4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant A10_001
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
4O3XB 4Z3TA 4O3YA 4AYMC 3UAQA 3HOEA 4O49A 4AYNA 2Y7SA 4O4UA 5T5FA 2W81C 4QQ1A 3PQSA 4AYID 4O3WA 1YS5A 3HOLA 2YPVA 2LFUA 4O3ZA 5EE2A 2W80C 2KC0A 4U9CA 3VE1A 2KDYA 3KVDD 4AYDC 3V8UA 3PQUA 4O4XA 3VE2A 4AYEC
chains in the Genus database with same CATH superfamily
4JFDD 1PTZA 4EVNA 3WDJA 3GSNA 4IOIA 2J8UE 3H9YA 1BVNT 1QABA 2R4PA 2C4FT 7TAAA 3CVHA 1IJ9A 5AW5B 1PY9A 1TUPA 3UAJD 3WO3B 5FW7A 5CM1A 5BJTB 3WFEH 1I9IL 4Z7WA 3CVHB 3C6LA 1QATA 5DUBA 5F3BB 4GLRH 5IFJA 4TVPL 1BPVA 2B9BA 5KTEH 4DKTA 2APSA 1SXCA 2WBJC 3I6GA 5E4OA 5I16A 4RSVA 2IQ9H 2LFEA 3ARDC 3NEXA 2WWNA 3VGAC 3VTAA 3WBDA 2YOAA 4UT9L 3X3GL 4Z7AA 4IKIA 3OKEB 3ARGD 3E1ZA 3HG1D 4B9GA 5E08H 2WWKT 4J3UA 4Z95H 2PYFB 1T22B 4N0CC 1G9NL 2DICA 2C4FU 5DUPH 3LH8A 4JKWA 3ZHLA 1OGTA 5AKTA 4L3CB 4W6YB 3JZYA 3KJ4B 3V4UL 1E7UA 4KRNA 3LEXA 3IJEB 3KCWA 1DJSA 3MTXA 4LLUB 4ZMAT 5MEOB 3QJRB 5L4JA 4GQ9L 2VTFA 4TRPH 5B1JA 3GI9H 5HJGA 4C83B 4DERA 1VADB 1P4IH 4OCXH 1UC6A 4OVVA 3M7OA 4HWBL 3QO0B 5KAFO 2UX6A 4LLAA 5TGBA 1YUKB 5DWUH 3OWEA 3LEYH 5D1QC 5ANME 2P4AB 4YHLH 3B56A 4MX7B 1BYNA 3E6FA 1XF1A 4HJJH 4NYLA 1F41A 1T6WA 4F7EA 1NBVL 1A1MA 3E6FB 4N0CD 1KG0B 5GPRA 3T8VA 4EZMA 1ZT4B 5LGKA 1TYEB 3KPLB 1HXUA 4OIBA 1JPGB 5EZLA 1VCAA 2UVEA 1OCOB 1YCSA 1ZV5A 3L95B 4L1SA 3X11B 4FFYH 4LCIL 2MPAH 5AG8A 2QPSA 4FZEL 1OP4A 4XCCH 4HKXB 2CJUH 3G7GA 5CCGE 1IB5A 3HNSL 4OV6F 3ECBB 3VI3B 1QFPA 1OE1A 2VLME 3GNML 5DHVH 3VD9A 1T7YA 2XXFA 3O6FD 1GGBL 2GC7C 3SGJA 4NM8H 1VGEH 4ACPA 3Q6FB 2BERA 5F1OB 4ZODA 5DRXB 4NPYA 3AZUA 5D1QD 3ETBJ 2W9EL 5E79O 3N9GL 3FRUA 3JWDH 3NRQA 2A4EA 3T1FB 5C2BH 3EH3B 1FGVL 3NMEA 3JWNE 2WNXA 4X4KA 1KIRA 4G2AA 3CN4A 4OIAA 4QO1A 3T71A 5DVPA 3CXDL 4R7VA 3KPPB 4QF1B 2MHAA 3H4FA 2D2OA 1AGDA 1W0YT 4NUMA 3UIYA 2JJUA 5EU5B 2IG2H 3D85D 1MVYA 4X5PA 3QJTB 2OL3A 2BIQA 3WFBH 2BOBB 4AVHA 3MMEA 5KBPA 4J28A 1S5IH 4XPAH 3PJLA 5D6DA 5E2UL 4YFDB 5FO8B 5AB1A 1JWSA 5E6UB 1H3VA 2W60B 4G8EB 5FUZL 1F6LL 5JPNB 5DFAA 4ZMNA 2CO3A 1CDIA 5MEQA 1JAEA 4K5OA 1ZGLM 4WI2A 1IAOB 2XYCA 2QQLL 4FG6C 5IEHB 3KPSB 5AKRA 3F7YB 5L8LB 3WHXB 2W9DH 3IKKA 3REVB 1G6VK 1D5MA 4ONGL 5D7EA 4PJXE 5DEGA 4F8NA 4NPJA 4CU6A 5JIMA 5H2FO 2KZKA 1B0GA 1HNGA 3T6QC 3SE9H 4OV5B 2C3HA 2EDOA 1P4TA 4F80A 1FNHA 4DTGH 4DKFL 4LCWB 2WUBH 2VB5A 2PP8A 1HYSC 1EEUA 4Y1AB 3WKYA 1NUFA 3R06A 4Y9FA 3K6DA 1RJZB 1T3FB 3FCTA 3K72B 4LSDA 4J3WA 5DHVB 2ETWA 1JTTA 1JXKA 5JOFA 3U9UB 1U8NA 1T1WA 3DOSB 3UZQB 4GUQA 3MOAL 4CW1B 4ORGB 1RURL 4FADA 2BVTA 4FG6D 2I9LA 1KV7A 3F00A 4HMCA 1FV1A 4LF3B 5CEYB 5T1LA 1JHTB 8PAZA 3OF6D 2JCCE 3JTSA 5FR3A 4JFYA 1YMMB 4TUJA 3VXRB 2K3TA 2FR4A 5AW0B 3WGUB 1EZSA 5C0AE 1JZEA 3RKPA 5GGRB 2GJPA 1M1XA 3CFNA 3VD0A 4LLDA 1E4KC 4AZ8B 1OGSA 3G08B 1DBKL 1Z3GL 2V8LA 2ZYIA 4XXWC 1HYSD 5I74B 4LL1A 1D3CA 3IXTB 1IL1B 3WO4B 3ZQWA 1I9IH 2JKSA 2JJTC 2E74C 4KK6C 4Z0XA 1I8KB 3VTTA 1SQ2N 3NPZB 2GSGA 3WJJC 2AANA 4TVPH 4YBLC 3HI6L 5DZAA 3AAAA 1E3XA 1GSMA 2MTPA 3G5YA 1JYVA 4NKDA 4NZ8A 5C08A 4ZS6C 3PWVB 3MFFB 4DZ8B 4HUUB 2V5MA 3G5YB 1L6XA 4UT9H 3X3GH 4E9LA 3KXFB 4Z3EA 5IEKB 1LO0L 5E99H 1MEXL 1LP9E 3BKCL 2GSIA 1J8KA 3DBXA 4AJVA 3U9PL 4XVTL 1YNTF 2XWXA 4WV1C 5D71L 2GK2A 2GSIB 4GG6E 3NCYP 5HDQH 3V4UH 2CJSA 3QI9C 5AOKA 2Q8BL 3MUJA 5EMYA 3PJNA 1NAKL 2EE3A 1YEKH 3MJ7A 1KB5B 1MCJA 2VZOA 4GQ9H 3FCUB 1S9XA 5FYLL 1MAML 3FQ4A 1LO5A 1JZDC 3KAAA 3BD3A 4HUXA 3LXAA 4ZI8A 1PKQB 4KUZL 3CAFA 4MB1A 5SWSE 1LDPH 1TDQA 2R7EA 3QH3B 4GKSB 1MWAA 4JFWA 