3BS0A

Crystal structure of the p. putida toluene transporter todx
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
432
structure length
414
Chain Sequence
DLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFAPDGNQFELGLDVVTTDIKVHDSHGAEAKSSTGPYVGPQLSYVAQLDDWRFGAGLFVSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWTSLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWGGRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPASLTLGLAHQFNERWVVAADIKRAYWGDVMDMNVAFISQLGGIDVALPHRYQDITVASIGTAYKYNNDLTLRAGYSYAQLILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGLRERVQTTEMLRQSHSQINAVVSYSKNFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TodX
publication title Outer-membrane transport of aromatic hydrocarbons as a first step in biodegradation.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 88
structure length 414
sequence length 432
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3bs0A00
2R4LA 2R4OA 2R8AA 3DWNA 3PGUA 2R89A 3PF1A 3PGRA 3BRZA 2R88A 2R4PA 1T1LA 3PGSA 3DWOX 3BS0A 1T16A 2R4NA 3BRYA
chains in the Genus database with same CATH superfamily
3HOEA 4FT6A 3SYSA 3DWNA 4E1SA 2F1CX 2R88A 2R4PA 3A0BO 3G7GA 3WI5A 1OPFA 3PGSA 1QJPA 1IZNA 2YPVA 3AA7B 4FQEA 4N75A 1ZHYA 1QJ9A 2KXPB 3SZDA 1ZHZA 3LK2B 3BRZA 1GFNA 2KC0A 5IYUA 3DWOX 3LK3B 4FESA 2XE5A 2K4TA 3QRAA 4AUIA 4C00A 4UB6O 3UPGA 2X9KA 2R4LA 4E1TA 4N59A 5EE2A 3HW9A 1OSMA 3AAAA 4UB8O 2KDYA 3POUA 6PRNA 3PQSA 4KR4A 2JQYA 2R4NA 4AYEC 4CTDA 2J1NA 1GFQA 3O0EA 1ORMA 3PRNA 2K0LA 5KAIO 4FOZA 1QJ8A 3AA0A 2FGQX 3K19A 4FMSA 3AAEB 4KRAA 2N2LA 4C4VA 3DA3A 2J4UP 4GF4A 2KZ7A 2YNKA 3HWBA 3PQUA 2O4VA 2XTRA 3JTYA 1H6S1 4FZMA 4K3CA 4RLCA 1BT9A 2ZFGA 3HOLA 2QTKA 3POXA 1T16A 1HXXA 2ERVA 5H2FO 2X27X 5G39A 2R4OA 5PRNA 4FUVA 4PUXA 3UAQA 4AFKA 1PHOA 2M06A 2XE3A 2XE2A 1PRNA 2Y0HA 3VZUX 1THQA 4XNLA 4O4XA 3VE1A 4AYNA 4N74A 3SY7A 3VY9X 4O3YA 1GFPA 4O3WA 3PF1A 3AA1A 4LSIA 3EMNX 1MPFA 3GP6A 3JCUO 4FZLA 3A0HO 4AKRB 3SYBA 4AYDC 2IWWA 3AA6B 4F4BA 5DL5A 1HXUA 2LHFA 3LK42 4KR8A 4LSFA 4G75A 2JMMA 1BXWA 3WI4A 4AKMA 2WJRA 3BS0A 4LSHA 2XG6A 2M07A 3DZMA 5AFUK 3PGRA 4GCPA 4AYMC 1T1LA 2WJQA 2Y0KA 2ZLDA 4JFBA 3PORA 5GV0A 5GTHO 3POQA 3BRYA 4FRTA 3AA7A 