3BS0A

Crystal structure of the p. putida toluene transporter todx
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
432
structure length
414
Chain Sequence
DLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHDSHGAEAKSSTGPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVQTTEMLRQSHSQINAVVSYSKNFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transport protein
molecule keywords TodX
total genus 88
structure length 414
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bs0A00
2R4NA 3BRZA 2R8AA 2R4PA 3PGRA 1T16A 3BRYA 3DWNA 3BS0A 3PF1A 2R4LA 1T1LA 3PGUA 3PGSA 2R4OA 2R89A 2R88A 3DWOX
chains in the Genus database with same CATH superfamily
3PRNA 1Q9FA 1Q9GA 2OMFA 2FGRA 1BT9A 4FZNA 5E79O 4UB6O 4FUVA 4UB8O 2N2LA 4O4XA 3AA7A 3UPGA 3LK3B 1BXWA 4RL9A 3AA6B 1ZHXA 3AAEA 4N74A 1GFNA 5T5FA 4K3CA 4FSOA 2F1VA 3HOEA 5G3AA 3RBHA 3SY9A 2R4PA 5B66O 2X27X 2XE5A 3PGUA 2WJRA 3EMNX 5G26A 5GV0A 3A2SX 1QJ8A 4FESA 5PRNA 3V8UA 3WU2O 5JDPA 3LK42 5H2FO 1MM4A 4JFBA 4AFKA 4GCQA 3VE1A 4LSHA 2R89A 4FOZA 4AYNA 1ZHWA 4PR7A 4C4VA 3BRZA 3KZIO 1BH3A 3NSGA 4C4VB 3C5OA 4B61A 1H6S1 3VY8X 3BS0A 6PRNA 2KXPA 3VZWX 2GE4A 4Z3TA 4BUMX 3DWOX 3PQUA 1GFOA 2W80C 1OPFA 4QQ1A 4N59A 3HOLA 4RJXA 3WI5A 2R4LA 4GHBA 2J4UP 1GFMA 5D5DA 3VZUX 3FYXA 2IWVA 2YPVA 4GF4A 4FMSA 2XE3A 4N58A 1MPFA 3O0EA 4D64A 4E1TA 4XNKA 4FZLA 5IYUA 3T20A 4O3XB 4O3ZA 5GTHO 2O4VA 2ZLDA 4CTDA 3POXA 3QRCA 1IZNB 3G7GA 1ORMA 4KR8A 5KAFO 4AUIA 1MM5A 2N2MA 2YNKA 3AA7B 2X9KA 4K3BA 3UU2A 1HXXA 3JCUO 3TZGA 1PHOA 5FVNA 3POUA 2Y7SA 1ZHZA 3AAAA 2Y0KA 4RLBA 4RLCA 2KXPB 4AYMC 4C00A 5G39A 3LK3A 2FGQX 1QJPA 4FT6A 4O4UA 5DL6A 3T0SA 3JTYA 2R8AA 5GTIO 4D5UA 2XG6A 4KRAA 3DA4A 3LK2B 4FSPA 1HXTA 1GFQA 2JMMA 2XTRA 3GP6A 4G76A 1YS5A 2KZ7B 3PORA 4AYDC 5KAIO 3AA0A 3SZDA 4D65A 2K4TA 3PGRA 1T16A 2AXTO 3BRYA 4IL6O 1ZHTA 3VE2A 4AKRB 2R4OA 4O3YA 1PRNA 3WI4A 5ADXL 2M07A 5G38A 2R4NA 2ZFGA 2WJQA 2ODJA 3T24A 4AKMA 2W81C 3AA1B 2M06A 2Y2XA 4PUXA 1T1LA 5EE2A 4XNLA 3AA6A 3AAEB 5B5EO 2KC0A 4C69X 4G75A 1P4TA 4LSFA 2XE2A 5DL5A 3SYBA 4U9CA 1GFPA 2IWWA 