4UZSA 3UYPA 4UQ2B 4KX7A 4F2EA 3MRCB 1MCKA 1I8MB 1UG9A 3MA7A 4HWBH 1ORSB 3IWUA 3T2LA 1DE4B 3E1F1 5J12C 1MWAB 3UYPB 4ZS6D 3VXQB 3N44F 3G7TA 2P5WE 2XWJA 3BPOB 4RFNB 3QZMA 2WZAA 5CZXC 4F9PA 2GT9B 2P24B 5I1IL 4YX2L 1I1YB 3E6HB 4NO0B 1IO4C 3L1EA 3MV9B 3UTOA 1NBVH 2IQAA 4BH8B 3U4AA 2ZUYA 1MFNA 1SEQL 3OX8A 4RRPA 4S2SA 2GUOA 2P44B 3D51A 3L6FB 1UA7A 3CDYA 3QI9D 4LHQB 3V0WL 1T6VN 2NY6D 3CK0L 5FV1L 5CEZL 4FZEH 2J43A 2PKDA 2WVUA 4CAGA 5JQHC 1QJ9A 4HIJA 3MBEC 1HHJB 3FAXA 4HPHA 2XJKA 3HNSH 3MJGX 3GNMH 5C0JA 1PAZA 1WTLA 3DA0A 4J7RA 1DLFL 5C0DA 1GGBH 1RZQA 3V0HA 1GZPA 2FT8A 1IKNA 3LNIA 1NC2D 2D0GA 4EKJA 2DKSA 3AY4C 1CN4A 3FU8A 3ZE1F 4G8GB 2W9EH 3DVFA 5JXAL 3WJLC 5CZXD 3NCWA 2NX5D 2ZXQA 3FT1A 5D2NE 5T3XE 3L9EA 1UEMA 4JFPA 3VQMA 1XH3B 2JKJA 2Y9RT 3BZEB 1ZK5A 4OLWH 2DMBA 3N1GC 2B77A 2BSSB 3B2MA 1X4ZA 2XWBB 1MOEA 2X89D 4FI7A 4P3CL 3SE6A 3QR1A 4QR7A 2GKIA 4HV8A 3WEAA 4OCLC 3AA6B 3MR9A 3QIBD 1T5KA 4AEFA 5J6GB 3MBED 3OMAB 1KYFA 2I27N 5FUZH 2XMXA 1YNTB 2VJ8A 1NFDA 5D6CA 5IIEB 1RMFL 4JHAH 1HHHA 4R4NC 2XXMB 4AGMA 2GTWB 1Y6NR 4BBWA 1NEZA 1HWGB 2YWYA 4OF5A 1HKLH 2EIBA 4ONGH 3BUYB 4CMHC 3OAUL 4Y5VA 5GXBB 4L4TD 3DVGA 2VLKD 2MJWA 4XO5A 3TNNB 1G7HA 3LK42 4R9HA 1P2CB 1OP9A 4ZYKA 5IZ7A 2HN7A 1BMGA 3MRRA 2H45A 4DSYA 3ARFD 4WRLA 4U6XA 1D2PA 4KO9A 3D2UB 2WVTA 5L4FA 5DJCB 3IU4L 3DV6A 4Z7NF 5IMLB 1D9KA 1TJGL 4A2EA 4PMEA 2BXZA 1CDBA 3G9VA 3L3HB 5EV7A 4JRYA 1FE8L 4YNYA 3EJJX 3EOBB 3MCKB 2IPUK 4AFKA 4DGVL 4F7MB 5L88H 3QFJE 3MO1B 3DSNA 1T4KA 3MOAH 1I9RH 3TBSA 1J8HA 4JHBA 1MFMA 1O6VA 1RURH 3IDNB 3VG0H 1JFHA 2VDPL 4DOHE 5KSVB 2Z8RA 4K7PL 4JKLA 1CIUA 4NKMB 1AGCB 1OEZW 4AMKL 2XN0A 2EVGA 4MJ6A 2WLZA 3QGVA 3SCMB 3I2CH 4D9QE 1MCDA 5EO0B 4M48H 1E27B 1GGIL 1XGYL 3V5KA 4K5PA 5GSVA 5D1ZA 4L1HA 4EXPX 1SJHB 4ZFQA 2GQHA 2P7TA 3ECUA 2D7OA 3SYAA 3IGUA 2KHAA 2F1CX 5DLML 1OGAE 5MHSE 4N87A 1MDAA 3ZE1B 1Z3GH 1PKOA 1Z5HA 4LARH 2YSTA 3GLAA 2VOTA 4B9IA 1A6UL 1QBML 5J1AB 1KENL 4KRPB 5FUCC 1PZCA 1JNLL 4NNYA 2HTLD 3ULVF 2YLHA 4TS6A 3HI6H 3EFFB 3NIDF 4WWOA 2K6WA 4Q2ZA 1V3KA 3JZ7A 1RUQH 1U3JA 2A38A 2H7WA 1PRNA 4WHYG 3D0LA 3QORB 4MS8C 2VL5B 3BEWA 4KX9A 4ENZA 5KYYB 3WXVH 4L8DB 1WDAA 2EECA 1A6TA 4MDJA 2NT1A 3U4EA 1MEXH 2FRGP 4F33B 3CFEA 4EAEA 1HHIB 3ZZ1A 2BHZA 1AXIB 3IDGA 3U9PH 3MLZL 1E8ZA 4XVTH 2LGNA 1G7JB 5D71H 1PHOA 3ULVH 1KFAL 1AZRA 4HUWA 1FA4A 2C9AA 3RPBA 1AFVH 1Q90A 3SO3B 3EW3B 4UINL 5E0FA 1AI1L 2EDFA 5D4QA 4U1GC 1BVOA 3ZZQA 3TZVC 2Z65C 3CC1A 3FT3B 4PS4L 4HXAL 5FYLH 2P48B 1BQHA 3J07A 2FGQX 1PZBA 3GMNB 4E9QA 2UWEF 1NDMB 2IXQB 3CFKA 4FKEA 2WYTA 3BQUD 4JY4A 5B3JF 3TOPA 1M53A 4YDJB 2AQ3A 3D87B 5MEND 3C8DA 3EIFA 4KROD 2QV2A 1UHVA 4XMXA 2QL1A 4C56D 4Z7NB 5KVEE 2RA1A 4MS8D 3CMGA 4H8HA 1BD2B 2BY0A 2I25N 1UKTA 5I1IH 3ISRA 1CPUA 1JGEB 5DHMC 4XP6L 4TXVB 4JRXA 3W37A 4NQDA 3QJVB 2VMFA 4PRIE 5CLTA 2XWTB 2ZWZA 3A4EA 4FFZL 4WO4A 4C58B 1VENA 1MCHA 2LTQB 5GGQL 3V0WH 2CIIA 4X98A 4JRLA 2O6CA 1GOGA 4PJFA 4HGKC 2ATPA 3U1SL 3CD4A 43CAB 3QUML 2JIXA 4EDXB 3QNZA 3DO4A 1I1AB 4DJMA 1QAWA 3GXFA 4ZPVB 3TO4B 1EHXA 4AI7A 1FN4A 4FOMA 1A3RL 2N7AA 3DXAB 2ESVA 2CXGA 5JXAH 2MCG1 4N2KA 1N5YL 1CFVH 4O2EB 4EPSA 4R0LC 2P80D 1MCNA 2YC1B 5E2TL 1EXUB 2M1KA 4HGWB 4AZLA 1M4KA 4IIQB 4MJ5B 4E9SA 3X1EA 5DO8A 1RZJC 4QKTA 4XXDB 1B4RA 1RFDL 4PS3A 4XNQB 4P3CH 3UTPE 4UM8A 1A65A 4IMKA 3QUXA 1GVIA 2G9HB 3NZ8A 3V7AE 4AW7A 4FA8A 4G7VL 3V0GA 3KLHD 2XSKA 2ZYSA 1KGYE 2HFGL 4DZBA 2IPTH 3Q9PA 1U58B 1UM6L 3PWPD 1CF8L 4TN9A 1MI5D 4XZUA 4YHKL 2OI9B 5EU6B 4Z7WE 3QRFM 1CL7I 2Z91B 1OAZL 1JPSL 4GBXB 3DYMA 5F7MC 4D0CA 