5B66O 1E54A 3KVDD 3LK41 2KXPA 4GHBA 2XTQA 4IL6O 2Y7SA 3LK2A 4O49A 5D5DA 4XNKA 5FVNA 1YS5A 1ZHXA 3LK3A 4FRXA 1BH3A 2W80C 5TISO 5JDPA 1Q9GA 3PGUA 4C69X 2XE1A 5G3AA 3WU2O 3AAAB 2XMXA 4JCHA 3T20A 2PORA 3QRCA 4RL9A 4RLBA 1HXTA 4QQ1A 5B5EO 5ADXL 3VY8X 2MNHA 3NSGA 2F1TA 1MM4A 4G76A 8PRNA 3AA0B 5AFUL 4AYID 3RBHA 2LFUA 5DL8A 4C4VB 5ADXK 1G90A 3AAEA 4FZNA 2KZ7B 3KZIO 5G38A 3T24A 4B61A 2R89A 3A2SX 4D5UA 4D64A 5T5FA 2AXTO 4O3ZA 2FGRA 1Q9FA 3VZTX 1IZNB 2F1VA 2GE4A 2R8AA 5DL7A 2IWVA 2Y2XA 2W81C 2MHLA 4FSPA 4O3XB 4PJ0O 5E79O 1MM5A 3DA4A 2Y0LA 4LSEA 2N2MA 1S5LO 3C5OA 4GCQA 4N58A 3T0SA 4K3BA 3FYXA 3VZWX 3AA1B 5DL6A 3TZGA 1GFOA 3UU2A 3VE2A 2WVPA 4Z3TA 4D65A 5GTIO 4FSOA 4PR7A 4O4UA 4AKRA 4AZLA 1ZHWA 3AA6A 3NJTA 5G26A 7PRNA 2ODJA 1P4TA 4U9CA 4RJWA 2OMFA 4RJXA 3SZVA 4GCSA 5KAFO 3SY9A 1ZHTA 2PRNA 3V8UA 1GFMA 4BUMX
chains in the Genus database with same CATH topology
2R4LA 2R4OA 2R8AA 3DWNA 3PGUA 2R89A 3PF1A 3PGRA 3BRZA 2R88A 2R4PA 1T1LA 3PGSA 3DWOX 3BS0A 1T16A 2R4NA 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4L A;  2R4O A;  2R8A A;  3DWN A;  3PGU A;  2R89 A;  3PF1 A;  3PGR A;  3BRZ A;  2R88 A;  2R4P A;  1T1L A;  3PGS A;  3DWO X;  3BS0 A;  1T16 A;  2R4N A;  3BRY A; 
#chains in the Genus database with same CATH topology
 3HOE A;  4FT6 A;  3SYS A;  3DWN A;  4E1S A;  2F1C X;  2R88 A;  2R4P A;  3A0B O;  3G7G A;  3WI5 A;  1OPF A;  3PGS A;  1QJP A;  1IZN A;  2YPV A;  3AA7 B;  4FQE A;  4N75 A;  1ZHY A;  1QJ9 A;  2KXP B;  3SZD A;  1ZHZ A;  3LK2 B;  3BRZ A;  1GFN A;  2KC0 A;  5IYU A;  3DWO X;  3LK3 B;  4FES A;  2XE5 A;  2K4T A;  3QRA A;  4AUI A;  4C00 A;  4UB6 O;  3UPG A;  2X9K A;  2R4L A;  4E1T A;  4N59 A;  5EE2 A;  3HW9 A;  1OSM A;  3AAA A;  4UB8 O;  2KDY A;  3POU A;  6PRN A;  3PQS A;  4KR4 A;  2JQY A;  2R4N A;  4AYE C;  4CTD A;  2J1N A;  1GFQ A;  3O0E A;  1ORM A;  3PRN A;  2K0L A;  5KAI O;  4FOZ A;  1QJ8 A;  3AA0 A;  2FGQ X;  3K19 A;  4FMS A;  3AAE B;  4KRA A;  2N2L A;  4C4V A;  3DA3 A;  2J4U P;  4GF4 A;  2KZ7 A;  2YNK A;  3HWB A;  3PQU A;  2O4V A;  2XTR A;  3JTY A;  1H6S 1;  4FZM A;  4K3C A;  4RLC A;  1BT9 A;  2ZFG A;  3HOL A;  2QTK A;  3POX A;  1T16 A;  1HXX A;  2ERV A;  5H2F O;  2X27 X;  5G39 A;  