A;  3DZM A;  3POU A;  3QRA A;  5DL5 A;  8PRN A;  3SYS A;  3KZI O;  4GHB A;  3POR A;  4C4V A;  4O3Z A;  4AKR A;  2F1V A;  2KDY A;  1ZHT A;  1THQ A;  1BT9 A;  5G26 A;  2R88 A;  3AA1 B;  4RL9 A;  4GCQ A;  3DA4 A;  2YPV A;  3HWB A;  3O0E A;  1IZN B;  1PRN A;  1GFO A;  3G7G A;  2KC0 A;  4UB8 O;  4XNK A;  2Y0H A;  2KXP B;  4FSO A;  4AKM A;  1G90 A;  3BRY A;  4BUM X;  3RBH A;  5GTH O;  4KR4 A;  2JQY A;  3AA1 A;  3DWN A;  1T16 A;  1IZN A;  2W81 C;  3KVD D;  2WJR A;  2FGR A;  5JDP A;  2AXT O;  4FSP A;  2XE1 A;  4AYM C;  4RLB A;  3BRZ A;  2XTR A;  4LSI A;  3UPG A;  3AAA A;  2R89 A;  2XE3 A;  5KAI O;  3LK2 A;  4PJ0 O;  2J1N A;  2K0L A;  3LK4 1;  5TIS O;  1OPF A;  3VY8 X;  5ADX K;  4RJW A;  4GCP A;  4O3Y A;  3WI4 A;  3AAE A;  4FZL A;  4KR8 A;  1GFQ A;  1HXX A;  3AAA B;  3POQ A;  4N59 A;  1ORM A;  2JMM A;  4N58 A;  3SZV A;  2ODJ A;  3V8U A;  3WU2 O;  5GV0 A;  3NJT A;  4G76 A;  4O49 A;  3EMN X;  4O4X A;  3A0H O;  5D5D A;  4E1T A;  2KZ7 B;  1HXU A;  4RJX A;  2XTQ A;  4C4V B;  5DL7 A;  1E54 A;  2QTK A;  3VY9 X;  6PRN A;  1YS5 A;  3LK2 B;  1ZHX A;  3VE1 A;  2LHF A;  3AA0 B;  2XE5 A;  4GCS A;  1BXW A;  1HXT A;  4CTD A;  2WJQ A;  3T20 A;  2F1C X; 
#chains in the Genus database with same CATH homology
 3PGU A;  3PGS A;  3PF1 A;  1T1L A;  2R4L A;  3BS0 A;  2R8A A;  3DWO X;  3PGR A;  2R4P A;  3DWN A;  1T16 A;  2R89 A;  2R4O A;  2R88 A;  2R4N A;  3BRZ A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...