4K15A 5KUMA 3AREC 3OAUH 2UWEB 2WCPA 5E00A 3DPBA 5F9DC 3ARQA 2B3IA 1JN6B 1ORQB 1U8MB 5EO1A 1BXWA 1DL7L 1L0YA 3VFWA 5FKAB 4FQJH 3H3KA 2IDTA 2VZSA 1DN2A 3IU4H 4UDUB 3FO9A 4APXA 1BQKA 3N04A 5ITFB 2R1YB 5D1XC 3FSVA 3G6AB 4DGVH 1VERA 5LNDA 1QFHA 3I84A 3V4PH 3DTDA 3L7FA 5HYFA 3WENA 4HG4J 2PR4H 4DP4X 3V55A 1JP5A 3BJLA 4X7DC 5C92A 3OLGA 4LEBA 3WJMA 1KCUH 2FJFA 1BFOA 3P73B 4K7PH 4OAWA 2K6YA 4U2YA 4W68A 3G5ZA 4XWOC 3ROLB 3ZDXB 5ACZA 3D06A 2DBLL 4W6XB 4HX1B 3S37X 3TF7C 4PJEF 3OJVC 1KC5L 2FJFB 1BWMA 1GGIH 2NLJB 3L4ZA 4FCHA 3V52L 3ARED 4BSVB 2ZE0A 3H85A 2EKSA 1M3JA 4I7ZC 1MHEB 2ADIB 5CU9A 4I3RL 3BE1H 3LXUX 4R83A 4MWFB 4TUKL 5A2IH 3VSQA 2XIBA 4PGCB 2IAMC 4CADB 3CDZB 2ZOOA 3MRQB 1A9VA 2ZOKA 1DVTA 5F7BA 1BJ1H 5CD3A 2VLJB 5CN1A 4LSSH 4C59B 2JJSC 1QBMH 4OI9A 1KENH 2YAEA 3KGTA 4PJAA 1AQKL 3SY9A 3LK2B 2ICEA 3F5WA 3F7LA 3NJJA 3QXAA 4P99A 5FIEA 4AK2A 5C8JA 1S5HB 5C0EB 4JFVA 1M7IA 5F96H 1PLCA 3T2NH 3HUJA 5C8JB 3KYKL 5GGVL 1E2ZA 5B38A 3U0WL 3CFBA 1HE8A 1YEHL 1SJVA 2FBOJ 5CGYC 4N9GA 5HXMA 3ISWA 3M88A 5H4YA 3S3JA 2N1TE 2Y0LA 3VMNA 5ISZA 5KSAA 5BRZA 2HLAB 1KEML 2R0WL 3KPNB 3P2BA 4OU3A 2VO8A 1XTMA 3VI4F 2FYYA 4E1SA 2IAMD 4L4VA 1AI1H 1TQVA 4H8WL 4OZHA 3RIAF 4F7TB 2FYYB 2NY1D 4LVHB 5DA0B 3TESA 1QSEB 4XCYA 5DJAB 1S9KC 5DK2B 3BP6B 1H3UA 3CN3A 5DJZA 3VXMD 4BQ9A 5IHWA 4L9LC 2C1OB 4Y9GA 1IFHL 3C60C 4JFDE 2WVPA 1FG2B 4HJUA 3NJFA 1KXVC 3BZFB 3L3IB 1UH3A 2HRGA 4Z7UF 2YD1A 1OD7A 5CGYD 3P30H 3D8MA 3BDYH 4YSCA 5I66B 2QHLA 2DWXA 4XP6H 3V6BR 3P0YL 2YHGA 1FFTB 4LSRL 3OR7A 2A5UA 4FFZH 2FX7L 3KWWB 1CGYA 3HMXL 3MLSL 2ITCB 5DJ8B 3ROOB 1NFKA 5GGQH 3U36A 4XNXL 1AGFA 3QPKA 5EWIH 3DOHA 3NJLA 1CLOH 1Q9LA 1DBJL 3QUMH 2OR9L 3QZOA 4JDEA 3GS4A 4OLUH 3HG1E 1NIAA 1RLBA 3A4DA 1RVFL 1FHGA 3MU3A 4JN1L 2DD8H 1CLZL 3MX0B 2I9TA 4FX5A 5GS0L 1XIWC 2P5EA 4N5EC 2XZAL 1IGYA 5EFIA 1TT6A 4K94H 3K8LA 1E40A 1RP8A 3HKFA 3LNGA 3X1BA 3D0VA 3RY6A 5CNHA 2DLIA 2OKMA 4OZFA 3VWJA 5C6WH 1KTDA 1BAFH 3QWRD 4HOZA 4WW2A 1TZ8A 4DN3L 1G9MC 4ISVA 2Y7OA 1BZ7B 1U8KA 2H2PC 3AS3A 4JFFA 3B3IB 1W72A 3SKOA 3QYNA 2QDVA 3H2QA 3BW9A 3KCPB 3KHQA 1JZ3A 4N68A 1NM9A 4LU5L 5AZUA 4UNIA 4ESKA 1VLXA 3UJJL 1DJHA 3UYRH 2ZUQB 3BW9B 3PAYA 4FJ6A 4G7VH 3KYOB 5MP6L 1HNYA 2IH9A 4GSDL 5H37H 3QULB 1LE9A 3V6ZB 4FMSA 5DQJB 1AACA 5B66O 1RK1A 4H44C 1BT9A 5DYOA 3UGXA 1UM6H 1XIWD 1LO3H 4N5ED 2XN9B 4AKRA 4YHKH 2Q3AA 5DRNA 1I9JH 5IB3B 1URIA 1SDDB 2X9YA 1OAZH 2OMWA 1HL4A 5KYXB 3OZLA 2Y0KA 4HUCA 3RB7A 1J1XH 4P48A 2GIMA 2A9NL 2NNRA 3HC0A 2YKLL 3MRLB 5ALCH 5EPMA 3VXNA 3SBQA 5I0WA 4ZAKA 2ZAGA 3PF1A 1U3HA 2QFRA 2H2PD 3T0BA 5F8QC 1OB0A 4IS6A 3FRPG 4OLXH 4M8UA 3S7GA 4F2FA 4NZUL 4XWGL 2BDNL 2ZXBA 3QUMB 2AJ3A 5FO7A 4Z7QE 5D7HA 4ONFL 5D1QE 5KVDE 5PRNA 3VXOB 1F4HA 5BPPA 1E6OH 2WK2A 5B1KA 5FXCH 5D93C 3QUYC 2Q86B 1XSIA 3CDCA 4HS6B 5DJXB 3K91A 3MDJA 1G6RL 3STZB 2XFXB 5H35B 1MW3A 2W94A 2CDGB 4R8WH 1G7MA 3ESVF 5EBLA 2XT1B 3BOVA 3L9RA 2DM3A 4E41D 3CHQA 1J5OH 3NFNA 3B9KC 2B08A 2X27X 4K8RL 4FHJA 2DBLH 2NZ9D 3L9RB 4DN3H 1IC7L 2B5IC 3TVMA 1KC5H 1B0RB 5IJVB 3QRBA 3V52H 2BW5A 4QHNA 2EE0A 4D9RD 5CCJA 5LN8A 1JZ7A 1HXTA 1BF2A 4PS7A 4TUKH 3II3A 1AXSB 3QNYB 4M5YL 4LLYA 1LWHA 4Q6YA 1XSKA 1ZHWA 3QCUL 4QRSB 4BHUI 2F58H 2MOQA 5KS9B 2W65B 2AXFB 3EGSB 3H2WA 3IU3B 4MASA 2Y3AA 2J4WH 2DPKA 1DVQA 5I19H 2JNZA 1J12A 1DBMH 3QUYD 4N58A 1AQKH 1CE1H 2H9GB 3NCXA 1F4YL 4M7LL 5E2WL 4AYGA 5DD3L 1J05B 3HFML 3CDGA 5FLUA 2Q8AH 1QNIA 2C9QA 2PYEB 3KYKH 1U8OA 4NFCA 1SJXA 1XTLA 5DEJA 3SPCA 2IBBA 4QXUL 4JO1L 3KVQA 5J9PA 1DN0B 3SDCA 3SY0B 3SZKC 1JTPA 1E65A 1P4LA 