4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Factor H binding protein variant A10_001
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
2W80C 4QQ1A 4AYMC 2YPVA 2LFUA 3V8UA 2KDYA 3HOEA 4O3YA 3PQSA 3KVDD 2Y7SA 3VE2A 4AYDC 4O3ZA 4O3WA 4AYEC 3VE1A 4O4XA 4AYID 3UAQA 2KC0A 1YS5A 4AYNA 2W81C 5T5FA 5EE2A 4O49A 3PQUA 4O4UA 3HOLA 4Z3TA 4U9CA 4O3XB
chains in the Genus database with same CATH superfamily
1BZ7A 2XN9B 4P5KA 5IHUH 4PJ9D 4KK8D 2W65B 5E0FA 2HX7A 3GMRA 3QUHA 2P80D 3K6SA 2WN2A 3GO1H 3MROA 4FXLA 2CG9X 3GBMH 4NKDA 1SDDA 1U8KB 4XNMB 3MV8A 1IBGH 3ZR5A 3ABGA 1NMBH 3GXPA 1A9BB 3I6KA 3OX8A 3WNJA 2Q7YB 3DZMA 1TFPA 1RD6A 2D0GA 3L5WA 4O49A 3I3BA 5C92A 2IAMD 3MGAA 4R7VA 2QLVB 2VSKB 4M6ML 3LKQA 4Z7NB 1KXVC 3ECQA 2IDQA 4J3BA 3KCWA 5AW5B 1INQB 1MJJB 2YKLL 5GSRA 5IFAH 2N0KA 4TOYL 1D2OA 4LRIA 3VQMA 2MCG1 1SUHA 1HSBA 2EE3A 1KEGL 4MASA 1PLBA 2OX5B 4QCIA 2X10A 4PJCE 4XP4L 3T8MA 4LGSB 5KBNC 4BH8B 4K2UH 5EV7A 4F7PA 4CDGC 1NAMB 4QHKJ 2Y3AA 5CWSB 2QPFA 2J57A 1L9RA 4LKXB 5FFOA 1PDKB 4TLKA 4L23A 3UC0H 5JDSB 1BIHA 3ULVH 1BF2A 3DROA 1B90A 3D48R 3KYKH 3GTVA 3N44B 4A2HA 5D2LF 4LPCA 1CFVH 5E1AA 3ZDYE 3HOEA 1CXLA 3TCLB 2CCWA 3GUFA 4NKIL 4DVBA 5B5EO 1MVUB 3FUEA 1NWPA 3IU4H 3HBQA 2QQLH 5E4AA 1WA2X 5C86A 2MQGA 2CGZA 3AG3B 2AKRB 2XA8L 3L3JB 1DTUA 2QT6A 2WP3O 1RJZA 1TTRA 2HB0A 4PS4L 5AFAA 2UXGA 5KW9H 1MAML 2VAJA 2OR7A 3BAEL 3UDWA 5ES4B 2J73A 1GGBH 2E9IA 1RVFL 3O0RL 4YXHL 3ULSA 4FQIH 1NCWH 4A6YL 5JXAH 1U42A 4F20A 1DHKA 4PN6A 3VXUA 3UC2A 1RV6X 4FNRA 3RGVC 5ANMA 1TYJA 5AKVA 1DQTA 4HJ0C 4UF7C 1FA4A 4PJIF 1L0QA 3SN6N 1BCIA 5IVOA 4UNUA 1CFQB 2CKBA 5HVGB 4IJ3B 4F9PA 5BRZA 2CR0A 1UGKA 4PRAB 2X0WA 3D2UB 3K80A 3B3BA 4FRWA 4GEJA 15C8H 5EUOF 4N6RB 4UTAA 3HPJA 1BGXL 4P9HC 2Y9RT 1GGUA 2ZXCA 2BNQD 5HHME 4WO4A 5AOJA 1P6FA 2V17H 1Q72H 2GBTA 5I5RA 1WA0X 1RLWA 2VMDA 2MOVA 2FBJH 4BKLA 1D9KB 2XE3A 3IETB 4NO0A 1HDMB 1QSFD 2EEBA 3HNTH 4JCMA 5C9KA 2QELA 3V0JA 2FT7A 3ZGIA 4W9JC 3VO0A 5BUGA 1IM3A 4GW5A 4JO2L 1TJGH 3DVFA 4L3FA 4P5TC 4LT7A 4PSRA 3ROLB 4DOHB 3CBJB 2WBJD 1HEJC 2WWKO 2JJSA 3E3QE 1A9VA 2GJZB 3QULB 3HMXL 2C9QA 1L7TH 1NMAH 1UXWA 1DQLH 1NCAH 2ZICA 3K91A 2L04A 4Y9CA 5K1NA 1J11A 1MFEL 2FX9H 2BOLA 3NCCB 5IVXA 1D5XA 4LLVA 3RY6C 4R96B 1XCWA 3TJEL 4EI6A 3RJOA 2WP3T 5L7XH 1XGTA 5GZOA 4NOFA 4ZFOA 4FA8A 4NFBA 1WHOA 3E6HB 3DNKA 4Q8BA 5LBSL 3WTSA 3NIGE 1W16A 1QZNA 2V7HB 1XF5A 3VH8B 3VNZA 2M06A 3ZBMA 2DKUA 5IG7B 2D7TH 3VD0A 3NAAL 2RAMA 5EWIL 3SYQA 3PV6B 2WQ8A 2Q1EA 2ERVA 4O2FA 1W9XA 3LRLA 3MBEC 1ZSHA 5SV4A 5C0DB 4YAQA 3ISWA 4G9DB 3QIWC 4CMMA 3DV6B 5GZNA 1KTLB 4KI5C 4ABVA 4Z7OF 1RUQH 1AY1L 5EPMB 3S35L 3MRCB 1YEGL 5DS2A 5TK4A 4LIQE 4NUQA 1XB6A 2PO6A 5D6CA 4PJ8D 5B39B 2Y7LA 3GIVA 4OT1H 4BZ2H 3UH8A 2IQAB 4XWGL 4AJYV 3PL6C 3TEWA 1A66A 5L4IA 2AK4B 2WUBL 2ESVB 3ABKB 3PWVB 3VSTA 1ZT7A 3ELAT 3SDCA 3AU0A 3MV9B 5F7DB 1T80A 5I16A 2AITA 1KBGL 2OTPA 3H7BA 2WWKT 3SSGA 3VAEA 4ENEC 5IJCC 2F1VA 4WI4A 3HCVA 3GDCA 1HXMA 2MNHA 2H41A 4BUGA 4GKZB 2PR4L 3WO3B 3QO1B 2BSCA 3D3VD 4YO0A 2HT3C 5DU7A 1UXLA 3CFTA 4MA3B 5KBKA 1YNKH 4X5LA 5GGSA 4XMTA 1N3NA 4YUEH 5DD0L 1D6EA 1N8ZB 2PCFA 4HZLB 3WFDL 4KJWC 4BIKA 3O4LD 4C00A 2VXSL 4MD4A 4WRLA 5F0MB 1TVDA 4A39A 2O1AA 3H9YA 1OAUL 1JVKA 3DUUB 1E27A 1OARH 4IRZA 1BMZA 3K8KA 4DHLA 1OVZA 2AGJH 4WFFD 3RGVB 5BPPA 1EEQA 4WWOA 1UWXK 3MJWA 3ULVD 3L17A 4P4KC 3T04D 2K8MA 1R3IH 4PRPE 5DYFA 2VMFA 2OMWA 2CM6A 3EO0A 4KRPD 3KXFD 3A0BO 2WXNA 3CZUB 3QNYA 5DJ6B 1BWMA 4XXCA 3A67H 3P0YL 1DVFA 3FZUC 5D70H 1CCZA 3IPEA 2VC2B 4K3DL 2HX9A 1SJXA 3FO9A 3QUMB 3OZ9H 1MHEB 1M2OA 4KDVA 5FB8A 2BVQA 4YHKL 1IBDA 4L2LA 1D5BB 5E5MA 4D7PA 3FU9A 1XCTA 3BIKB 5DEFA 1MF2H 1F02I 3CLEL 1FZMA 1NCCH 3HJEA 4MTMA 4HAGA 3ULUF 1F58L 2H3NA 3G6DH 3X13A 4A2GA 5INDA 2VXVL 4LGPB 3K6FA 4F2EA 2BZCA 4P5TB 5EOCL 4X6BB 1Z9MA 3LNHA 2OCJA 2O6EA 1P4LA 5C0CE 2JFCA 3T71A 1TQSA 4L9LA 1FHNA 4N0YH 4Q2ZB 1DBAL 5GRUL 3ZTCC 1I1YB 2ZOKB 1KEML 2R4LA 5ALBH 4GG6A 4WKXA 4KJPC 2DWYA 4MZRA 3IFPB 2G30A 3ARTA 2VLRA 3F04A 4F58H 5K9KB 1T7WA 3F8UB 3JTBA 1SY6A 1A6PA 1YEIL 1U8LA 2EEFA 1SGKA 2PXYD 5F2FA 1II4E 4GMSH 1V3LA 1QBBA 3U2SA 2BNUA 4XB8A 1BQ5A 3S34L 3CSYB 4BQ8A 3OKKB 4XO5A 2IH1B 3BDBA 4TF4A 5IROC 4HBCH 3T4AC 4FA7B 3NA4A 3QDMB 3UABA 4NLAA 3ZE0F 3MBEB 4MNQE 4EF3A 1FFPA 4HX1B 1GHFL 4G1EA 4OQTA 4XP5L 4K94C 4F7EA 3N1QC 3QIWB 4XMKH 5DJXB 3MUGA 5GISH 5I71C 5C07A 2R4RL 2DLGA 4H0HB 1WQVT 1F1AA 4RNRB 2DWSA 1WHPA 2DLHA 4MCYA 1IAII 4JZOB 4LOUD 5A2KH 2N0MA 1E54A 1E6OH 3IFNL 2P47B 3F12A 1JF6A 1QI3A 5FO2A 2C9SA 2Y7MA 3BDYL 1J7VR 3U9PH 2VQTA 3G6JE 4DP8X 4R6UA 1JXKA 4ODUA 3ZW3A 1XF1A 3PL6B 1TG8A 4FHKA 4HHWA 4PVMA 4K5OA 3TBVA 5IMOB 5JZ7C 3MA7B 1G7HA 1C5BH 1MW0A 5D7JA 3T0ED 5FR3A 5LGJA 4ZNEE 2D3JA 4PGBA 4FADA 3S8GB 1AO7B 1WCBA 3BVNA 1AIFB 2B1AH 3GDBA 3IF1A 2GBVA 3SPHA 5L8JB 5EOQH 1LDPH 2EZ0D 5CR8A 3M7OA 4YSSA 4RBPK 1EVUA 1SJMA 1W0VB 1JWSA 4ATWA 3DX0A 3FB6A 3T0DA 1Y6MR 3OB8A 1RPQA 1S8DB 3H0TA 5KVEL 2GSGA 4WU5B 4IBUA 3VFWA 3LXUX 4OZIA 4GS7C 3HB3C 4FFZH 5AZEL 5A1AA 4WFED 4QXUL 4JHVA 2J2ZA 1WP6A 5C08A 3HVNA 4XO4A 1TKWB 