2J1NA 4FRTA 4LSIA 3UAQA 3DA3A 5ADXK 2K0LA 2JQYA 2PORA 2LFUA 3AAAB 3NJTA 2XMXA 3SY7A 4AYEC 3DZMA 4AYID 4FQEA 1IZNA 2XTQA 5AFUK 2WVPA 3SZVA 3KVDD 3DWNA 4RJWA 5DL7A 4E1SA 3LK2A 1G90A 4AZLA 4N75A 2F1CX 2PRNA 4LSEA 1ZHYA 2KDYA 3A0BO 2KZ7A 3PF1A 2QTKA 1HXUA 2F1TA 1E54A 1S5LO 3VZTX 5DL8A 5AFUL 2LHFA 2XE1A 3K19A 4FZMA 3HW9A 2Y0LA 3A0HO 4FRXA 3PGSA 4PJ0O 3VY9X 2Y0HA 1OSMA 3PQSA 2MNHA 5TISO 2R88A 3HWBA 4KR4A 4F4BA 3AA1A 3LK41 2ERVA 3AA0B 7PRNA 3QRAA 3POQA 4GCPA 4GCSA 4O3WA 4JCHA 3SYSA 8PRNA 2MHLA 1THQA 1QJ9A 4AKRA 4O49A
chains in the Genus database with same CATH topology
2R4NA 3BRZA 2R8AA 2R4PA 3PGRA 1T16A 3BRYA 3DWNA 3BS0A 3PF1A 2R4LA 1T1LA 3PGUA 3PGSA 2R4OA 2R89A 2R88A 3DWOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4N A;  3BRZ A;  2R8A A;  2R4P A;  3PGR A;  1T16 A;  3BRY A;  3DWN A;  3BS0 A;  3PF1 A;  2R4L A;  1T1L A;  3PGU A;  3PGS A;  2R4O A;  2R89 A;  2R88 A;  3DWO X; 
#chains in the Genus database with same CATH topology
 3PRN A;  1Q9F A;  1Q9G A;  2OMF A;  2FGR A;  1BT9 A;  4FZN A;  5E79 O;  4UB6 O;  4FUV A;  4UB8 O;  2N2L A;  4O4X A;  3AA7 A;  3UPG A;  3LK3 B;  1BXW A;  4RL9 A;  3AA6 B;  1ZHX A;  3AAE A;  4N74 A;  1GFN A;  5T5F A;  4K3C A;  4FSO A;  2F1V A;  3HOE A;  5G3A A;  3RBH A;  3SY9 A;  2R4P A;  5B66 O;  2X27 X;  2XE5 A;  3PGU A;  2WJR A;  3EMN X;  5G26 A;  5GV0 A;  3A2S X;  1QJ8 A;  4FES A;  5PRN A;  3V8U A;  3WU2 O;  5JDP A;  3LK4 2;  5H2F O;  1MM4 A;  4JFB A;  4AFK A;  4GCQ A;  3VE1 A;  4LSH A;  2R89 A;  4FOZ A;  4AYN A;  1ZHW A;  4PR7 A;  4C4V A;  3BRZ A;  3KZI O;  1BH3 A;  3NSG A;  4C4V B;  3C5O A;  4B61 A;  1H6S 1;  3VY8 X;  3BS0 A;  6PRN A;  2KXP A;  3VZW X;  2GE4 A;  4Z3T A;  4BUM X;  3DWO X;  3PQU A;  1GFO A;  2W80 C;  1OPF A;  4QQ1 A;  4N59 A;  3HOL A;  4RJX A;  3WI5 A;  2R4L A;  4GHB A;  2J4U P;  1GFM A;  5D5D A;  3VZU X;  3FYX A;  2IWV A;  2YPV A;  4GF4 A;  4FMS A;  2XE3 A;  4N58 A;  1MPF A;  3O0E A;  4D64 A;  4E1T A;  4XNK A;  4FZL A;  5IYU A;  3T20 A;  4O3X B;  4O3Z A;  5GTH O;  2O4V A;  2ZLD A;  4CTD A;  3POX A;  