1AD0A 2NW2B 1MRFL 3RTQC 4JY6A 4AEEA 4XP4H 3N55A 4JDZA 4RDQG 3WIAA 4KDTA 1UUNA 4Q74A 4K5NA 5D4JA 1PZ5B 5ESQA 5KJ7E 1YEGL 3X1GA 1OCZB 2K1MA 3ME0A 4JDZB 3UTZA 3BJ91 3FOMA 1LD9B 3PP4L 2E46A 3EZJB 4UMGA 1U8HB 5I1KH 4FXKC 3MUZ1 4H8WH 3RAJL 4BFJA 2O6FA 3CSGA 2YPLD 2GIXA 2XQYG 2AEOA 3DUSB 2PORA 3MRDA 2WINA 4IRSB 1T1XB 1Z0MA 4K3DL 1N67A 3PXHA 4AXWB 1THAA 1E9PB 1CFQA 2I69A 2MWCA 2X4RA 4HEPA 1S7WA 4YBHA 5JW4Q 2NTFB 5E23A 3HOEA 1FL5B 2F74B 2YRZA 2DL9A 1U8QB 2BSTA 1F13A 2BOLA 1DQLL 4ODVL 3T0EC 4F3FB 5IJCC 4MNQA 2KMWA 3QDMD 5AAWC 2BNRE 2D3JA 1W8NA 2MEJB 1ZXKA 1IZKA 1OTTC 4KNQA 3H9SE 3S3SA 1VPOL 1OQXA 3P0YH 3D30A 4ODWA 4P5TC 5E8OB 5F8RC 3RGVB 3T4AB 3RTQD 4M5SA 3GBDA 1EQWA 4LSRH 4Y2OB 2FX7H 4EOWL 5KBMA 3MLSH 2X4TB 3LPOA 4WGKA 4JDTL 5EA0L 1I3VA 3O81A 4XNXH 2ADJB 1NFIA 4F8OA 2CRZA 3B2DC 2FTAA 2ITDA 3FT9A 1DBJH 5T5NF 1R3LB 1AD9A 2XA3A 4NN6B 3NBNA 1NFIB 3UC0H 3I9IA 4N6RA 3ASOB 4PG9B 1UB5B 3KDMB 5FHBL 4JN1H 3UAEA 3VMPA 4F15B 1CLZH 1T03L 5KVFE 2H1XA 4Z5RA 2FYVA 1BAWA 3EGDB 2XZAH 2X70A 3ASWA 4FD0A 1NEPA 4G6KL 5D5MF 2CK2A 4LP8A 4O51A 4JZNB 4E1TA 3T0ED 3BPCB 1KPRA 1D2OA 3NQKA 2ZPKH 2WWOA 2EDWA 4W4OA 1UD6A 3FTSA 2EEFA 4HJ0C 5ESAA 5C09D 1JPEA 2CUHA 5A16A 2N3JA 4P5TD 3D9AH 4I85A 4N0RA 2GUYA 3T0VA 3TA3C 4GQPH 4U1KB 2QGBA 4M4RB 2F8VA 2FWLB 4XBPA 4CN4A 4DNLA 4X0NA 4ICXA 5SWZD 2QGDA 4YEEA 5F7DB 1I8UA 1TU2B 5LBSL 4LESA 4LNRB 1BFVH 4N3UA 1ZWIA 3ESNA 4HWNA 3MV11 1DDHA 4X42A 4XVOA 1H0DB 2K78A 3CSTA 3AW5A 3Q06A 1CL7L 3OQ3B 5HYJD 4G43B 3VFNB 2BIIA 3TBTB 1IEBB 2A74A 1DANT 3APMA 3CH8A 3HMXA 4JQVC 3SKJL 1WICA 3OKNA 5BUAA 1FUNA 1E90A 3LZQA 1N8ZA 1S7QA 2YKLH 5IW6A 1A9BA 1I7ZA 5AB9A 2C7FA 3BKJL 2D7QA 1GGUA 4KXZI 4JFXB 3PPEA 3TA3D 4UQEA 3DMMB 4MAUL 2BDNH 1ZT1A 2SEBA 3C87A 5AB0A 4JE4B 2XNAB 3PL6A 2AJUL 3FFCD 3S35L 4CMMB 3ZR5A 1JNHB 1U8JA 1E4JA 4FKKA 3PL6B 3Q9QA 1DANU 4H0LC 3VFOA 1NFAA 2YUZA 1FVCB 1KB3A 1F45A 2R2EB 3VFOB 1XZWA 1ZE3C 1R3KB 3UADA 3OR6B 1ZT7B 3FONB 4K8RH 5EOTA 2H1LM 4P5KA 2F53D 4WEBL 2OYLA 5ITBH 5LXGL 1EAQA 4JEGB 1IC7H 2IF7A 4P3DA 3TIEB 3WTTA 1CTMA 4O2CA 4F9LC 4A6YL 1FI8C 4IHOA 5E0QA 5F21B 4L29A 2XWDA 4JN2B 4GQQA 3PF2A 1KB9J 1WZLA 1A6ZB 4A04A 4ELDA 5D5MB 1NZRA 1RIVH 4DF9A 1I7UA 4ZW5A 3BYTA 3QCUH 3QIWB 4NQDE 5EDXA 3GEFA 4KJYA 1WRFA 1YS5A 4OUUB 1OM9A 2ZAHA 4L4TE 3TIDA 3ZQ9A 2VXQH 3FQTB 3W2DL 4A2LA 4MB5A 2VUOA 1F4YH 4M7LH 5CIPH 1TOXA 5DD3H 3NZUA 1EAPB 1JGLH 3HFMH 1KT2B 5IVZB 1E42A 2WBWB 4I2XB 4JJ5B 5D72H 3S48A 1KYOK 1CQKA 5GGUB 4D2NA 2DQGH 2VMEA 3BFOA 1NWOA 3AB0B 3OG4B 4DKDC 4HZLA 1VKXA 5CAYB 5L2KA 5FLVA 2F5AL 3RWGA 5CSZB 4Y8DC 4QAWA 1P1VA 2DJMA 1MRFH 1OTSC 1MNUL 1TCRB 1XXFC 2ESVE 2XTLA 3PGDB 5LG6A 4FQQB 5DMJB 2BIPA 1Y6MR 3BZ4A 4PVMA 1TEGA 5JORA 3C6LC 1P53A 3KBFA 3ZL2A 1T1LA 1QX1A 1G6RA 2ZJSH 3PP4H 5IBLC 4FQPA 5BVJB 3T2PA 2Y1ZA 4J12A 3UTTB 4C55A 1XH0A 3GSXA 3COOA 1KGUA 3K5RA 4XP5L 2EYSA 4ZK8A 1MCFA 2X2UA 5GQBA 1KBGL 3QEQA 5CLXA 3ZHNA 2ATKA 1YEJL 3P02A 2DB8A 2OR7A 3S0PA 3KJ4C 4R90L 3HB3D 4QHLA 3RWDA 4CJ0A 2X4NA 3G04B 3QAQA 4U1NB 3QZWA 3BVDB 5GRVK 5C0FA 1DQLH 2AEQL 2VW7A 4L37A 3A6BL 4Y5XB 4PWGA 4X0KA 4KZDL 2BP8A 1U42A 2EUXA 4PEEA 5IKCB 4PUXA 1IAKA 5IWLA 1NGZB 3IFLL 2AHIA 3CZSA 4DK6A 4XB8A 3WE6B 2X4PA 1A7PH 1OTSD 2UYLB 4ZSOB 3SGDI 3V0EA 4RAVA 5B1JC 2KL6A 3IAQA 5HYQA 1CDHA 5EA0H 1S7SA 4XVUC 4I1NB 4RAVB 4QXVA 4X6CF 4XRCB 5I18L 5IBLD 5CHNA 1HOCB 2PWGA 2DIAA 5I5JA 3IDIB 5CIPB 4H88H 4LQ1A 1ZTXL 3ULUL 4Y7OC 1T03H 3DWTA 3OB0K 5EG6C 5CEXA 1VFBA 3HOLA 3RX7A 4KKPA 1J1OL 3VGBA 2XVBA 1USQA 1TSRA 1KLUA 1SM3L 2XA8H 2DYPB 5CILL 2YFOA 