2O5XH 4P4KB 4F5CE 4U1IA 1HOEA 1T1YA 3B43A 3BWSA 4FQXC 1F5WA 4HH8A 3PDGA 4RX4D 4BFRA 3NTCH 4UQEA 1X7QA 1GGTA 3ECWA 4NERA 4EOWH 3MLRL 1S9XA 2MQ0A 1KELH 1A7NL 4NO3A 2Z35B 5C0RL 5KJRL 3QW9A 5IVXF 3Q1SL 3S36H 2NZ9D 4APQC 2EILB 1KGCD 2Y07L 2AXGB 3ET9F 4KRLB 2EIKB 1XGRB 2OTWB 4GKLA 4XCEA 5I19H 2WLKA 4LGRB 2AXJA 5FDYA 3ZQWA 2UY6A 2XQBH 5IZ7A 4H88L 4MA8H 5H2BB 2HJKA 5DMIH 4LLMB 4B9GA 1I1AC 3WUZA 2X38A 3ZT7A 5C2BL 2Y1YA 5L2KE 3IXTA 3ULAB 2CKNA 4G80B 1ZHBA 4JZJA 4KK6C 3ARBD 4ZPVA 2JKWA 4ELME 1MLBB 3UAEA 1B0RB 3VFRB 1BDYA 3HMXA 2ETWA 3FH8A 3KVQA 2Y6SC 5JW4R 5ESAB 2B4CC 2BIOA 2DF3A 2KL6A 1KIRB 1FAIL 3APNA 1H9VA 2W8CA 5KSBF 4YJZL 2V7NB 1QVOA 2B08A 2C9RA 3G6AA 1MAJA 5AW0B 4F2ME 5AB9A 2F7RA 2YKLH 3QZOA 4TOYH 3KPQB 5C0JB 4CN6A 1F00I 3H9HB 1KEGH 4G72B 5BS0D 3MBXL 3KNBA 2PPAA 1FQ9C 3KHQA 5DEGB 4QHNA 4UM8B 3H6JA 3PAVA 2F7QA 3NSXA 4OCRH 4XPHH 2XZAL 3HR6A 4HUNB 3T4AB 3BAIA 4MAYD 4U3CA 2BHZA 2QQKL 2FJFB 1KJ2B 1UJTA 3T3MB 2D73A 2VAAB 1QMUA 3RZCC 4YSEA 3WV0A 1A8JH 1JFHA 5I71B 5HDWA 1KLUB 1A6AB 3IFLH 3WIHH 4FCAA 1YNTB 3VGFA 2RQEA 3EMNX 3TOPA 2DLFH 5MEPA 1N7ML 5J11C 3QYCA 2R0WL 3GJFH 5LGKA 4JRFA 4N0UA 4XBPA 5J1AA 4ELDA 3NJTA 1U8KA 4HWZA 3QWOA 1ZJBA 3SBPA 3SZKC 3HBPA 1A9BA 3T77A 4I85A 2AJZA 1BAFL 4OZGE 2Q7YA 2VMCA 4PWIA 1DFBH 5TDPB 4HUVA 4UV4L 1WT5A 4J1UA 4NUJB 2X4QB 5HI5C 4NQDB 1D7DA 3I9GH 4RLBA 1MAMH 1UKTA 1Z5YD 2DEYX 2DI7A 4U0RC 3UPAA 4HPOH 2X6AA 1RVFH 1NIFA 1INQA 1MJJA 3OPZL 2D7QA 2HWZL 4BRVA 2F1EA 3RWJA 1IARB 4Z3EA 1FL3A 2XV3A 1J1OH 4KMQA 3LRSA 4LL9A 4MJ6A 4GXFA 5AOKA 1ICTA 2XY1A 2Q87A 4F9LC 3SYCA 1NAMA 1XD1A 4OFYD 5GTIO 3MRDA 3TH4T 1E4WH 1J86A 3BCFA 1UXMA 2B8OT 3HAEG 2F5AL 4KNSA 4UAOC 2OMYB 1BGXH 4GS7B 2ICWB 3HB3B 5DO8A 1PDKA 1ZVHA 3CFBB 7TAAA 3U7WL 4JAMB 3V0AC 1VFBA 2E9BA 3BP6A 4NQEB 1A3LH 4KUZL 4Z7QF 2X70B 3MXVL 3V0GA 1DVSA 2R2EB 3AVEA 4HKJB 4YN3A 2XVBA 4FQXB 5IK3A 3KPPA 5MEOB 1V5JA 3CVIH 3QUKA 3SPCA 3SO3C 1J9RA 3CHXA 4WIQA 2J44A 1JNNH 2MKWA 2AKRA 3ESVF 3GQFA 3L3JA 1HOCB 4OF6A 5D7KD 4DPCX 4X98B 4MDIA 4TQHA 3SKJL 4Y19B 3L4ZA 4HJJL 4X7SH 5EU4A 3N42B 4JDZB 3BZ4B 5DVKA 3IJEB 3W2DH 1TNNA 1NBZA 2OK0L 4APQB 1X3DA 4B3VA 3MLTB 3UJTL 3P9LB 5H37A 3WELA 2P5ED 2R2BB 5ISZB 4PVBA 5FYJE 3AA0B 4A37A 3FONB 2XA3A 3F5WB 3TJEH 5T5FA 1I1AB 4X0KB 1KPVA 5EDSA 4PRAA 5IJKA 3R1GL 4D9RE 3BAYA 1EJFA 2YPVL 3I02B 4BGLA 4HD5A 4ZMZA 1F45A 3GBNL 5DUPH 5EWIH 2J71A 3FS9A 3GZPA 5AW2B 1OCWL 1X7TA 1D9KA 1ZV2A 3QSKB 4W9DC 3AMKA 5IB5B 1AVAA 3IETA 4I0PB 3GNML 2GYSA 2Y5EA 2E74C 3KGTA 2VDNB 3H3BC 1WGOA 2NLJB 3X1GA 4DFHA 3SGJA 1AY1H 5D8JL 2YAMA 5AENA 3QHTC 2WOYA 3GMOB 2YGQA 1SHSA 3WSQL 4OV5A 3D39E 3QBTB 2A4CA 3O6FC 3SDDC 5DJCA 1FI8C 2LAAA 2C1PB 3LX9A 4D3CL 4JZNB 1JE6A 2GJZA 2XQYA 4LLWA 5ECJE 4Z78A 3K2MC 5C09B 2Q8AH 4H1LA 3EFFB 4XWGH 3MRNA 3RZCB 2XWDA 3LQAC 4PGEA 1IE5A 4HF5L 5B38B 3ARYA 4DT2A 2F1BA 2OCCB 4Z0BL 4FG6D 1T6VN 3WXWL 2MCPL 2APTA 4DKAA 4X5XA 1K5WA 1VHPA 5J11B 2X4TB 1ACZA 2F1AA 4LCWA 5I1LB 1H6EA 4WSGA 1AZBA 3B1UA 4R83A 1J9CT 2V7HA 4OZIF 2YD1A 1G6RB 2EINB 4OLVH 3SBWA 3VH8A 5IG7A 5TDNB 3S48A 5EBLB 4Z95L 4X7TA 3HN5A 4ZXBD 4U0RB 3VMNA 3ETBF 4FQ1L 4NT6B 2G5UA 3T2QA 4DP4X 1QBAA 1GYVA 3HFML 3IJ9A 2HPTA 3Q8AA 1BOGB 4MD5B 4M4RB 1DJZA 1S7QA 1CLVA 4FMFA 4PHZA 3VXOB 5I1KH 25C8L 4ZFFB 2B1HL 2RJMA 1AQKH 4HUXA 1MCRA 1LO5A 4NPYA 1RURL 3VGDA 3WJLC 5BUPA 5B3SB 1FZJA 5B39A 4QXVA 1OSYA 4IKLA 1E6JL 5K59E 5C3LD 2J6EA 1WAEA 4UAOB 1HHIB 1W80A 2W1NA 5DHEA 4C56B 2ESVA 2UWEA 3H4HA 3PWVA 4K3DH 2G60H 3WNNA 1GY2A 5D7LB 4OLZL 2PYED 4AQ1A 3DTXA 3RIFF 2BY0A 3UEQA 1HYSD 4RGNE 1MJ7L 5HPOA 4CVUA 2ADYA 5L4FA 2OSYA 3AY4C 3S37L 1HEHC 4GKZA 1GYCA 4V1DD 3SO3B 1HQ4B 2OMBA 2W59A 4A2MA 1ITCA 4MA3A 4GO9A 4TVPL 5DFVC 3RPKA 3DYPA 2XC8A 5D1QA 3JVFC 1QR1A 4HZLA 2FATL 3OGOE 5TF1L 3L4CA 1DQML 3QDAA 4ZAKA 4HCRH 5GRJH 3V9FA 2IOOA 2X27X 4KVPA 1SHWA 1E8XA 2DQJL 2GJ6B 1EDQA 4JKMA 4ZOEA 3DUUA 4M9OA 2FBRA 3HG0A 3RGVA 4DN3L 2IPKB 3T24A 4YBQC 3RURA 2IWWA 1JMXA 4KVCL 3NN8A 2J56A 3D06A 1MQKL 1XCXA 3QWNA 1V55B 3KLLA 3L5JA 2WJ5A 5DJ6A 3MACH 4Q9RH 5PAZA 4TUOB 2Q2EB 3VMPA 2WKGA 2EP6A 2GTWB 2H0EA 3PE9A 5FS5A 3TXAA 3CPUA 2L7JA 1FNGB 3TT1H 1JIBA 3S34H 4PJ6A 5IR1B 1GPOH 5B3JE 5JHDE 1G9HA 3E8UL 4U3SB 5I17B 1MHEA 4HKXA 2AJXL 1Y1UA 3KBFA 3MNZB 4BZ1L 4KVNL 4PRBB 3FRUA 1NAKH 2R39A 3CDYA 3MNWB 5AAWC 4BFOA 4XP5H 3CU1A 1T21B 4LLAA 1D5BA 1PYWA 3X3GL 3QRGH 1RZJC 3HHMA 1FNEA 1BQKA 4GJTB 3ARDD 4N59A 4Z7UB 2MHLA 2KXPB 4P5TA 4CMHC 5I1JL 4MSWB 4X6BA 1W0WB 1VEOA 2K6ZA 2XBTA 3O6FB 3SDDB 4Q2ZA 4M56A 3RIFK 4LPVA 4GAFB 2BDNL 4U7KA 2ZOKA 4JANB 1H3PL 2LLLA 3OJDA 2MCAA 3VQ2C 3VRLE 4GG6E 5IM7B 2D2OA 5IB1B 4ADJA 1X5KA 2Q0ZX 4LE8A 4NRYB 3KPSE 4C55A 3QAZC 3IFPA 4KDTA 1JXDA 3P3YA 4AY0A 5K9KA 3W5NA 4HCFA 1FFQA 1CFNB 4I1RA 3LS5L 4I4WB 1U2CA 3EJPA 3FU8A 3WNIA 5GGVY 1HL8A 1PIFA 2CO4A 4MCZB 2BIMA 1L9QA 1RZ7H 4QRSA 2FB4L 4R4FH 4P5SA 5AWNH 3CSYA 3Q2CA 4KHXL 3VW3L 5C0BD 3GMQB 1IUZA 4KH9A 2BY1A 3QDMA 2EDHA 1VGKA 1LD9B 1Z6JT 2KQMA 2X9WA 3MBEA 3N44F 1KNOB 3IWVA 2F19L 4UANA 1TSRA 2OSXA 5TK2A 2XTSA 3QIWA 1AD9B 4DKEL 5AZEH 5C07E 5I1DB 4R7LA 