2R4O A;  5PRN A;  4FUV A;  4PUX A;  3UAQ A;  4AFK A;  1PHO A;  2M06 A;  2XE3 A;  2XE2 A;  1PRN A;  2Y0H A;  3VZU X;  1THQ A;  4XNL A;  4O4X A;  3VE1 A;  4AYN A;  4N74 A;  3SY7 A;  3VY9 X;  4O3Y A;  1GFP A;  4O3W A;  3PF1 A;  3AA1 A;  4LSI A;  3EMN X;  1MPF A;  3GP6 A;  3JCU O;  4FZL A;  3A0H O;  4AKR B;  3SYB A;  4AYD C;  2IWW A;  3AA6 B;  4F4B A;  5DL5 A;  1HXU A;  2LHF A;  3LK4 2;  4KR8 A;  4LSF A;  4G75 A;  2JMM A;  1BXW A;  3WI4 A;  4AKM A;  2WJR A;  3BS0 A;  4LSH A;  2XG6 A;  2M07 A;  3DZM A;  5AFU K;  3PGR A;  4GCP A;  4AYM C;  1T1L A;  2WJQ A;  2Y0K A;  2ZLD A;  4JFB A;  3POR A;  5GV0 A;  5GTH O;  3POQ A;  3BRY A;  4FRT A;  3AA7 A;  5B66 O;  1E54 A;  3KVD D;  3LK4 1;  2KXP A;  4GHB A;  2XTQ A;  4IL6 O;  2Y7S A;  3LK2 A;  4O49 A;  5D5D A;  4XNK A;  5FVN A;  1YS5 A;  1ZHX A;  3LK3 A;  4FRX A;  1BH3 A;  2W80 C;  5TIS O;  5JDP A;  1Q9G A;  3PGU A;  4C69 X;  2XE1 A;  5G3A A;  3WU2 O;  3AAA B;  2XMX A;  4JCH A;  3T20 A;  2POR A;  3QRC A;  4RL9 A;  4RLB A;  1HXT A;  4QQ1 A;  5B5E O;  5ADX L;  3VY8 X;  2MNH A;  3NSG A;  2F1T A;  1MM4 A;  4G76 A;  8PRN A;  3AA0 B;  5AFU L;  4AYI D;  3RBH A;  2LFU A;  5DL8 A;  4C4V B;  5ADX K;  1G90 A;  3AAE A;  4FZN A;  2KZ7 B;  3KZI O;  5G38 A;  3T24 A;  4B61 A;  2R89 A;  3A2S X;  4D5U A;  4D64 A;  5T5F A;  2AXT O;  4O3Z A;  2FGR A;  1Q9F A;  3VZT X;  1IZN B;  2F1V A;  2GE4 A;  2R8A A;  5DL7 A;  2IWV A;  2Y2X A;  2W81 C;  2MHL A;  4FSP A;  4O3X B;  4PJ0 O;  5E79 O;  1MM5 A;  3DA4 A;  2Y0L A;  4LSE A;  2N2M A;  1S5L O;  3C5O A;  4GCQ A;  4N58 A;  3T0S A;  4K3B A;  3FYX A;  3VZW X;  3AA1 B;  5DL6 A;  3TZG A;  1GFO A;  3UU2 A;  3VE2 A;  2WVP A;  4Z3T A;  4D65 A;  5GTI O;  4FSO A;  4PR7 A;  4O4U A;  4AKR A;  4AZL A;  1ZHW A;  3AA6 A;  3NJT A;  5G26 A;  7PRN A;  2ODJ A;  1P4T A;  4U9C A;  4RJW A;  2OMF A;  4RJX A;  3SZV A;  4GCS A;  5KAF O;  3SY9 A;  1ZHT A;  2PRN A;  3V8U A;  1GFM A;  4BUM X; 
#chains in the Genus database with same CATH homology
 2R4L A;  2R4O A;  2R8A A;  3DWN A;  3PGU A;  2R89 A;  3PF1 A;  3PGR A;  3BRZ A;  2R88 A;  2R4P A;  1T1L A;  3PGS A;  3DWO X;  3BS0 A;  1T16 A;  2R4N A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...