5GS2D 2Q6WB 3SKUD 4P2OB 5HHOB 3VX1A 5CBAA 1JERA 3FN3A 3HS8A 4X8CA 3EJRA 4NQUA 5GRVL 1ZLVK 5FUCE 1JOIA 3RILA 4UIKH 2E56A 5L6YL 5IJKA 3VSVA 4GT0A 5MENE 2L3BA 4HLZG 4L18A 4C56E 5G39A 4FJZA 1XGRB 5FA4B 3DX6A 1T20A 5LBSH 4FMFA 4ABUA 3WN5B 1N5AA 4FQXA 35C8H 1UT9A 4GUCA 2ZWSA 1I3GL 4GKNB 4XBGA 4Y16B 3X2QB 2FO4A 4AM0Q 1QI5A 2X6AA 2YMXH 1CL7H 1NMAH 2FD6H 3QEHB 1JZ5A 3ULSA 1RXLA 2XKSA 3IN0A 4J3SA 4RETB 2F15A 3C6EA 4PJAE 1OSYA 3OKMA 3CFTA 4PJBB 2PW1A 2OFQA 2X4SB 5EN2A 2XZQL 2Z3FA 2QKIB 2ZIDA 1J1PH 2Y7QB 4FNQA 1HEJC 5JPNC 4OJDH 4R26L 5D6DC 2AQTA 3BLPX 3RWEB 8FABA 3BKJH 3ENEA 5EOCH 1SY6H 2R56L 4ZMZA 4BUGA 5IVXF 3IKCB 3TLRA 5FEBA 1K9TA 3ATBA 1WC7A 4MAUH 1KXTB 5L0QC 3ISYA 3SPGA 3V6OC 3ZE2B 4WHCA 2JJWA 2Z7ZA 2AJUH 2K7QA 4N2FA 1S9VA 5AW9B 2MIZA 4KJPC 5SV3A 5TE4H 4XZ4A 5LWYH 3K2UH 4WK4B 5BZWA 2R27A 4OZHE 1Q4NX 3PDOA 4PRPA 1TVDA 1SOSA 3GKWL 2V3EA 4AJWA 3A0OA 2CH8A 2PNDA 4WEBH 4IDJH 3W0WA 2XE5A 3GLEA 5JMOC 5F93C 1KIPA 5D2LF 4QYOB 5K93A 3Q8AA 3RY5A 12E8H 4ATTA 3WKNA 4AQ1A 3PWPE 3QDGA 1S3KH 3P9LA 5DO2C 2XXCB 3FXIC 3D4YA 1T1ZA 4WUUB 4Y4KA 2BC4B 4RQQB 3L3DA 5CF3A 1JZ8A 4Z8FH 1V7ML 1WCBB 3MKKA 1ZIBA 4GAYA 1GIGH 4OI8A 3GF8A 1MFBH 3EUDA 1SYVA 1ZHBA 3TEXA 4LPWA 3UXFA 2DKUA 5CN2A 2ZX8A 5E4IA 4ZT1A 4PGZA 1ETJA 4OJCA 5K59E 1IRAY 1MJJA 1JK9B 4NLHA 1IU1A 1G84A 1ETA1 4EXKA 5LBVA 3BXNA 1TTAA 3GZOA 4LCWD 4JZOB 2J8UF 5IV2A 4PGBB 4Y1AD 1A7BA 5AVQB 2CUIA 2Q2LA 1SOKA 1XD1A 1BQ5A 1I4FA 3WO4C 2Z35B 1L5GA 2VDOH 2GITB 2J5LB 3FQWA 1U92A 1MNUH 2AF2A 2EDJA 2OTUA 3CFQA 3VXUB 3QJSB 5G38A 4L1LA 5DO2D 4GSXA 3O3UN 2VQ1A 4E36A 4OI7A 2AEPL 4X7SL 1BHGA 1Q72H 2VQTA 1YMMD 3F12A 1NDGA 3VXRD 5T1LD 1YEIL 3MZTA 1UOLA 4J39A 1KBGH 4P4KA 4PJ7A 3U0PB 2OCFD 2YQBA 1GYWA 4U1HA 4M6AA 4PJDF 3UGUA 5IVXB 2BRRL 2O61A 4R90H 4Z3GA 4A6YA 1DUZB 5CLYA 2B2XL 5E03A 3PCYA 7PAZA 4BZ1L 4GAGL 4U1LA 4X8XA 2AEQH 1WIOA 4M3HA 4U3HA 3A6BH 5IROA 4UTBA 3LN5A 4KZDH 4PB9L 1VSCA 4DP9X 3PJSA 2HKHH 2ZWNA 3F84A 4PI0A 1UCBL 4ERSL 3IFLH 1CXEA 1LMIA 2HFFB 2XJLA 1CYWA 3JV4B 4G9FA 3IDXL 4PRHE 2ICWI 5AUMA 5ENWB 43C9B 4A2HA 5J89A 5IQMA 2CBQA 3IJ8A 4QRUA 4NP4L 3LK3A 3BPOC 5J13B 4RFNC 5LG1A 4BCXA 1AHWB 3CC5B 3KXFD 5D2LB 3T8MA 3QHFH 2JQAA 1BG9A 2CK0L 4UQCA 3V4LA 1XF2A 2HT3C 2J73A 4LPXA 2WUCH 2OCJA 3AAZB 1DLHA 1ZTXH 3NVQA 3ULUH 3RPKA 5F9WC 2HJLB 2ZKWA 4MNGB 3RURA 4ALAL 4O2FA 5E5UB 5C1MB 1XF2B 5F1KC 1J1OH 4J3OF 2DY2A 1T0MA 5FCUH 3BSZL 5EH1A 2JCWA 1E3FA 1SM3H 4OFVA 3CJJA 3EG9A 5CILH 2AXGB 1QZ1A 2RAMA 3U83A 1E28B 1F3RB 3FOLA 3MGTB 4BFGA 2BHFA 4W9LC 4MZ2A 3VRJA 1PY0A 5HD8C 2CLZA 3KL5A 3DVNA 1B9ZA 4A2MA 5L6YH 3GMMB 3VXME 4GO6B 1ODUA 4KI5C 4NQEA 3KWUA 1P5UA 2HJFA 1JZFA 2VR9A 2Y5TA 2N7SA 4TUOA 2W0KA 4ZUSB 3VFRB 4J3OH 4L5FL 4M9PA 3QS3A 2XVKA 2V2WA 5SX4I 1QSFE 1G9NC 1NWPA 4E9WA 1OHZA 3U1PA 2VUYA 3W9EB 5E6ZA 2RCSL 4NO0D 2HT3D 3MVSA 3MV9D 1ML0A 1PCSA 2IDUA 3L3KA 3MUY1 4K55A 1HEZB 1LEKA 3OKDA 5HJDA 3ES6B 1F11A 2IOOA 4CSTA 2JXMA 5CP3A 5HY9A 3D18B 2JKNA 4U1IA 2OMUB 4O3YA 3GPSA 3EYQC 4HHAB 4MQXC 4A7SA 1Z9MA 5HHPA 2G30A 3KH3A 5ICUA 1EGJL 2ZP0T 3RU8L 5F6IC 2XZQH 4W70A 4UM9A 4TVPD 4QRTA 4ODUB 3JV5A 3L3OB 3DWOX 3QQ4A 5HD8D 4R26H 1P7KA 2WKOA 2EXWD 5IB5A 2DI7A 2X5PA 1CG9A 1IGCL 1MREH 3IJSA 4PJDB 4WNJA 1BZEA 1VEPA 1WFIA 4J23A 1SF3A 3RNQA 5EDSA 2WP3T 4KI5D 3WMPA 4K73A 3KYMB 4UUJB 1G7LB 2WXNA 1ZLVH 1U93A 1F1GA 4CDGC 1NCCL 3C2SA 1LGVA 5CP7A 3DJSA 1AQDB 3DARA 5F6HJ 3ILDA 2Y4SA 3VFTB 1Z5LA 4QRRB 5ERWA 5KSBF 5AOJA 3PE9A 4Y2DB 4Y5VC 3CZLA 2EDRA 2XN2A 4MD0A 3INOA 5I8CA 3TFKC 4KFZC 5EIIB 3RUGF 3EYQD 4MQXD 4M43L 1ORMA 