4AIXA 4H40A 4AEEA 4UOQA 5IEHB 3KD4A 3TYFB 3DSFL 4JZOA 3D2TA 3QZWB 4PJDF 4NCC1 1EFQA 1ZHLB 4ZG1A 5IQ7H 5E7FA 3OLDA 4W81A 3BI9X 1VZGA 2XG5A 3MX0B 2P8MB 3ZDXB 3INOA 5FDWA 1W72L 4K7PY 4OVUA 3SKOA 1W2KT 3QCTH 5CEZL 3SJVA 3D33A 3MRQB 4B50A 4L0YA 5CIPA 2W95A 5T3XE 3Q7JA 4AKRA 4DF9A 1T7VA 2QSCL 3GMNB 3FCSA 1AYRA 1DBKH 4J3OC 4X2UA 5AG8A 2VXQA 1S5IL 3D85A 4OF7A 2VOTA 3WCYA 4BRJA 4QYOB 1KZQA 2ZWLT 4LNRB 4QEGA 1AO7A 3WTXA 5I0VA 4XVUC 1AGEA 5AG9A 4X6CA 3WJJC 1FZOB 1Z0MA 4HFWB 5D1ZC 4ZJ9A 3FFDB 2HRLA 4S1RH 5BVPH 4XXDA 1BX2A 5HY9B 1W0VA 1ZLUH 4ABUA 4H88H 2AQRA 2Y7NA 3R0NA 1OP9A 1Q9KA 1YA5A 2WW8A 4PWGA 1NUDA 5C2BH 4NGHL 1ZPUA 3AM8C 1S8DA 1RH8A 1S9WA 3P9WB 1KGYE 2WNXA 4WU5A 2VGLM 4FNUA 1FG2A 2E0PA 3LIZH 2VL5B 3UX9B 4DGYL 1MFAL 2DQUH 3IXAB 4MJJA 4E9XA 4LEOB 5C08E 1P6AB 4B0MB 4XOCA 3TBWB 4WHTA 2N2MA 3MA9H 1TKWA 4N74A 3I75B 4P4KA 2DWTA 4BXVA 3KMDA 3DJSA 5G55A 1GJUA 3ZQXA 5FCUL 2QVKA 2XE5A 3B4NA 1KY7A 1HKLH 2E9GA 4MNHB 1F4XH 4TNFA 1IJ9A 3T6VA 1U33A 2K6WA 3S36X 1J8HB 3IBEA 3UBXB 4ODWA 1A2YB 2B16A 1F86A 3KH3A 3P4NB 2BWQA 1KB9K 1QWNA 4NJ9L 3TYGL 2AXGA 1WAPA 4GO6B 4KAQL 2QFPA 2E46A 2V5SA 3BSZA 3FT2A 4Z8FL 3DK2A 4KGJA 1ZS2A 4XNXH 4X6DE 3CVBA 3R06B 1O6SB 3UZVA 2NZIA 5H2BA 2E86A 4RIRA 3IVKA 2R9HD 4CMHB 1BQUA 1N7MH 2E75C 3MYZA 5A6LA 4U1LB 3HG1E 2R0WH 3ATDA 3IMWA 1MCCA 2XWRA 2PW1B 1H3GA 2VO5A 4G6KH 5FOJA 1PZ3A 3EOTL 4I2XB 4WENB 2RHEA 2JCCB 1MLBA 3VFRA 2DY2A 4QRPD 4NYLB 3PQYB 1AJ7L 2Z34A 3NIDB 2W9LA 5DTFB 4CJ0A 3TWCL 3IB4A 3QAZB 1U3NA 4GSQA 2OSWA 1GIGL 3GLEA 2AEPL 2V7NA 1K3ZA 4MQXD 3HS0C 1MFBL 3G3LA 4M5YL 1I9RL 2VSMB 4HDIA 3KPQA 5C0JA 2LU3A 3H9HA 1RMFL 1WWCA 4N2KA 3FH7A 4XHQA 3QC6X 5HVHC 4OCYL 1GMEA 2HSIA 1FO0L 3RFRA 2FJGA 5JO5B 3DX6B 5DHDA 1ZE3H 1BF5A 2FJFA 2X3AA 3LB6D 4DUXA 5C0FB 2HAZA 2VAAA 4YDVB 3ATBA 5F7LB 3UG3A 3GM8A 3ULUL 4XPTH 3V9CA 3II1A 3TZVA 3RIAF 4JQIA 3ZOAA 2FLBT 1A6AA 2XQYK 5HDBE 4AYID 5DRWB 1NCDL 5KYUB 1HJCA 2J3SA 1PD1A 5TISO 2CK0L 1FSKC 3DIFB 1G1YA 2I85A 4N0UE 3WU2O 1CK0H 1PF3A 3GSNH 4LEXH 1GKEA 3UP6A 3V6ZB 4BZYA 3MYJA 2X1OA 4AW7A 4XX1G 3B56A 3FO1B 4TSCL 3LK42 2AV7B 5SWQB 3R4RA 3FTXA 3GFUA 5TDPA 1JZJA 1P53A 4HK3N 2GSIB 4RMRA 3SKJH 2DQTL 4HJJH 4HGMA 4NQDA 4XNKA 4QHLA 2OMTB 5FUCC 4ILDA 1T66C 1QSZA 2EUXA 3GSOA 1YQ2A 5HHOB 4TNVF 4JL1A 1KIPA 4X9GA 3WHXA 1SXBA 1K8IA 3FCBA 3UG5A 1GJIA 4JKNA 3NACL 3QP3A 5FO8B 1DBBL 4PV9B 3BKJH 5MI0C 3RB7A 3T8VA 1A64A 4L8BB 1BW8A 1GSMA 4ZUUB 3FQUB 1KMGA 3FT4B 1CXEA 2ROXA 3GRWA 3R1GH 1MRFL 5DD5L 5F1NB 1NSNL 5C0EA 2ZXAA 4P3DA 1UFGA 2NTFB 4AIOA 4CN4A 1M7DB 1Z5LA 5JW4N 1YMMA 2G0LA 1PX3A 2Z6FA 4JM2F 3GJEA 3DVNB 2X0VA 1H19A 1MY5A 2CALA 1JGUL 4N24A 3V79C 1VADA 2HRHA 3AABA 3FSOA 5KBPA 1FGNL 4FQXA 5MEOA 2VDPL 1OTUD 5GGRB 4K8RC 1QLFB 1JZDC 3LKNB 3NJIA 1YECH 3RIAK 3WUWG 3BIBX 4PYGA 4L1TA 4MXWL 4X98A 1IQWL 1A7OL 1BBDL 5DQDH 1T6BX 2R69L 4JDZA 3BZ4A 3OZLA 1JNLL 5AZUA 2EIBA 3KDPB 3QS3A 3A0OA 2X7LB 1ZXQA 5E2UH 3H9SD 3MLTA 2CGRH 2A7BA 3P69A 3Q6GL 5FWRA 4L5FE 4QJ5B 3EGXA 1OTSC 1F97A 1M71B 2NNRA 4RRPA 3ZKXC 3FONA 1SOKA 4QRRA 1A8ZA 4HVBA 4NM8H 3F5WA 2RTTA 1GYAA 1I1AA 1P4IL 4YDZA 2MCPH 4TL5A 4X0KA 5IFJB 2WJQA 1PTZA 4LBEB 4FFYA 3IN0A 3QPXH 3ZVVA 1T4KB 2YD8A 4KNTA 4IRSD 2QQNL 3W37A 3I02A 4A2DA 1GTNA 4TNVK 3UERA 1HNYA 3C75A 1S7TB 3ZL4L 3EDEA 5DMGC 3Q06A 3AU1B 4XXWC 1EJ6A 4LIQH 3WS3B 5IB5A 2XTJE 4I0PA 4N87A 4EE2A 3LKPB 4FFVD 5TDOB 4E9VA 1BYNA 4FQ1H 1JZHA 4I48B 3HS0B 1ZLVH 4GCPA 1TCRB 1OGSA 3MOAH 4PJGA 4B5EA 4ORGA 2OM5A 4TM9A 2ISDA 1R24A 2WAQA 4B27A 3GI8L 5HVHB 4G5AA 2WCPA 2C1PA 2M1KA 4I0KA 1NLBL 2GBAA 4PVNA 4YHOL 3KL5A 1OM3H 4WUKL 3EFFA 3INUL 1YEDB 1MZYA 1E3ZA 2A6KA 4CU6A 3JWOC 3EJRA 4D9QE 2IGLA 4B3EA 2VRAA 1GZHC 1BMGA 3GXTA 2ALAA 3JWDL 3OJ2C 3L3KB 4K0OA 4MRCA 3WNKA 5A2CA 3NCJL 3MUJA 1FSKB 2V2WB 3QHZL 4LCWE 3V5HB 3OXSA 2HFEB 4FOZA 4KKCD 4P49A 1OM9A 5CHNB 4J39A 4G76A 3ZDZE 4WF7A 4FG2A 1XF4A 1CFBA 4YXKL 5TDNA 3WFEH 4FZLA 3KPLA 4M3JA 1BD2E 3O2DA 1ZIBA 4PREA 4DCQB 3D0LA 2FATH 4WFGD 1N8OE 5J8OA 3NIFE 3U46A 1BOGA 4MJ4A 1Y7VA 3QJVB 3MLXL 4M4RA 2EIMB 1TLKA 4BA8A 2KERA 4NC1C 2YAEA 2EEAA 3D09A 4HXAH 4NQCD 4LOVA 3MJ7B 1DUYB 2ZIDA 1WJ3A 1WTGT 5MI0B 4NUGL 3QARA 4XI5D 1WIUA 2R29A 3DUSA 4G5ZH 4FYSA 3RL1A 4YVNA 4F9LA 3VFGH 5CJXC 4YMPA 2IADB 1Q94B 3T9WA 2BSSA 3CC5A 1AS6A 1U8HB 2ESVE 2UWEE 1H0DA 2CJ3A 4YQXL 3ABLB 3E8UH 1ULVA 1RUKL 2G2RA 2YD0A 4OD3H 3RU8L 4XNQB 4BZ1H 5HDLA 3U4KA 3QUXD 3U1PA 1N6QH 2BIIA 3UTTD 1EGJH 3MU3A 1ECZA 4TUJB 4KRMB 3W9DA 4HG4K 2NXZC 3NZHH 3KAAA 5GPRA 2B0SH 3UYPA 1Y1DA 1XH3A 3JV6B 1YEJH 3BW9B 1HQ4A 4UT6H 5C9JB 1ONQB 4XGZB 3UOAB 5E99H 1MXDA 5D1QE 1TZOA 3BZFB 3BD4A 3V8UA 5GGTA 2F53D 4M6NL 4BYHA 3FU7A 2GAZA 4WY7H 2YZ1A 5I30L 2HLAA 2WMPA 3THMH 3QEQA 4MJ2A 1MIEL 2BDNH 4OI8A 3UADA 1RZFL 2XQYG 4DN4H 5KS9B 4UB0L 5E6ID 2AXFB 3JT2A 3DJZA 4H1LG 4X5WB 3ZKXB 2RB8A 4ZTPL 1LEGB 4GAYB 1UB6B 3B2VH 3SDAD 4GQPH 1RP9A 5JMOC 4RFNC 3FOLA 5DHVB 1E0OB 2NX5D 2GTWA 2WLYA 2X5PA 1CDIA 3LDBC 4ZS6C 4XCFL 3T3MF 1FNGA 4BWTA 4KHXH 4MCMA 3LZLA 3O11A 4U3SA 5I17A 5L88L 2R56H 2J5WA 1A4CA 1MHHB 4PRBA 3VH8G 5C3IA 1QOKA 1YNTF 2I27N 