3QRC A;  1IZN B;  3G7G A;  1ORM A;  4KR8 A;  5KAF O;  4AUI A;  1MM5 A;  2N2M A;  2YNK A;  3AA7 B;  2X9K A;  4K3B A;  3UU2 A;  1HXX A;  3JCU O;  3TZG A;  1PHO A;  5FVN A;  3POU A;  2Y7S A;  1ZHZ A;  3AAA A;  2Y0K A;  4RLB A;  4RLC A;  2KXP B;  4AYM C;  4C00 A;  5G39 A;  3LK3 A;  2FGQ X;  1QJP A;  4FT6 A;  4O4U A;  5DL6 A;  3T0S A;  3JTY A;  2R8A A;  5GTI O;  4D5U A;  2XG6 A;  4KRA A;  3DA4 A;  3LK2 B;  4FSP A;  1HXT A;  1GFQ A;  2JMM A;  2XTR A;  3GP6 A;  4G76 A;  1YS5 A;  2KZ7 B;  3POR A;  4AYD C;  5KAI O;  3AA0 A;  3SZD A;  4D65 A;  2K4T A;  3PGR A;  1T16 A;  2AXT O;  3BRY A;  4IL6 O;  1ZHT A;  3VE2 A;  4AKR B;  2R4O A;  4O3Y A;  1PRN A;  3WI4 A;  5ADX L;  2M07 A;  5G38 A;  2R4N A;  2ZFG A;  2WJQ A;  2ODJ A;  3T24 A;  4AKM A;  2W81 C;  3AA1 B;  2M06 A;  2Y2X A;  4PUX A;  1T1L A;  5EE2 A;  4XNL A;  3AA6 A;  3AAE B;  5B5E O;  2KC0 A;  4C69 X;  4G75 A;  1P4T A;  4LSF A;  2XE2 A;  5DL5 A;  3SYB A;  4U9C A;  1GFP A;  2IWW A;  2J1N A;  4FRT A;  4LSI A;  3UAQ A;  3DA3 A;  5ADX K;  2K0L A;  2JQY A;  2POR A;  2LFU A;  3AAA B;  3NJT A;  2XMX A;  3SY7 A;  4AYE C;  3DZM A;  4AYI D;  4FQE A;  1IZN A;  2XTQ A;  5AFU K;  2WVP A;  3SZV A;  3KVD D;  3DWN A;  4RJW A;  5DL7 A;  4E1S A;  3LK2 A;  1G90 A;  4AZL A;  4N75 A;  2F1C X;  2PRN A;  4LSE A;  1ZHY A;  2KDY A;  3A0B O;  2KZ7 A;  3PF1 A;  2QTK A;  1HXU A;  2F1T A;  1E54 A;  1S5L O;  3VZT X;  5DL8 A;  5AFU L;  2LHF A;  2XE1 A;  3K19 A;  4FZM A;  3HW9 A;  2Y0L A;  3A0H O;  4FRX A;  3PGS A;  4PJ0 O;  3VY9 X;  2Y0H A;  1OSM A;  3PQS A;  2MNH A;  5TIS O;  2R88 A;  3HWB A;  4KR4 A;  4F4B A;  3AA1 A;  3LK4 1;  2ERV A;  3AA0 B;  7PRN A;  3QRA A;  3POQ A;  4GCP A;  4GCS A;  4O3W A;  4JCH A;  3SYS A;  8PRN A;  2MHL A;  1THQ A;  1QJ9 A;  4AKR A;  4O49 A; 
#chains in the Genus database with same CATH homology
 2R4N A;  3BRZ A;  2R8A A;  2R4P A;  3PGR A;  1T16 A;  3BRY A;  3DWN A;  3BS0 A;  3PF1 A;  2R4L A;  1T1L A;  3PGU A;  3PGS A;  2R4O A;  2R89 A;  2R88 A;  3DWO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...