1PFCA 4TSAL 3GKWH 4OFPA 4OIIL 3PHOA 5HJ3A 4JFTA 2OX5A 3S3BB 2CLRA 3L7EB 4MGXA 2CPUA 1DBAL 1QR4A 1B2WL 2D31A 3PWUB 4AVIA 2Y07H 4PY8I 3PHOB 1WZAA 4MNQE 3HAEA 3V8CA 4ILDA 4MQTB 2YPVL 3QG7H 4M1GH 3PGCB 4ELMF 3FSAA 2WXRA 4ZUVA 1D7BA 2VZTA 3ARWA 5C9JA 1H8OA 4XCEB 2JCCF 4A2GA 1V7MH 1SHWA 3CFMA 3ZBMA 1NEZG 3DX9B 3PAZA 1BW8A 3FPXA 1OWWA 2EDYA 3OGCA 5J11B 2FSDA 3I02B 3L4WA 5TDOA 3FCGA 4LHUB 3NJMA 3KGUA 2YARA 4B3VA 3KVPA 4I48B 1XCQB 2EIMB 5D1ZC 5HYSA 1JK8B 4OF6A 4OGYL 5HPMB 3T20A 2CR6A 4OCMC 1RH8A 3OKLA 3D2UD 3IM1A 1IFRA 1BEYH 3TBWA 3X14B 3K6SB 3S5YA 3P4OA 2BVOA 2DLFH 3LKNA 1ILSA 1UATA 3GXNA 4N22A 4WKZB 4QAMB 5EUKA 1VF5C 3IF1A 5FKPA 5FYJL 1M05A 2ZWYA 3DX3A 4A7UA 1YYLH 4C47A 2BCKB 5T3ZL 4POZD 1QSVA 7FABL 5E8EA 1M7UA 2KZBA 2ZUSA 3VFMA 3I50L 3LH2L 3HI1A 2QZQA 2VCOA 4YLQT 5EN3A 5C0BB 4X7SH 4Y19A 5DURB 3SCMD 1MQKL 3VFMB 1C5BH 4WI7A 1LP9F 4M3JA 1YEIH 3FU7B 3ZW3A 3R7RA 4D9RE 3HPJB 4F57L 4JFEE 3QJZA 5DZNA 1M3IA 3RZWA 4GG6F 3JWOC 3E2HB 3VQ2C 5DJ2B 2BRRH 2J8OA 2Y1VA 2B2XH 3U7AA 1X7TA 3CX5K 1I3RA 1KBVA 4GAGH 3IMWA 3X13B 3QJXA 2QSCL 3FO1B 4PJIA 5AOMA 3VDAA 1A3QA 3PV6B 2R88A 2OYKA 2FT6A 3ZYJA 4LPTA 4PB9H 2B1HL 2QTEA 2XZZA 3ILQC 4XMUA 4AX3A 3OG6B 1EEQA 4ERSH 3NG5A 1QMUA 4YPJA 1GJUA 1GHFL 1CDGA 4R2GB 1N7ML 4HJIA 5FO9A 1IBYA 1DEEB 4XNYL 5B7EA 4JCLA 4TL5A 3G6JE 3UG3A 1AYRA 3CU1A 2Q7AA 3ZKXC 4TQIA 1I1CA 3IDJA 1JZJA 1ETZB 4B9PA 4N28A 4NP4H 4FTVB 1ECZA 1EMTL 4JCMA 4G9DA 1CYXA 3WU2O 2OSLB 3MRHB 4EKXA 2DBJA 2D7PA 1RZGA 5E9DA 2CK0H 1KYDA 2IH8A 2H1PL 4KGLA 1NAMH 3ZSSA 5K1NA 1SUHA 5TDNB 2EDDA 2NY4B 5FDWB 1OM3L 2EDHA 1P6AB 2PPFA 1ZHNB 1KTJA 2LTQC 3EH2A 4ELMB 4LSVL 3QFDB 3SQBA 3BSZH 4YVNA 4WO4C 4EI5B 1CD0A 4N26A 4XH2A 4AZUA 3SQBB 2KQNA 5IBUB 4JDVA 3C5XA 2YPLE 4G7SB 4HXBL 5E5LA 5J6SA 2ERJB 3UO1L 1OALA 1I1AC 4UBDC 5DD6B 5G2NA 2ZSWA 3UBGA 2EUVA 3K6IA 3TO4C 3U7WL 1NGXB 4ZX5A 4P46A 3GB7A 2VQ4A 3SE3A 4RA0C 1U8CA 2QMJA 2EC9T 1ONQA 3U46B 1ZGLB 1GRWA 5G55A 1GW6A 3VXSB 4KK8C 5HGDA 3BIKB 1CR9H 4BZ1A 4R7NA 2PMZA 4AV0A 2A1WL 2A4CA 2GJ6B 4KK9C 5DRWB 1QLFA 1WZ1L 2X1PA 4XN2A 1QFWM 3N42B 4HK3N 4MAYB 2VDRL 5F89B 4YXHL 2XG4A 3MLRH 2B59B 1HHGA 2R2HB 4W6WB 4N0YH 1FZOB 4XVJL 1EGJH 4IMKC 3QUXC 2OLDA 5BZZA 2VDML 1HJBC 4ZFZB 2EC9U 3OPUA 4ZD3H 1TJIL 1A4JB 1MZZA 1I1AD 2BMKA 2G2NA 4KXZH 3TO4D 4PW3A 2W5PA 2H3NA 2OI9C 3MJ9L 5EUOA 1BJMA 4UT7L 3T0DA 3DXAD 3MLYL 3SKMB 3VNZA 1NAMB 4PLJC 1BVLB 2YWZA 3O4LA 3EXLA 4WSGA 2YSSB 5EO9B 1NCCH 1JIBA 1NCTA 1RUAH 4OQTL 2Y36L 3MUGB 3DRQB 4Z7VE 3IPBA 4NIKB 4JG0L 3WGVB 3X3FL 3GMLA 4YHYB 1RK0B 4DP7X 4KY2A 1CFTB 3AAEA 2GK0A 1JJUA 4WW1B 2APWA 3QEQE 5FYLD 1WBZB 3J2PA 4A2DA 3S3DB 3BRDA 4OIIH 5J5EA 1FIGL 3IXAA 2DQJH 1Z66A 2ZUWA 4IRZL 3FSOA 1BMWA 7PCYA 1B2WH 4NRYB 4UU9A 4PU2A 5C7XL 1SVZA 3R0NA 4PJGE 3QQDB 4ZTPL 1FO0L 4V1DA 3VFPB 5JUEH 3RHWK 2WSPA 1YO4A 3CZGA 3R1GH 5EU6D 5K39A 5HYJE 1DSWA 4GBXD 3JTYA 4XMLL 3RL2A 3KPMB 4PLJD 1FWXA 3WLWC 1YPZE 2CBPA 1TJHH 2ZYHA 2LQRA 2A0LC 4F2MB 5BS0A 2ADGA 1MIEH 3NZSA 5EZPA 2YIHA 5CEZD 4FEIA 2NSMA 2YQGA 3F8UB 3LKPA 1JPST 2NXYB 4JHWL 3SEPA 3WNNA 1MXGA 2YD4A 4UYPA 2IWWA 4RLBA 4R4BA 4XO3A 3WS6A 1NBYA 4YSEA 5GV0A 3LKPB 4TKWA 5DR5H 4LIQE 5EORL 4JAMB 5I0YA 5CCKL 1ACXA 4K9EL 1SPDA 3KYAA 5FYJH 3S5ZA 3N40F 4N86A 1FORH 2KYIA 2V37A 5D7IB 2WVVB 4WWID 1VHPA 5T3ZH 1CJYA 7FABH 3US9A 5B7MA 2VWEC 3AA0A 3O9WB 2AEIT 2ICEC 5JHAA 3NH7L 4IL6O 3I50H 5IFHH 4GRLB 1F02I 2WNGA 3SPHA 1XCXA 1MQKH 2E7HA 5HGBA 2L8AA 1INEL 3GQFA 3WLWD 2AKRA 5AOLA 4WY7H 4F57H 4Q6IA 1XVSA 3GLDA 5HGBB 4NQCB 2A0LD 2FJUB 3DGCR 3LD8B 3NAAL 5IJBC 