1MWAH 3B7YA 5D93C 2F19H 1YS5A 1YY9D 1N12A 1TQBC 3CFDB 2NNFA 1L5GB 3FU3A 5I1IL 4AGQA 4DGWC 4M1CD 3LKOB 4H8QA 4Z7UA 2KXPA 3V4VH 2WYZA 4WUUA 1BFOB 4DQOH 4MSWA 3DWOX 4JKWA 4PR7A 2O6FA 1W0WA 4PP2B 3SDDA 2MFNA 1OSMA 5TE6H 4KJYA 3KYMA 3VG0L 3NK3A 3CFCH 5CEZH 4IMKC 1K6QH 1JN6B 4OLUL 1LP9A 5CLYA 4HS6B 5B39G 1QSVA 4F7TB 3BEVB 4QD2E 4ZNCD 1EZVX 4MQ7A 2H2SC 4NRYA 4YIQB 4JPIB 4LU5L 3DA3A 4JN1L 1G9NL 3TO4D 2Q76A 4NS0A 3TH2T 4OJEH 1TTGA 5ESQB 5HP5A 1CFNA 5EU7E 2ZKXA 2OYPA 4YLCA 2DLTA 2DQEL 3R8QA 1JPFB 1SXNA 4MCZA 1ODAA 5E4OA 5AW8B 4NN5C 3IYLW 2BP8A 3T08A 3AWGA 1F56A 2GJRA 5DK2A 4Y5VA 2OL3H 2HKHL 4GBXC 3V0VB 1KNOA 1X5HA 4L8CA 4P23C 4JLRB 3NJVA 2G3ZA 3U0TA 3OKEA 5I1DA 2AJUL 3FHEA 4GIOA 4HSQA 4UQ3B 5IEHA 4P07A 1E9PA 3GIZL 4L4VA 4H4NA 2ZJSL 3GYRA 4GT0A 2DH3A 3B7SA 3LEXA 4LPXA 3MX0A 4LCVA 3W11C 3RA7H 2P8MA 5DVMA 3VGHA 2GJPA 3OPUA 3V52L 4DUVA 2B5IC 3H7LA 5JXED 3SJVE 5FCUH 1REIA 3N42F 4ANWA 5E1GA 4PRHB 1GFMA 4DEUA 5M7QA 3VQ1C 4PRIA 1T1XA 2WHVA 2A9NL 4BSVB 4BXSV 4P48A 2EH8L 5ABAA 1G7QB 2D7MA 4YPJA 3LKRA 1XIWA 4UBDD 1KF9B 1PVHA 1TQWA 2EDNA 2ZUXA 3HAEH 3MJ9L 3RWEA 4ANVA 2FQEA 1U8JB 3KHOA 3PDOA 3QQ9C 2VDQH 4XO8A 5IWLA 4AL8H 4LSEA 4RESB 4FYRA 3TYGH 4JO4H 2FX7H 4X6CE 4YGVB 2Y1AA 2NXZB 5LG6A 1FZOA 2EIDA 3AY4A 2NUPA 1PZ5B 4HFWA 5E9DD 3LRMA 2AJYH 1IILE 1UZ6F 1ZS8B 1NIBA 3NSJA 2XETA 4G3YH 2Z3FA 4KO9A 3EYFB 3TJPA 4HU2A 3HZVB 3VE0B 1YYML 4JFUA 2CUMA 5BVJB 4NZRL 1AZCA 1M9SA 1ZGLM 2NR6D 1O7VA 1JCVA 8PRNA 1XEDA 3GZOA 5IB4B 4AW4A 3LNEA 1S46A 4L4TA 4WGKA 3CFKB 3QUGA 5FK9B 3TBWA 5MENB 1I9IL 4FJ6A 4D2NA 1W15A 3I75A 4ODHH 5E2WL 1K5NB 5EDXA 2ZNXA 5CLTA 2BH0A 1OSEA 1VGEL 4JUTA 3STLB 1ZT1B 4RFNB 4LAQH 4MNHA 1P7QA 3WEBA 3LDBB 2FJHB 4XP9H 3P1VA 1J10A 1FO0H 1SVZA 1PW3A 4Q14A 3P4NA 4BCYA 2IV8A 4Z3FA 2BK8A 5AVUB 2ITCB 1DQJB 2R88A 2PNDA 2WVTA 3KWVA 5FYKL 2W60B 1Q4NX 1KG0B 1L7IH 1S7UB 2I07A 1TQBB 3VX0A 1C7SA 4LSRH 5E9NA 1O6SA 2OR8A 4WKZA 1WCQA 1NCDH 3HE6A 2FEDD 1QI4A 1ZHKA 1UWGL 2JKLA 5FWQA 4XOBA 1MDTA 4NI3A 4RBPH 5I6MA 1YMHB 1MEXL 5DYOA 2PW1A 2K0RA 4OTXH 4MNQD 4D9LH 4NJAL 2JCCA 2Y2YA 2OJEB 1DJHA 4QT5A 1CIDA 4KC3B 3PQYA 2AMUA 3O9WD 4WNJA 5DTFA 3VX1A 2IWFA 1JZ2A 1UM6L 3A6OA 3P77A 3FSWA 2BP0B 4ZQKB 3O8XD 3OHMB 4NNPH 2CBTA 4FABH 1FFOA 1DANU 2G2NA 1XVSA 1P5VB 3X11B 3ARBC 2ARWA 1NICA 3WD5L 5EEUA 3CDGB 4NN5B 4MB3A 5AVVB 2WNGA 2YD2A 2Y0LA 2L3BA 2N1TE 5I76A 3Q2VA 1XX9C 3L4YA 5DD3L 5JO5A 1RHHB 4GBXB 2FX8L 1ZA6B 5DC9B 3SCMC 4P23B 1DQVA 3MFFA 4YDVA 1MRFH 2V2XB 1TJHL 1OGAD 3BP4B 5CEZD 3HKZA 5CU5A 3X1NA 2YIHA 3DJTA 3O4OC 4LLYB 3FFCB 1BJ8A 4ODXB 4Y2OA 5DRWA 3RLSA 3U4EA 1E4XL 4R2GC 4FNTA 2Z92B 3CXDL 5AL0A 3MV7B 3TIDA 2FWOA 4HJTA 4Y4HA 3WEOA 3ATEA 3C5SA 3DIFA 3AA7B 4HP5A 2VMEA 2HFGL 4MAYC 2NPLX 4P05A 4IKKA 2J20A 3V6ZA 2ATKB 4KKBC 1JZ6A 1FGNH 2B5IB 2VDPH 1E9OB 2VM3A 4A66A 1PY0A 2W0FB 3FO1A 3PFQA 5KANI 4OGAD 3IDIB 3VI4B 1C7TA 5G4OA 5SWQA 4UIMB 3BAKA 5KAIO 4N2IA 3A6CL 1WZMA 1CXHA 3MDJA 4HFUL 2GSIA 1IQWH 1JSYA 1QPKA 5HPMB 2OMTA 2WTOA 4F80A 1KBPA 1MPFA 2BIHA 5HHOA 5T1DH 1OPGH 3Q3GA 3TA4D 2X41A 3V7AE 7FABL 2OYKA 3Q6GH 4M9PA 3WJJA 3HUJA 3DIVA 3MJ6A 1NLDH 4M6AA 3P30H 4U1SA 4OI7A 5F93C 4S1DC 4PV9A 2FUTA 4F37F 4QRUB 4K3HA 2CRIA 2VXTH 4J12A 4JQXC 3SEPA 4X6FA 5D5MB 4ZUUA 3N06B 4TVPE 3NFPB 5ADOH 1H6UA 4CAGA 2QQNH 5F1NA 3OVUB 2NTFA 1M7DA 1YMME 3EJZC 1EHLL 5JHLA 3ARZA 3DVNA 1N26A 4JFTA 2QGCA 3FUFA 4UWQB 4AEIL 3IGLA 2A9MH 4D94A 4Z7UF 4U9CA 1QRKA 4IJTA 1AGBB 3SY7A 3E9TA 4XNAA 1SQ2N 2YPLE 1QLFA 4NZTH 5GGRA 2HLFD 1ZTXE 2VDLB 5KVFE 3ZKND 2AZAA 4Z9KB 2X4NB 1KCSL 1D5MB 1M05B 3WE6B 5DHXB 5HHQB 1KB3A 3HRZC 1QUNA 4Y16C 3GI8H 4L1SA 4YHZL 3AS2A 3RDTA 5D2LE 1NCBL 4M7KL 5DT1H 1KCKA 1CG9B 3FUMA 3BVDB 3T20A 3VSUA 1JK8B 2YMOA 4AIZB 5FA3B 1YUHB 2Y7QB 5E56A 4XC3H 4ZUTA 3MRLB 3QFJE 2HVKA 3JWNH 3LH8A 2CLRB 4FTDA 4YBHA 5L9DH 3WJMB 4GXVL 3EJYC 4PJHA 1MCIA 3U4BL 3IEAA 4NPJA 4QRRE 1OXYA 3RNQB 5D1XC 4IGBC 4R3SA 4RWYL 3F83A 2J8UB 2ZUUA 3VWKC 1QJ9A 5ID1A 4LBEA 3TVMC 2XKSA 5JOPD 4LHUA 3C6EA 3TA3A 4IIQC 2YARA 1RJYB 2VLLB 4UDTB 2WB7A 3C08L 3BVUA 4MJHA 3A4DA 1A5FL 2L7UA 4FI8A 3ZYOA 2JXMA 2X9XA 3BXNB 1MCWM 4GSUA 4JFHD 4YXKH 1RIHL 2KI6A 3QXAB 3AU1A 2EDTA 3VFPB 4GI6A 2QPDB 5L2JB 1ETZA 3WS3A 4F37K 5TDOA 1WZ1L 1SXSA 2P7TB 4I48A 4AEHH 5KUKA 4PJGE 4M1GL 2OJZL 3ARBB 1HS6A 1XO8A 2YEVB 3TN0C 1PY4A 1WDAA 3GBEA 3WKNA 1EWHA 2VDRL 3MV8D 5ABDE 4OKDA 1NANH 5JR1L 1MRDL 1X5FA 2HTLD 3H3KA 1CFTB 3BX7C 2WTRB 4NUGH 3I74A 5T1KB 3SCMB 3T0SA 1IAKB 2C4FT 1HVXA 3F7YB 1PJ9A 3QNXB 4NN7C 5IVZB 4YQXH 4MXQC 3O4OB 2A1WL 3D9AH 1OZUA 1RUKH 1QSEB 3TEXA 5F6HJ 1F3DH 3UEZA 3WY4A 4R2GB 3ZMRA 1G7PB 3L3KA 2J88H 3UBGA 5ACMA 2KDGA 3QEHA 4WEBL 4D64A 2V2WA 3CBKB 3VM7A 3RRQA 1SYVA 3V5HA 3FTVA 2HFEA 4IS6B 3OXRA 4ZPTB 3ARQA 2DYPA 1KWGA 2YWZA 4XPGL 4RMSA 4Y2NA 1YJDL 1XL4A 5IQLA 2WY3B 3D4GA 5IHLB 5D7SL 2J8OA 4IRZH 5E08H 5TGBA 4D8PA 3BAWA 3RVWC 1NC4B 2LT9A 4M6NH 4N1HB 3TLRA 3OR7B 4FQLH 4DCQA 3ILDA 2IPUK 3CXHK 5HJ3B 5CP7B 4O02B 3HE7D 2NY2C 1MJ8L 1DUYA 4ZTPH 1OY3B 2ZKHL 4ZDHB 3BZ5A 4JGUA 3TURA 3ZHFA 1M2VB 4JRLA 2H45A 3WY2A 4L18A 3TBBA 2OULB 1A3ZA 3JUZA 1GJWA 3BLBA 4NBXB 4EDXB 3MLVL 5I24A 4HC1A 2YA1A 2PTTA 3EH1A 3GGWA 3NG5A 4XCFH 3MLYH 1CI5A 4GKNA 1U8HA 1U0QA 1DVTA 4BQ6A 4K5LA 5L88H 1ET7A 3VXUD 3NSFA 4XNQA 2ZT9C 2DAVA 1UKSA 3BRZA 1G7LB 3V5DA 2H8PB 2BNRE 4TUJA 3PWPB 3GM0A 5BRZD 5H4YA 1OB1B 2E7MA 3OMIB 5I1IH 1OAQH 3JV6A 1QQDA 5SX5K 4YSQA 3U9UB 5C9JA 1BSIA 3EHBD 4P59H 4XGZA 3HRZB 1UQSA 1DUZB 2Y24A 1OTTC 4WO4D 4Y16B 2X89A 4GW4A 4ODTL 5T1MB 1T7XA 2F58L 1CYXA 1Q90A 3NIDF 5BMFL 5JNYA 1T20B 1TZ8A 4XP6H 3QEQE 1SY6H 1VPOH 1BQHB 1A47A 1QO3B 2XPGA 4NO0D 4KDWA 3WXVH 1BZDA 4BFFA 1ROWA 1SMDA 4P9HL 5KYWB 4Q0XL 1WBYA 2VC2L 1IM9B 4NM4H 2V2TB 2COQA 1PG7H 2ICEC 1CFMA 1K4CA 4JJHA 5B1KA 1LEGA 4GAYA 4M5SA 5D1XB 4IGBB 1G9NH 2W0KA 4H8VA 1IM3D 2CLVB 3CZFA 1UB6A 2XI9A 4JN1H 3VWKB 4BFGA 2ZF8A 1DQQA 4OQTH 2MPAL 1IKFH 3TVMB 1HXUA 2E7DA 2DQEH 3G5YA 2G0KA 4NPKA 4IIQB 4P2AA 4U1KB 4XWOC 2EO1A 1WAAF 4KQ4H 3LEVH 1QFWL 1ZHNB 4JCWA 3E2HC 2EEDA 1KPUB 3WI9A 4LSFA 2BSDA 2A6IB 4QOKA 2F0CA 4XZUB 1PEWA 2XPZA 3MCKB 2P4AB 4LMQI 5A3IC 1M1XB 5FEBA 3CFDA 4G6JH 1WWBX 1L9TA 1JRHH 3TN0B 4ZFGH 4ZYKA 1JXFA 3LKOA 3GIZH 4WUUE 4FGMA 2DN7A 2ZSVB 1BFOA 4KROD 5HHNA 1XSKA 3QG7H 2YQGA 3RVVD 1GS7A 4PP2A 3QJSB 2JI2A 1E5CA 3I6GA 1VACA 4J3OF 1EO8H 1LP9E 4JRXA 3TZGA 4CNIB 4GMTL 4HS6A 1WS7A 2NCMA 1JNJA 4A04A 1BZ8A 4QTHB 4Y1AD 4YIQA 4NN7B 3PY9A 4CSPA 2FH6A 3T6QC 1GZHA 2G4EA 4OLYH 3NT0A 2B9AA 4KTDH 5ESQA 4JDEA 1N9PA 2MTAA 1SN0A 3LN5A 4NHCH 2X3CA 2X4OB 4O3YA 1JPFA 3QCUH 2P5PA 1ETA1 4UMSA 4QWWC 1MW2A 2G3NA 3FQNB 1TZIB 1CE6B 4WFHD 4YDNA 1NKOA 3VYPA 5HSFA 3V4LA 1MH5B 5DEZA 2HVJB 2ENSA 2EXYC 1LE5B 4H0GA 4NZRH 2VDOB 5H2FO 3QORC 5E8EB 1BYOA 2YMXL 4IKNA 4RGND 4M03A 4Y1TA 3W0WB 3UIYA 2NY0D 4UQ3A 3DIDA 4L4VE 1MXGA 2J5LC 2NY2B 4WU7A 3IDXL 1FV1B 1YEEL 2Y6TE 1DP0A 3ZDXE 1DZ0A 4DNLA 3HPLB 5F7FA 4RA0C 4H2AA 3IK2A 5EEXA 5BZZA 6TAAA 4O5LL 4PRHA 4PRIE 4Z7VA 2CIKB 2UVEA 4LZKA 1PLGH 5ENWB 4BSVA 1MCPL 2Z0BA 1FFTB 1XZ0B 1G7QA 2A6JA 4XN8A 5GJSL 4AYGA 1SJHB 3LS4H 4RH4A 3P4OB 2KLSA 1U8JA 2YD4A 2RR3A 1N6VA 1T03L 1FC1A 3CVDA 3QZLA 4OIBA 5BXFB 2A9AA 3ZT5A 3M7FB 1PRNA 4YGVA 1PG7W 5IW1A 3FQTA 2KHAA 1ZS8A 4GFXA 4PSPA 2FSEB 1F4WL 3QYNA 3GSRB 1DVFD 5KEZA 4A7TA 2EIZB 3UJJH 5F9JA 4UYPA 5D7HA 5C7ZA 1NGQL 3EYFA 4Z7IA 2ENJA 4PB9L 3OQRA 3EDFA 2PN5A 3HZVA 3VE0A 2O5ZL 4FKHA 1UJ3A 4YDKH 5KAQG 4JFSA 5LQBL 4S10A 5EIVA 3C09C 1F4YL 3S5LA 1A4JB 3U0PA 4L4TE 2K0LA 3WIIL 5K9OA 35C8H 3ESOA 3P73A 5FK9A 5F9OH 1QFWM 5AVXB 5IMMB 5MENA 1PU0A 1NEZB 1XQ4A 2ICEB 1ASQA 3O6ML 4HQQL 1U9KA 4N8CH 3Q8CA 3ILQD 5LN8A 2AZUA 1K5NA 3RGHA 4WWKA 2LFUA 3OG4B 3K6OA 4IU2B 4HS8H 3EYOB 1ZT1A 4YR6B 5FW7A 3GS4A 3VJ6B 4JHUA 4DGUA 1NEPA 2K4AA 1WRFA 1NCHA 4HIEB 1PZUB 1CXFA 1AKJA 2GT9B 2W81C 4ZD3H 1JHTA 5DD3H 4Z3JA 3E2HB 1KTRL 1BVZA 4QRTA 3VQLA 2IPUG 1DQJA 1I8KA 2GPZA 4UI2A 2VLRD 2WKOA 3CHQA 5FGCE 1KG0A 1TJHH 2C3XA 2DW5A 4M8QA 5AVWB 3PRZA 3B3IB 4ZSOE 4AH2B 5AVQB 2GIMA 2JQZA 3G5WA 2KBGA 1FVEB 2I25N 5EA0L 5TFSL 4DP7X 4PTUB 5EBMB 3BJ91 3T4YB 3EYQC 3WGUB 5IBLD 5IKCB 1YMHA 2QR0A 1KYFA 3QDJA 4X8JB 3WLBA 3P3UA 1OE1A 2OJEA 3WAJA 4FKEA 3QXWA 4N2CA 4YZFF 4EUPB 1SQMA 3II2A 2LLGA 4HIHB 5BZXA 2BP0A 3L4VA 1NAMH 4GQRA 1KJ2L 5EU6E 3VXSB 4UQDA 1CGSH 2WXIA 4K94L 3X11A 2VDKL 4ALAC 2NY1C 2GTQA 4U3XA 4NC0B 1L4IA 1UZ8A 1N59A 5EZLB 1HIML 1ZCRA 1VZHA 5KAFO 3VRJB 2YPKB 1BZOA 1MAKA 3NJKA 1QUPA 5BRQA 2IWEA 5LDSA 4GBXA 1FNFA 3SZ6A 4F8TA 1CD9B 5JA8B 2EDQA 3VFOB 5LCVA 1UASA 3BP4A 4PBWD 3O0EA 3QORB 3QIBD 3DOSA 1ACYL 4IIZA 4R8WL 1DBJL 1B3JA 2A6DB 3KLKA 4LLYA 4HOXA 4F7MB 2FVNA 4AEIH 2J5LB 1MIML 3F58H 2EC9U 3AA7A 1RCYA 4MB5A 2ATKA 3MUHL 4OKVB 1CICA 4DW2L 1E9OA 5KWYC 4WTZA 4NNXB 3F6IA 1H3VA 2K3HA 1WEJH 1W6LA 3NYKA 2F15A 4KU1A 1EEUA 1ES0A 5LUMA 2LHFA 1EH9A 4JFZL 2BXZA 5KBMA 5KS9F 4YHZH 5AB0A 1NGXB 5K1VA 1USZA 4LARH 5T5FH 3B9KA 1SLXA 1Q1JL 4ZO7A 1WFIA 5C08D 2OMUB 4GT7A 3DTUB 3C6LC 1HN1A 1YPZB 5GRYA 3CSFA 4ZT1A 1NGPH 4M8VA 1F8TH 3HUJE 3HHSA 1LO0H 3R4DA 4GXVH 5CN1A 5EO0B 3U4BH 3SDXB 1Q9WA 2Z93A 1B9KA 4E5XA 1ZEAL 5FM4A 1MCWW 4XPAH 3CN1A 1O7SA 5DGQA 2E7CA 3RL2A 4PLKC 2O4VA 4DIXA 1OW0A 1JJUA 4MZ3A 3ZO0A 1AANA 4P2OC 4YSDA 3LSOA 2R4SL 2WGXA 2DL2A 2X0UA 2EKSA 3MXWH 4EVNA 2ZXQA 3FQXB 3S4SA 2BSBA 5F71A 5DURB 4ONGL 2VH5L 5IJDC 5F96H 3SQOL 4F8NA 5EU3B 4JFDD 2A4ZA 1BYPA 4M1GH 4B7IA 4BKTC 1QBLL 4U2ZA 2C8NA 2N3JA 2OYLA 3WE6A 4F8LA 4PTTA 4Y9BA 4JRYA 1HINL 1EXUB 3NZSA 2PRNA 2IBGA 4PWFA 4PJXB 1CG9A 3SZDA 5JIQA 1DVYA 1NBVL 5DJ8B 5FA3A 3AA1A 1YUHA 2Y7QA 1NFAA 5DHYA 1HL5A 4PJHE 2VDMB 3C2SA 3NZUA 3T2NL 2CBQA 4B60A 1OAZL 2A1WH 3RNQA 4FTVB 4MAUL 2J8UA 5D55A 2B4CL 4YE0A 2NW3B 3MUUA 5KSVB 1KOAA 4FSPA 1Q0YL 1HTYA 4KGLA 4RAHA 4R5VA 2VDNL 4UDTA 3SB3A 3FQYA 3CLWA 2E7BA 4EZKA 3FHAA 3PHOB 2YFNA 3BXNA 4JFPB 1IFGA 5D7SH 4Z3TA 3VB9A 2XN9D 3SE4C 2YGOA 4JMNA 2ZOLB 1D5ZB 2GITA 5I9QC 4KV5E 4RETB 4KTEL 2W94A 5CXPA 2J6EH 2XVKA 2NY1B 4HUCA 3O41B 2YUZA 4BWUA 2VB5A 3VGBA 4HKZB 1H8NA 1JNHA 1MJ8H 1WG3A 3P0VL 2K1MA 2NNAB 1KXTA 3PAZA 4FX5A 3RWFB 2WTRA 2X2IA 3RVXD 3OKLB 2B59B 3FO2A 1FNSH 1ZLDA 5I8CB 4FUVA 1IAKA 4NAJA 3DARA 5AOZA 4BHUA 4M7JL 2NYYC 