1R24A 5HSFA 5KSAC 3ZK0A 3TF4A 1NMBL 1Y07A 1UWGH 4QHKJ 5DD1H 4G5AA 5IQ7L 1CGTA 4YAQA 2A6JB 2YPVA 1N0XL 4HF5L 4XMKL 4Y1SA 1G43A 3SSGA 1F8TL 1FVEA 1KXHA 4LVHC 4GO8A 4U1SA 2HH0L 1N7MH 3MNVA 3MRNB 2WLLA 4S1QH 1LE5B 4XNYH 3F62A 4F7CB 2P46B 4X9GA 1XGUA 3AU1A 2TAAA 2LFGA 4P9HH 2JTYA 4ACTA 2UY7B 3TV3L 3NSJA 1DCLA 1EMTH 5C97A 3I75B 1UYWH 1CXIA 1ZK9A 3L5HA 5AALA 4XVSH 3S2CA 1WAAE 5T1KB 3L3GA 1NBZA 3MCYA 4P23B 3L81A 2IVFC 3IMSA 4LSVH 2ENQA 3DA4A 1GY1A 3UABA 4QOKB 3SDDA 3VDCA 5BRZD 6PRNA 2DQHL 2VKWA 3ETSA 5KUKA 1DO6A 2I07B 1YUHA 1A21A 3NIFF 5IB4A 3JT2A 1AIFA 3MLTB 4HXBH 1JV5A 4IBLT 4JLRB 4XCFL 2VLLB 4HBCH 4PRPE 3UO1H 3VZTX 1QSED 3Q8BA 4NRXA 5C07A 1K3ZA 1SXAA 5IB4B 2RMNA 1JV5B 3U7WH 5DJYB 4DETA 2Z0BA 2AI0L 4X4XB 3BP4A 1FVDB 2MQ0A 1UT2A 4I3SL 3VRLE 3QCVL 4N1EA 4D0BA 5E7FA 4QYAA 4M61B 4L8BB 3AM8A 1NC4A 1D7CA 2JK5A 4U6YA 2LE9A 4N0UB 3EOYG 4OVUA 4QHPA 1WA2X 1RJYB 1UD2A 3MRJB 3RY6C 4PJHF 3ET9F 3BWSA 1UQSB 4XT1C 3VWJC 3L4UA 1KJ3L 1OAYH 1WD8A 1WZ1H 4A7TA 4LVOB 1JGVH 3UDWA 1XGPB 2P8PB 3EJYD 3H9HA 3VE0A 4XVJH 2W07B 3FQ1A 5E2VL 3DIFB 3KPOB 5CJBA 4D9LL 3GJEB 4NAMA 1XF3A 2IPUG 3V4VA 1KYUA 3U2SA 5C70A 1TJIH 5IHBA 4AJYV 4CSSA 3E38A 1BREA 1TZHB 4HC1H 1T5WA 3WE1A 1LO4H 2JTDA 3FT4B 2FB4L 4X5XB 3MJ9H 3VXTA 2JQYA 2WB1A 5ETUA 2CO6A 3MLYH 5DFWH 2P5ED 5IQ9A 1AY1L 5C0CA 3X17A 2GABA 3D4GA 4OZFG 1ZHLA 5TQ0L 4UMSA 4WJKB 1U8LA 4PR5A 5A43C 2UY6B 4CUCA 1GSKA 4ZMLA 4I4WA 2J8HA 3EYOA 4C4VB 4TQ8A 4OJFL 1HXMA 1R5WB 2FHFA 5IYUA 4JG0H 4L8SA 3NJXA 3X3FH 2R1WA 3LIUA 4MZIA 1U3HC 4JFFD 1A1OB 1T7ZA 2Y2YA 3HE7B 4JPKH 4NEHB 1FIGH 2BIMA 3T3MB 5T8IA 5F7HA 3C08L 4PRBA 1E9QB 1Q94B 4P59H 4N8VB 4Z77B 5L2JA 4K71C 3MV8B 4ZTPH 5HP5A 3PQYA 2X4QA 4MZ3A 1KIQB 2XN9D 4G7YH 3TASA 1IARB 3APCA 2AVFA 1LWRA 4LEOB 4FFVC 4H4NA 1KPVB 1LQSR 3NIFB 5JA8B 3CUPA 4G9FE 1ND0A 3GZPA 3GHPA 1WBXB 3MJ8B 5GRUH 4NZFA 4QCIB 1NLDL 5TH2B 2V7NB 3VI3E 1EFXB 4ZO6A 1P7QB 2EP6A 3OJDB 2VXSL 3U4BL 4BYHA 3O3DB 1F6AA 4OKVB 1RHFA 2E6QA 1AO7B 2J57A 2WV3A 4JHWH 4ZQKA 3R8BB 3KWVA 2VDMB 5IHHA 4J3TA 5EORH 4FRWA 5FA3B 1YY8B 4K9EH 4PJHB 1BV8A 1GFMA 4RWYL 3FH5A 5E1IA 3O0RL 5IW1B 5JW5B 5E8PB 1H9DA 2VR3A 3UEZA 4ZNEA 1KNOB 2X88A 3L4CA 2AQ1A 2P26A 4F7PB 4S1SL 4H25B 1O7DC 2NCEA 3LKSA 3PWJA 4MYPA 5F9JA 1T04B 2YAOA 3NH7H 4KUCD 4OQTA 4AMXA 2Z31B 1V05A 2PXYB 2R4NA 4FFVD 4UV7L 3LKSB 2IANA 3RFRA 2FEEI 4N2LA 5SX5K 1INEH 3BAWA 1G0XA 3CCHA 2Y6SC 2EVFA 3DTXB 3F01A 3IRPX 3ARTA 2IANB 2RB8A 5B21A 1CVSC 2F18A 4L3EA 1TQBC 4IRZA 3RX5A 3M46A 2FIKB 3O41A 3KPSE 1JWUA 2LLGA 4KDTC 1NPUA 3BP7A 4PJ8A 5IQ7H 5D70H 1FO0A 4XMKH 3V0IA 1F8TH 1HH9A 1K8IA 2F7RA 3OMZA 4IRSC 1JWUB 4OFYA 1CS6A 2VRKA 4B27A 1DVFB 1R5VA 4PJEA 1H3PL 3IGAA 5INDA 4O3XB 3RZCA 4HSQA 1XGQB 2CM5A 5BRQA 1XFPA 4ZW3A 3S4SA 6TAAA 3BEVA 1A4KA 2PYED 4IMLB 3DX8B 2CDEB 4LCWE 3TV3H 4AM0A 5B8CA 4E5XB 1DVZA 4IQHA 5JW3L 4Y1AE 1TKWB 2AV1A 2FE0A 3LN4B 4U3SA 3HWBA 2VXTL 4MMZA 4Q0XH 3FBQA 1QLRB 4K7FB 4LCUA 4ZMVA 2AJSL 2Y6SD 1F4WL 4JFQB 1N0LB 4J8RA 3W81A 3T4AC 4M7LT 4ZNCD 3O0EA 1K85A 1C08A 4QHUA 1Z9SB 4IRJB 5FGBC 4HISA 5E6IB 4BH7A 4YQXL 1I8AA 3RPIB 5I8EB 1ZANL 2R2BA 3GJFA 4KQ3L 1JD7A 3TU6A 4LQFH 1RU9H 2CG9X 4HUNB 3CLFH 4ZPTA 1YMME 2TSAA 3G5XA 1CE6B 4XCFH 4BSJA 2FCBA 4IRSD 2E6PA 4J3BA 5JW4M 4HW6A 3ARBA 5CS7A 2AI0H 4HEPG 4I3SH 3HBZA 3EKCA 3QCVH 3CQFA 4F5CA 4JMXA 1OOAA 4NDMA 5SX4H 3HIZA 5FHAL 1CD9B 2RACA 3L5WA 4QY8A 4TNVK 4M29A 4ZXBA 3E9TA 3C75A 3HG3A 3VI4A 2Z9TA 4XGZA 2J1XA 1HZKA 1U95A 1ZIAA 1OE2A 3LPFA 3HEIB 1A7QL 4G3YL 4RRPM 2F1VA 5J6HA 1EERB 1MLBA 1DQQB 4D64A 1HHKB 4H8WC 