4PGZA 4YHIA 3QNXA 1G6RL 2ADIB 1J0ZA 2P44B 1A6WL 5EORH 1THCA 1G7PA 1NANI 3DOIA 5FAAA 4L37B 4ZPTA 4Q9QL 1P9MC 3RUGA 5I66B 3DETD 1GGCH 5KSAC 3JVGC 4N90D 2PPFA 4EEEA 5AKSA 4JO3H 4PM1A 1IC4H 5E94A 4G7YH 4N6QA 2LABA 2OR9H 1NC4A 3CVHL 4OD2B 2YNKA 3HLAB 3OR7A 4MS6A 1D6VL 5EZIL 1BPVA 1CD0A 3ZE2E 4LKCB 2ZX6A 3C6LB 2KZ7A 2BMKA 2Z31C 4X9BA 5CSBA 5CP7A 4NDMB 4HV8A 3KLHC 4O02A 1S4IA 4A68A 4IM8A 2VC2H 2IIJA 4FP8L 4UUJB 4OU3A 3QUMH 4LLUB 2OZ4A 1ZANL 1ZWIB 2QL1A 2WYIA 4OIAA 4ZDHA 2F8IA 3WNMA 2AXWA 3H42L 4JQXA 4LASL 3O2WH 3I50L 4G9FB 1F3DJ 1LMIA 3I3EA 3U7AA 1EV2E 4YWGL 4EDXA 4LHUG 5DS8B 2X4UA 4PCYA 4R7XA 1J5CA 1G9MC 5I1HH 4P2OB 3GRBA 4UOJA 2DMCA 3O6KL 3GXFA 2BS9A 3VDBA 5CGBA 2CHXA 1J1PL 2K4TA 3ENEA 4TLSA 5AYUL 1XAUA 2E6JA 3UAJA 3PWPA 4HIQA 3D2UD 3BRYA 2ZCZA 3KJ6H 2EH7L 1BXVA 2FLRT 3QR2A 4G6AD 3REVB 3EXJA 3HRZA 1DUZA 1RY7B 5T1MA 1NIEA 1JGLL 3PGFH 4K15A 1OCRB 3VZTX 1TVHA 3QUXC 2LW3A 3LZRA 1IL1B 5EUKA 3CFNA 1PG7X 3HOLA 1UA6H 2DQ6A 1D9KD 1I8MB 1BQHA 1SNRA 1QO3A 4N2HA 4AOFA 1IGJA 1UFUA 3HBGA 5FYKE 2ZCLH 3O0LA 4LSVL 4OJDH 1IM9A 4P2RB 3WKPA 1GCYA 1NBQA 2F54B 2MNUA 2ZAGA 5JHAA 2CLVA 2JTDA 1J9SA 1BEYH 3TVMA 4Y5YA 4O4XA 1GYUA 4I3SL 4IIQA 4XN9A 2P24A 1B4JL 4X80L 2P49B 2WYTA 1WZKA 1KPUA 1UC6A 4M1DL 4JFXB 4QOKE 1F1GA 1BQLH 5I9QB 3OAZH 4C47A 5C0AA 3LH2L 1NC2B 1YAZA 4NXKA 3E3QC 2YMXH 5EF0A 3OJMB 1FYTB 5F7YC 4J8RA 2Y2WA 4FFTA 2ZSVA 3LQAL 4EIUA 2VSDA 3VI4F 3IDXH 3W81A 2QPUA 3ZYZA 4DZ8B 2VXQH 3QJRB 2CLZA 1AC0A 1RJLB 1BXUA 3GTNA 5FIEA 1YLBB 3L95B 3PHSA 1CTNA 4JRXE 4N2BA 5E9AA 1QACA 1ORSA 5T3ZL 5I8KH 5JPNA 3D69B 4CNIA 1MCPH 4ECNA 3TV8A 2YFOA 3LTVA 4ZW6A 1UH4A 5GJSH 5G39A 4F1ZA 2J12B 5CCJA 1Y0LB 5HGAB 1I3GL 3TIEB 4JREC 5CCHE 2QVTA 2IDSA 2YXFA 2ZX8A 3FOMA 2FO8A 4FERA 4UQAA 1XR8B 2QEJA 2X4OA 4W9LC 3RVUC 4UTBA 5D5MF 1JUFB 4YX2L 2JSFA 5KSAB 1FLRL 5FKPA 3AC0A 5IMKB 1T5XB 1F4WH 3NCEB 3FQNA 1QAWA 3NEOA 2WIIB 1QHOA 5I75C 2L0DA 1UB5A 1U4EA 2AK4D 2ESVD 4NHUB 4PQXA 5GQBA 3KBHE 3TO4C 3BAJA 3MV9D 3P11L 4OF0A 3K2UH 1CDYA 2JIXA 4W9ZA 2CO2A 2Z31B 5CF3A 1F4YH 3ESMA 3VZWX 1UACH 1HHHB 1AR2A 2JKXA 2QVMA 2AJVL 5F7KC 1ASPA 3M45A 1FV1A 3PGRA 4HQQH 2R7EB 4PRHE 4XVOA 4U6VH 4Z7VE 5DZOA 5AUMB 1NL0L 2CIKA 3ZDYB 3ZSSA 3BSZH 2F8OA 2CWRA 4UU9B 1RUAL 4OZFB 4UDUB 4CUCA 4PR5A 1S78C 2VR6A 2XY2A 3P4OA 1CFSB 3RGVD 3NQIA 2HG0A 5BXFA 4HJ0D 3VWJA 4KZEL 3GI9L 3ETBJ 4XCYB 3ZX1A 3OTTA 2ZUYA 3C5ZC 4XAKE 3GSNB 1OSPL 1CLYH 1QFOA 2APSA 1CBJA 1YN6A 3GSRA 3UTZB 1TZHB 4KTGA 1EFXB 2EIZA 3OGCB 4LCIL 5EA0H 4V11A 4DAGL 5M94B 4X6EA 4QY8B 2C4FU 4UILH 1SLVA 1RPKA 2ICES 3UXFA 1CE1H 5ICZB 1IGCH 2KZWA 2WXLA 1A4JA 1B0IA 2GABA 5IMMA 2HP4A 1NEZA 2P26A 1T0PB 3P9MB 5HHMB 3FB5B 4BFIB 1AR1C 4P5TD 4IU2A 2BJML 5TD4A 5JPMC 3P3RA 3EYOA 4LVNC 5T5NF 5F7UA 3SY0B 3PGDB 2BOCA 3IDGB 3VJ6A 5LNDA 5I0YA 1RZJL 1I8AA 5DZ9A 5CZVL 2BOBA 1URIA 4K9EH 1GCFA 4HJUA 1RSYA 4P3CH 2GT9A 1M9WA 1JK9A 2NSXA 3MLWL 1BF8A 1F11A 3EO9H 5HI3C 4PMFA 5GIRB 2X09A 2CD0A 2ZAIA 5FUOH 3A6BH 4L1BA 5AEAA 5DUBB 3V4PB 3BQUA 3FBKA 3VXRA 1ACYH 3B3IA 3SZVA 1DJGA 3ZE1E 2R23A 1HH6B 3CIAA 1FVEA 4PRNB 4PTUA 5EBMA 4YHLL 3FUNA 1INEL 3WG7B 4XZ4A 1E9QB 1QNIA 3GLAA 5LXGH 3QDMD 3QDJE 4MQTB 3MBED 4X8JA 4DK6A 2JF1A 5DGRA 4H7VA 4MD0B 2N1KA 2K6YA 3QIWD 1PKQA 2HTKC 2BIQA 3FC8A 4EUPA 5I0DA 3HR5B 4U3HA 3OJVC 3IRPX 4HUUB 5J89A 3NIGB 4KI5D 3RVTC 1KACB 1YO4A 2AI0H 1CTOA 1E4XI 1U8CB 4JREB 3VGAC 3ZQ9A 4OLWH 2J8HA 1NCNA 3GRWH 4K3EH 2XG4B 1BZ9B 1LO2L 3S7GA 3HS8A 4TXVB 2F18A 5D7IA 3EOYG 1R3JB 1SOQA 3B2PA 4Y7OC 2YPKA 2ZWYA 3VRJA 1KENL 5I75B 5K9QG 3PL6D 5E1QA 4F1SA 1XGYH 4OGXH 3V9EA 3TO4B 4Y2DB 5AKTA 2VN4A 2XFGB 4PJ5E 2ZKMX 4DEWA 1MCOH 3ELQA 4Z3HA 4YHYC 5GS0L 2X3BA 3H2WA 4Z1PA 4W4OA 2V8MA 1AO7D 1ZTXH 4XTRC 4ENED 5KVFH 1CDBA 4N8PA 4RA3A 4F7MA 4L3CA 1KT2B 2EE6A 3S5LG 3CSTA 2HT3D 3IDUA 2X1PA 2AF2A 3UZEA 3SQOH 1PNCA 3D0VA 3BP7B 1U2HA 4KJWD 4NZUL 5KVGE 5EN2A 3CPLB 3UAFA 4PBXA 3DSNB 1NGWA 4PIRF 2DQGL 1JWUB 4WLCA 2WCSA 1NGXA 1IEAB 2AHIA 1BMWA 3LH9A 4XCCH 1KTJA 2ZWSA 4B0MM 1RFDL 4IDLA 2N56A 2BFVL 4FFYH 5BW7C 1DCEA 1JGEA 1NBVH 2FEJA 2XN2A 4P4KD 1MI5A 2DQIH 2WXOA 2VZ3A 1EVTC 3IDNA 4Y4KC 2AEWA 3MR9A 3KBPA 3C5ZB 1A4KA 2BS8A 2B3RA 2P1YA 4CVZA 8FABB 2TRYA 5L8KB 4Z77B 4UM9A 3FZUD 3TT3H 4MAUH 2B4CH 1YQVL 1KB9J 1I3VA 4PGJA 3DC0A 1XH2A 1AYOA 1UOKA 3QH3A 1O5DT 1VF5C 2VDNH 4PRPB 1SBSH 4MDJB 2BO0A 3HI1B 3VNYA 1PD0A 4AQZA 3HZ3A 3GMMB 3NEEA 4Y88A 4YSRA 1BT9A 3FQ2A 1NUNB 2YO3A 4AT6A 2AS5M 4Q4EA 2IG2L 2WNKA 3QNZA 5AYTA 5LJYH 3IKCB 1AR1B 1I3UA 2YLKA 4KTEH 2VWEE 3H85A 3D18B 5JPMB 3L6FB 3JYCA 4LVNB 5EU3A 3LEYL 1G7IB 5KG9B 2Z8WC 5JIHA 1T16A 5F3BB 1ADQL 3VRIB 1TMQA 1IGML 2O61B 5JDPA 4JRYE 2OMXA 2GQHA 1Q9FA 1ZAGA 2C3VA 2EYRA 4M48L 1I9EA 1EXUA 5I26A 1KZYA 2EDBA 1IQDB 2YN3A 3LMJL 2YGPA 3LXBA 4KJPD 3ZXAC 4ZMXA 2CJUH 4X7EC 3BN3B 4C57C 2XSKA 3O81A 1EEZB 2Z65C 3QQ4A 5IEKA 3ARGA 3Q5TA 2R8AA 4MA7L 3ES6A 2BVOB 2AEQL 3FULA 1ZKAA 2VITB 3N91A 1GGYA 5C0CB 4BSJA 1G6RH 3RTLA 1E65A 2X6VA 4FTVA 1HHKB 1LWRA 2OYMA 1A6WH 2H6UA 2J8UE 1AHWC 1IZKA 1FVDA 3BWUC 3LQMA 3O2DH 4IMLB 4OFVA 1UXSB 1UOLA 2CBMA 4QXWA 3DDFA 2NW3A 1GYWA 5IROD 3CWGA 1D5IL 1NDMB 1R3LA 2CBOA 1ED3B 2VABA 3BT2L 4K4KA 3LPFA 4FQHB 2XWBA 4JKPL 5FXCH 1GW0A 3NQKA 4K73A 4JFPA 4GIPD 4WTZG 3TZVD 2LU5A 3DK0A 5DFWH 4LSSL 1KJMB 1TPXC 2LFEA 4FLRA 2ZOLA 1D5ZA 2C9XA 2R29H 1XSJA 1BP3B 4JPVH 3VGAB 4ERSL 4Z76A 5CKAA 1JI2A 3CZLA 5LGHH 3PXHA 5ACLA 1MWOA 4Z7WF 5DK0B 4FT6A 4RISL 1AMYA 1R1CA 1X4ZA 5DZVA 4GAGL 4EIZC 2EXSA 5FGBC 1W8OA 4G8IA 2NNAA 4U7MA 5HYSB 4ZOCA 1PZSA 5F97E 4Q4IA 2B59A 4HSAC 4NQDD 3DPBB 4RWHA 3I50H 1RP8A 4XNUL 5G5DB 5JZ7D 3DJ9A 4E5XG 3ILEA 4YHYB 5I8CA 1LE9B 1L6XA 2GVYA 1A1MB 3QA3A 1MWAB 4AGMA 1MQ8A 1HHJA 2J1ZA 5I15L 4UNVA 1SLUA 5DS1A 3G6JB 2HTLC 4B9JA 3BIAX 2JB6A 1D3CA 5GGTH 4FQ2L 1J1PH 4N2LA 1WICA 4DVRL 4JFEA 2IVFC 2R0LL 3RUGE 2UX7A 2EDFA 4GQ9H 5DJ2A 3S4SG 5I66A 1OGTA 5HJGA 1DBML 4B41A 3PP4H 4K23L 2UY7B 4M29A 4WI9A 2EH7H 3RKPA 1J0JA 3HB3D 1DJWA 4LRIC 4QRFA 1FUNA 3V0WL 2Q20A 5D72L 3AAAA 1ZA3A 2ENPA 1GR7A 2GK2A 1JGLH 3HLAA 4G11A 4NQED 5C8JA 3OZKA 1Q8MA 2Q5BA 2AK1L 4LKCA 5AAMA 3OR6B 2QZ5A 1GGIH 4L8DB 3L2MA 4NDMA 4Y4KB 2H32B 3SY9A 3KEHA 4FQXD 4LSVH 1ZHWA 2XXMB 3TBTA 4UUJA 5CCKH 3IDJB 1X5GA 2OXGA 4LLUA 2P48B 1ZWIA 1IT9L 1JAEA 1G7MA 3NSCA 4LSDA 3RKDC 3IJYB 3AAEA 4Y19D 1UG9A 3CK0L 3UTSB 2MOGA 4EQ3A 1HI6A 4EKJA 1F3RB 1I7RB 1ZDQA 5DCCA 4PWEA 3LQZB 3CHPA 5DLLA 2CA4A 5JQ6L 3RIKA 4UQ9A 3C12A 4AG4L 1GAFH 1LYQA 4P2OA 4P2QA 5ISZD 4N2FA 5INCA 2P28B 2ZPKH 3DV4A 1U36A 3L9RB 4I3RL 3OAUH 3K0YA 4A7QA 2YQBA 3MJGX 2WQWA 4U1NA 1I1AD 5A40E 4JVWA 1YN7B 3SKNA 3IM1A 4GSDL 3MLPA 4I89A 2Y36H 2DPKA 4ONFH 1RZQA 2K8QA 3FT1A 2DWXA 3US9A 2BVPA 3K1KC 4KK6D 2YD7A 4QRAA 3REVA 3ZZLA 1BM3L 3LQAH 1RK1B 4PGDA 1S7SB 4POUB 3RHWF 5B1AB 1EJ8A 3HG2A 1QFWI 2VUYA 1R47A 5CEYA 3M1BA 4E9QA 5EZOL 1IL1A 4QAMB 4S2SA 3W39B 1YEWA 2Y6SD 3NESA 3HAEB 2E9JA 3AREC 1L3WA 5T3ZH 3KPRE 4I0PD 1XWVA 1KN2L 2IMNA 5DQ9A 5L2KB 3DA4A 4PPTA 2EKJA 3CHRA 2FEEL 5CILL 4R5TA 4AM0A 1P2CB 3EKCA 1BHGA 4P57B 5E5RB 1HCZA 3UFIA 5L4JA 4WO4C 4Q9BA 4ELMB 3C6SA 1I3GH 1AHWB 2W0LA 2EDEA 4KRAA 1U8OB 4MJ5B 3SPVB 1I8IB 1FLRH 5C09D 4D0BB 4F2MB 1IC5H 5F7MC 3O3UN 3RZCD 2DM4A 5GS2H 5I18L 1DQDL 2YUXA 2A2QT 1TPXB 4HJ1A 4DP6X 1AKPA 3P11H 5C0AE 3WN5A 1NC2A 3AACA 2JJSC 3WENA 2Q7AA 5D7EA 5J6HA 1SUJA 4OFKA 4BK5A 2BSRB 3PWUA 2IANE 2Y69B 2YLHA 1D2PA 4PI0A 2AJVH 3QUYC 4MHHG 4PU2A 4DZ8A 1BFSA 4O51B 5TH2A 4KNQA 1BZ7B 5IP4A 1NKRA 1T1ZB 3N04A 5AOLA 3VU2A 3LV3B 2QTVA 3NFNB 5SX5H 3VDAA 4DETA 1QYGH 3FSZA 3MRPB 4S0SD 5GZOC 1GOGA 3GMRB 1N64L 3D69A 2WAHA 3ARXA 1TO5A 4RDQF 3IGFA 2BZDA 1SDDB 1YPZF 1AQHA 3OWEA 4HJSA 1IJNA 2CDFB 4H20L 4G82A 3H3PH 1ORQB 3UBHA 4JM4H 3I6KB 1Y0LA 2NT0A 2W9EH 3SDXF 3RHWK 4OZGB 1YYLH 3L5WB 7CGTA 4BE5A 4EI5B 2IGFL 3C2AL 3HI6L 4KZEH 1DVXA 1LEIA 4KOBA 1H9DA 4G7VH 4JEGB 1V7NH 3CH8A 1QKZL 4L3EA 5IMKA 1BVKB 5GZNC 2BIPA 3FN0L 1MM4A 4UT9L 1WVZA 4XHJC 1QRNA 4ISVA 1XR9A 4C56D 3O6LL 2D3VA 5D7LD 2TSBA 5DK3A 5KVMC 1QPXA 1FPTL 4QCIB 4XE0A 3R7RA 3LRHA 4HG4J 3L5XH 4U7SA 2PO6C 3A4AA 5F1SA 4F7PB 3KM2A 2NZ1A 1AXTH 1RIVL 4ZMTA 4IU3A 1BFVL 1BQHG 5ADPL 2WO3B 2O5YH 3BN9C 5HD8C 2YEZA 2QJDA 2ADFH 5DVPA 1X5AA 2D4DA 1YC7A 3E8VA 3IDMB 2L4OA 3SDCC 3CDCA 1QEWB 2V8LA 2BJMH 4KK5C 1OCCB 2IQ9H 2QGDA 2SODB 3DBSA 4GKSA 4GPVA 4KKNA 4PJXF 4ZODA 5AUMA 3VTAA 4CC1A 4RGNC 3DOHA 1RZJH 5CLZA 3GBML 3GP6A 5DR5H 2YRBA 1IBGL 4DJMA 2GJ6D 1NMBL 4OZFA 5EHFA 3MBWA 2IXQB 1CFSA 3QWQB 4JFFA 1JHLH 5DUJA 4ACTA 5A7EA 4OZHA 4AMXA 3RX7A 2V33A 2X40A 4HYTB 1CS6A 1BAWA 4AMKH 4HEMA 1EDYA 1Q38A 3APFA 3LXCA 5IUSA 1CGTA 3ULSB 1MELA 5JW3H 5A2LH 5ADXK 1CT8B 4AIEA 3UTZA 1TZHA 5IFAL 1UT9A 1EFXA 2X2JA 1MPAH 2WIMA 2CE6A 3EG9B 3V4UH 4QY8A 3GB7A 1M1SA 2XMXA 3JV0A 4GAJL 4K71C 5DJDB 1JL8A 5ICZA 1ROCA 2IF7A 2CKBB 3AREB 5B3NA 5FGRA 1V54B 1SDYA 4EN3A 4AYDC 3FU5A 4X5QA 5HGDA 4O3ZA 2ZOTA 1QA9A 1D7BA 4OIIH 3P9MA 1KFAH 3UC0L 5JYMA 3FB5A 3S5YA 1G6VK 3GSVA 3ULVL 1MFCL 3KYKL 3QJHA 2JMMA 1CFVL 1FH5H 3O6FD 3SDDD 4AQAA 4BKLB 3IDGA 4KKQA 4X5RA 2I9LA 3P4MB 4GNKB 1KENH 3IKKA 1J0IA 3EOBB 3F2LA 4G70B 2WLIA 4WHCA 3X1BA 4OV6F 4W9GC 3HVDA 3V95A 2RA1A 1AHMA 1KYAA 5GIRA 3QDGE 1KIUA 2NY3C 3D39B 5KW9L 3VXRE 3JZ7A 5DUBA 5T3ZD 3FO0L 2A3TA 1CQYA 4FQIL 1NCWL 4ZTOL 5JXAL 1UXWB 1HH6A 4FZNA 3LHPH 4GQQA 3QUYB 4J3OH 3T0XA 2WVVA 3EIFA 4HGKC 1KB5B 1D5XB 4D65A 2VR5A 4LLVB 4EI6B 1XGTB 1NFIA 1Q0EA 4WW1A 2R1WA 1PKQE 4PB0H 5FKAA 4MBRA 4MZ2A 4MA1C 3F6LA 15C8L 4HWEH 2DQGH 1X5XA 4HUUA 2AXTO 4G8AC 1W8EA 2ZWKA 1ETJA 5IBLC 3VM5A 2V17L 1Q72L 3BHBA 4O2FB 2FBJL 2F61A 5GRWA 5D7IE 2FGQX 3RY4A 3U79A 2WZ6A 1PGRB 3ZRCC 2Y25A 4F57H 2ZUQC 3B8SA 5JHLH 2ZWNA 4S1QH 3HNTL 4DPAX 2Z8VC 5EZPA 4YDIL 1UVQA 2RCSH 2ZTBA 4OJYA 5BQDA 4I5BA 1FGVH 1TJGL 4Y2DA 1E4HA 2D7OA 2AABH 2IAMA 2PO6B 4G7SB 4OJFH 2AAAA 3A21A 5D6CB 1L7TL 1NMAL 1X7SA 3GIVB 4GW1A 1NCAL 1KT2A 2ICWI 4ZOBA 2FX9L 3MGTB 4OFDA 2Y0HA 2GHWB 2JMRA 4NRZB 3V6OA 5DFVD 1ZT7B 1NEZG 1ZPLA 3SDCB 5D4JA 1CUOA 5D7JC 2ALWA 2GI7A 4EZJA 4G75A 1OLZA 3GWJA 1R5VA 3H7BB 2DZEA 4RGNB 2EEXA 3O3BA 5CCGE 1RZ8A 3DSNA 5HYJB 4GEIA 4JG5A 3P2BA 2B1OA 2ICWJ 5I73C 4P5MB 5FFGA 5DWPA 4YBQD 2D7TL 4XO9A 3QWRA 5GGSB 1MI5E 1N3NB 1VB9A 2V5RA 3S2AA 1HYRC 4NZFA 1E8WA 2B9BA 3EZ8A 3L4TA 4XX5A 2OJ1A 4MD4B 8FABA 2BVTA 1U2YA 4Z77A 4PWKA 4QKTA 4PG9A 4U6YA 3DX4A 2MNWA 2OAAA 3NSDA 1G0DA 4AZUA 4G6FB 4K71B 1ZVYA 2XWEA 5AFUK 2WN3A 3BWZA 1Z5HA 2OMWB 3BT2H 4IHBA 2VDLL 4MDJA 4NENB 4S1SH 2H4EA 2PUQT 4XT1C 4JKPH 1PMYA 3HI1A 3QNYB 4LB8A 4OT1L 3T6ZA 4BZ2L 4HU8A 3NCWA 4WCYH 3HC2A 1VLXA 3EOAA 4EUPG 5BCAA 3FO9B 3SQBB 3GPEA 2CO3A 3TASA 5JHDB 2CM5A 1DFXA 3QQDA 2ZUWA 2I32A 5JPMA 1G7IA 5DRXB 3TX4A 4RISH 3FUDA 2VXUH 2O61A 5D6DA 4DGVH 2VW7A 1XCTB 4HMCA 4LCUB 5DEFB 4QQ1A 4IKJA 4YLBA 3PQYD 1FZMB 4MRBA 4PYHA 2H3NB 3X13B 3S3JA 3KPMA 4XNUH 3G5ZB 3PLYA 5MP6H 2VLJA 3GEWB 4YUEL 5I1CH 2NY3B 4N86A 2KS0A 1P4LB 3HOGA 1MFMA 1MCNA 2BVOA 3DGCR 1VFAB 3EFDH 2VITA 4LSUH 3K5RA 5J06A 3AA6A 4FRXA 4RCAA 4GG6B 1HHKA 3UTPD 4IMLA 1OARL 2AGJL 4M7ZC 1PSKH 3KPSB 3NRPA 3BCDA 4L0ZA 1BZQK 1ED3A 1NCGA 1R3IL 5AZ2H 2P43B 2Z7WA 4PJCF 3AADB 4XMPH 2ED8A 4MA1B 3DTDA 2N7BA 3A67L 1XTMA 3VI3E 5D72H 1E2VA 3U2SB 1G90A 1Y6NR 2BNUB 4QLRA 4MMYB 2WLMA 1U95A 1OQXA 3OZ9L 2AK1H 1AH1A 1ZMYA 3HZMA 4H8WH 2JNZA 4M02A 2M26A 1FFPB 4HC1H 2CZNA 1G87A 4G1EB 2XCMC 4PW4A 4F7EB 1FWXA 4OI9A 2ZUQB 3ZDYF 3TF7C 2CUAA 3QZNA 5C07B 3OWRA 2Y4SA 4WGWB 3HMWL 5HYSA 1NCCL 3EFOB 2XG6A 3MI6A 2E8ZA 1KIQB 5HJDA 4ZMPA 2NY4B 3DPBA 4J3OD 5G5DA 5J3HD 4XBGB 2O5NA 2IBZX 1LE9A 2DI9A 2BSEA 5HHOD 4K8RH 5IQ9A 4N0YL 3G7TA 2H0JA 3CJJA 5ALBL 4XVUD 4A2FA 4HPYH 4E41B 4HWBA 4LSTH 5DSCA 4ANXA 5J5EA 4RVBA 4I3RH 1WT5C 1NKGA 4GINA 4JFEE 2ZXGA 5JOFA 3TBVB 4F91B 3HZKB 1KFGA 1G7HB 2D0FA 3EYVB 5D7JB 3W82A 4F58L 1I7UA 1C5DB 5EO9A 4PGBB 1HC1A 4Z5RA 4D8OA 3IF1B 4YFEA 4GMSL 1FL6B 2Q6WB 5I73B 3SGDI 2G4GA 2LQRA 4GQZA 1TU2A 1JWSB 1XH1A 2C1OA 1CYWA 1UM5L 3FB6B 4HBCL 2OTUB 1CDCA 5IW3A 4GG8B 2F7OA 4FS0A 3N85H 1EANA 1QP1A 3H0TB 4AYNA 4NAMA 4Y4KA 1U6AL 2DBJA 3VFWB 1BH3A 1OAKL 3IDJA 4XMKL 5GISL 2CH8A 3TO2A 3KWWB 4TPRH 1JPSH 4QXGL 2J2ZB 4XNYH 3IJYA 4A6YB 4BSWB 3CZEA 3D3VA 1E6OL 3UTSA 4W9KC 4PWHA 4NCC2 1I7RA 2QV2A 4U1IB 3G5XA 4F5CA 5ALCL 3QPQC 5BQ7A 3U9PL 5HYIA 5EEWA 4P2QE 3CH1B 2ZCHH 5I18H 1DQDH 1VCAA 3CQFA 1N5YL 5AD0A 1S9XB 3VTMA 4YL4A 4GUQA 3LZQA 4LESA 5E70A 1YN7A 2AQPA 1C5BL 1KGUA 1MG3C 1XGPB 2FIRT 2WUCL 3EJJX 3M17A 5DL7A 4NO3B 2AW2A 4WI2A 3T0AA 1CGXA 4I9WE 2XN0A 4Y5XC 3FT3B 1FH2A 3KXFA 1S7SA 3JWOH 5EOQL 1LDPL 4XCEB 2VYRE 4MB4A 2EQDA 2HFTA 1EO7A 1I1CA 4X6DB 4WJG3 3VFNA 2RACA 2XT1B 1AIZA 3NIGF 2R2HB 5H35B 2PP7A 1MCDA 2QKSA 3LVEA 2OP4H 4LK4A 3BH4A 2VZ1A 3HG1B 3PUCA 3Q9PA 1ZHBB 2WO4A 2WVPA 3N5AA 4G6AC 4FFZL 4NO2A 3CD4A 4ZPVB 2HKFH 4O9HL 4LDLB 2X1QA 1AHWA 1GXEA 4MJIE 5E2TH 1F6LL 1E5UI 5JUEH 4M7ZB 4OF8A 2IGFH 4P5RA 1SFDA 2WQSA 1U8OA 2XIBA 1DDHA 1ILSA 1Z3RA 2XTJC 4GSXA 2R8SH 3FN0H 2C9PA 3E0GA 3NTCL 3FN9A 2KKQA 1T1LA 4EOWL 4TLTA 2GHZA 5SWSE 3SGJC 3Q5OA 2VQ1A 1C12B 3C9NA 1DL7H 4W1TA 3PGSA 1FF5A 4WGVB 3S36L 3DUHA 3RWDB 1TEFA 7PCYA 1Z9SB 3D7PA 1A6TB 1U8PB 4WNQB 3UL4A 5I19L 4R26L 3W57A 4H25A 3TBSA 1YNLH 2XQBL 1T1ZA 2YSTA 5HDBB 3LJ3A 3LV3A 4MA8L 1J0KA 3NFNA 5DMIL 4BFJA 4N3UA 3MRPA 1SYSB 3CXHJ 4AYFA 5MEPB 5D5DA 1A4BA 1U3YA 1T66D 2IDUA 5EG6C 3OHXA 4N0UB 4EMZA 4XBPB 5J1AB 4NKOB 2CDFA 3DECA 1FC2D 4HWZB 4EJ1C 1ORQA 2RFXA 3QWOB 4LF3B 5EO1A 3NUKA 3T77B 4A1RA 2AJZB 3SBWC 5F6IC 4OZGA 4HUVB 5BJTA 4WI0B 4J1UB 4XC1L 4EI5A 4E1TA 1K85A 1ZHZA 4PLJC 4J2QA 4QHKI 4BFNA 1IFHH 3LZOA 1O6TA 4L3EE 1BVKA 4K3GA 1AFVL 5GJTL 3AS0A 3QEGH 3RWCB 2W91A 2BX5A 1HHGB 5TTRA 4WDIA 5C0NC 3RWJB 1QRNE 3F05A 1FL3B 3MRJA 1BLNA 4GAJH 4XPHL 2OA9A 3LRSB 4MJ6B 4OCRL 4DGIH 1GSKA 4JHWH 3FAWA 3MRDB 4EZMA 2J43A 3T0EA 4L1DA 5A2AA 3UCRA 1AXIB 3SOBH 3W56A 4K8RD 3QI9C 1RUMH 4JBSA 2JB5H 1P1ZB 3PNWA 5FYLL 3IDMA 1VFBB 1KXHA 3ATAA 3IFLL 3WIHL 3IAGC 1MFCH 2E6PA 3BP6B 1QEWA 3LPGA 4LP4A 2X89D 1ZLVK 4AQ1C 4W70A 1WF5A 5AL8A 2DLFL 5ID0B 1CR9H 1U92B 2O30A 3LNDA 4IL6O 2PR9A 5IK3B 3KPPB 3GKZA 5GRZA 3QUKB 5IHWA 2P45B 5HHXH 1QFPA 4ESKA 5E4EC 4DP2X 3PCYA 2OMZB 2IXQA 1OTSD 4JFFE 3UBXI 1DFBL 2KC0A 2J25A 4OZHE 5D1QC 1OWWA 2E7HA 4MDIB 4E0RA 1SDAB 5EU4B 3I9GL 4OVVA 1S9VA 4HEME 2FWLB 1CGVA 2HJFA 4HPOL 4LCCA 3EGDB 4CL7A 1H8OA 3FO0H 4PJFA 4ZAKC 1V10A 1NBZB 4ZTOH 5EEYA 1CT8A 5LHDA 1M53A 4Y5XB 1R3HA 4RX4A 3EG9A 3VD2A 1QPPA 1J1OL 3II3A 4FZMA 3L4WA 1A9EA 3UAAA 5DJDA 5DMGD 4F3FA 3GSQB 2FECL 3AREA 1KPVB 5ITBL 1E4WL 5D2NE 4FQQA 1XB8A 1MUJA 5FF6B 1F3JB 1EJOH 4JG9A 1A25A 2DWDB 4RJWA 1IBYA 3ZRFC 2A77L 1A3LL 4QAWA 2XUWA 2Z8RA 4X5PA 4ODVL 3ORJA 4OCSL 2OW7A 3EYSH 2XTJB 1NUGA 2B2XH 4CGUB 3P4MA 3S3PA 2W5PA 3WMSA 2VZVA 3CVIL 3EOBA 4X4ME 2V3EA 4YDIH 4NP4L 3HN3A 1JNNL 5GV0A 3G6JF 4OV5B 2X2UA 3ERXA 4MYWB 1ACCA 3L9BA 4X7SL 4YLQT 2YA2A 3D39A 4YK4C 2EVJA 5DJCB 4N85A 4JQVA 4OLXH 3FTWA 3CFIC 4LLWB 3W2DL 2GK0A 4CKQA 1E50A 4TNEA 4NQXB 4Z78B 5KVGH 4IYKA 1KJVA 5EOTA 1W6WA 1C16B 1HFUA 3MJ8B 4H1LB 4W9IC 3NCFB 4LPUA 1UZGA 3QUYA 3MRNB 3K19A 1JFQL 4PGEB 3U82B 2F5BL 1OF0A 3TCTA 1KB5A 5BS0A 4KDTC 1JYXA 3QYMA 1YEKL 3DVGA 2MH4A 2WO2B 5JYLA 1MVYA 4JFYA 4X5XB 1TF4A 2J1YA 3ZYIA 1O7DE 4LCWB 5EU7C 4A67A 4ELKA 1WGVA 1FNAA 2BP5M 3EF4A 5DMKB 4CVXA 3ZDZB 4O4YH 2OQJA 3R7QA 5DUPL