2PTVA 4P2QB 3CFDB 4E68A 4IBTA 5FWRA 3D39B 4OY9A 3MRGA 4HULB 3SBPA 1K2DA 3GMOB 3VJ6B 5E2VH 5AVZB 4BIKA 2EKJA 3KXFE 4FULA 2ICWB 4FF9A 3QXUA 3I6SA 2FWOB 4D9LH 1UZ8A 3OSKA 3LMJH 4I13B 5H2BB 3SHSA 1S7VB 3FHAA 4Z7UA 1DO5A 1CBVH 2ZT9C 3UMNA 1CLVA 3QSKB 4TPRL 3O45B 1TQSA 2L7EA 1SLVA 1HX0A 2YZ1A 5HI4C 5JDSB 1QO3B 2XVGA 2J2ZB 3SQRA 4RLCA 4LGPB 1OVZA 4FTDA 1U2HA 2JKWA 3UTQB 4PJ9B 1XR8A 3TM6A 3O3EA 1A3LL 1K4CB 1S9WA 2A9MH 2VC2L 4V33A 5B39B 2A74C 5TQ0H 1ZHTA 2HX9A 1KTKE 4YR6A 4Y4HB 4EBQL 3QRLA 4ZOBA 3B34A 1WA1X 2X0WA 3INUL 4YDVB 1XAUA 3V6FA 4JW3A 5FVNA 3EJTA 1IFGA 1T7XA 5JIIA 2K3HA 3DMMC 4GW1B 3P3TA 3RIKA 3RWHB 4Z7QF 1CTOA 2QPUA 5BNXD 2CD0A 1OOWA 3NQIA 1RHHB 2ZF9A 4CL7A 2R39A 3M8OH 3FB8B 4KMTH 4HJEA 1J10A 3BFWA 4U0RB 3IRCA 4NNPL 1FPTH 3C08H 3FSWA 4OJYA 4MA7L 2R51A 4PP1C 5GS0C 1U8PA 1YJDC 4NOFA 2XTSA 1JI1A 5E6YA 4RESB 1INQA 2HKAA 3PL6C 1FZJB 1FNFA 4JM2B 2N2MA 2ZONA 2BS71 4H7VA 2P45B 3AQYA 1N6QL 5HI4D 3OHXB 1IGTB 4JO8A 4KY1H 2D4DA 2Z8SA 2VN7A 1SHXA 5DZJA 1KN4L 3NZHH 4HEMA 3RWJB 4TVPE 5CBEA 1A02N 1NLDH 3C5OA 2X1WL 3EJPA 4X5LA 4JGNA 1AMYA 4YMPA 1SXNA 3EFOA 5G5DA 2GJRA 4MKMA 1BX2A 1P6WA 4KI5E 3DMMD 4I8DA 3FH8A 4BDVB 1MHHA 1XBDA 3A23A 3M17A 4OGAD 4ZOAA 1TTFA 4G8GE 4PVNA 4MXWL 1JFQL 2V4LA 4PP1D 5GS0D 4RWYH 1U2CA 5DVNA 3O0RH 4NT6A 3SBWA 1GYAA 2N0MA 3PL6D 4K9JA 2A9AA 2OA9A 1JYXA 1XB8A 1TVHA 3WFHB 2X87A 4HUMB 2WBJB 2EXTA 3CZJA 4UILL 4WI3A 5IR1A 3ARDB 4UV7H 1CFNB 3AB0C 4FQHB 2WGNB 4JZJA 2RH0A 2VR5A 3MNWA 2W0FB 2H0EA 3H0TA 4TNEA 3BH9B 1ZOXA 3P77A 1JCVA 1MZYA 3TNMB 3X12A 1QEWB 5A2CA 3P11L 5AYTA 3WNPA 2WCSA 3IJ9A 3QO1A 1L9MA 1TITA 1MLCB 3BRFA 3NJTA 3RYMA 3MROA 1AVAA 3L1OH 2ZX7A 1ED3A 3L9YA 5JHLL 3HJEA 4DEPB 3OC8A 1YVLA 1J9RA 3QIWD 1QPPA 1M71A 3C5ZA 4W9ZA 4CC0A 4JK0D 4QT5A 3LV3B 2JKIS 2YBGA 3O3BB 1A8ZA 3DIDA 1NJ9B 1M7DB 3VFGL 1YLBB 1H3PH 1W8EA 4K8RC 3EMNX 4YLBA 4N85A 4OZIF 3WFDL 5JW3H 1UJ3A 2O5XL 3W5MA 3ETBF 4D0DA 2ZLDA 4N2OA 4NJAL 5HGAB 2VXTH 5I1HL 2CR3A 2HUHA 3VYPA 1GJWA 1NPNA 3GYRA 1EIBA 3ARVA 2RQEA 4U49A 3WDHA 2JMRA 2AJSH 2BNUB 4GW4B 5JIKA 3DO7B 4AH2B 2J56A 3MN8A 5B1BB 5IWLC 3QARA 4YQXH 3O4LE 5SX5H 4DGYL 3DYOA 3B7RL 4GINA 1BYOA 5F3HA 5ID0B 4UQ3B 3UGEA 4M6MH 3MBXL 4B9CA 4XP1L 3WYRA 2FQEA 1FFOA 1G7PA 3QXDA 3UTTD 3LQAL 3LSOA 1C8QA 3H4HA 2A4ZA 1DSYA 1SHSA 2DWEA 4P0DA 4IIZA 1HWHB 4PV1C 4TTDC 1D6EB 5LQBL 4K8RD 3OSVA 2J7LA 2WC7A 5BQ7A 2LFUA 5I71B 5D4HA 2FQFA 3N91A 4FKHA 5TF1H 1LEIB 2AJZA 2XPYA 3ZE1E 5E70A 1THQA 2COVD 5FHAH 3D3VE 1BOGA 3HI5H 2W0LA 4P2OC 1WAEA 4S0TD 1MCSA 4UAOB 4ES8A 4M7KL 4X7CC 4V1DE 4BXVA 1RZ7L 2DOCA 2J6EA 2XV3A 2HPTA 4G3YH 3MUUA 5EBMB 2ZP9A 1DVYA 1EAJA 3C6SB 3EYFA 2WZ5A 4DAGL 5TE6L 5DXWA 2K0RA 1S8DA 3WIIL 2NY7H 3BCDA 4ONHA 4D8OA 3FQNB 2HJKA 4MZRA 2EH8L 4HUVB 4BK5C 1VFUA 3O8XB 4PVLA 5FDYA 5A3ID 5BS0E 3HG4A 3IMVA 3E3QC 4HD9A 4R7DA 3FTYA 3WN5C 3PXJA 1L9PA 4PJ5B 4TNVF 4NWTH 3B8YA 4G80B 4TTDD 1V7NH 3HE6A 3FUHA 1HQ4A 1UWYA 4TPRH 4A63A 4MCYA 1ULVA 5DJ0B 2DYPD 2WXKA 3PAUA 1ILUA 5AVRB 2BNQA 2VC2H 3IJYA 4N6QA 4P2OD 5HHOD 3UTSA 2HG5A 4GKZB 5HPOA 3Q8CA 4H20L 4EBQH 4WCYL 3INUH 3LNEA 3GMRB 4J6IA 3JV0A 4NSKA 2NRDA 4HOXA 5IG7B 1XCWA 4LZKA 1PW3A 2OQJA 4CKQA 4OZIB 3PWLB 1I7TB 3CBKB 1ADQA 4LK4A 3E8VA 4M00A 1JZGA 4Z7NE 3KHOA 3WNIA 4E42B 5KVGE 2O5ZH 1T0PB 3BWUC 1BD2E 4KRMB 2BOCA 4LLQB 3LN9A 4TV3A 1M6OB 2HWZH 4BRVA 1A1NB 3TWYA 3ZLQC 3TYFA 2F08A 5EC2B 3HCVA 2Y7SA 2I7SA 4Y16D 5I1JL 1N6QH 4GOSA 2KQMA 4HKZB 5PAZA 4HIEA 1RK7A 4IKLA 1QUPA 3L5IA 2BVEA 1O7VA 1KJVB 3FUMA 1G1YA 1KN4H 2PW2B 5AW4B 3WU1A 1KBBA 3H8NA 4L3AA 2Z92B 4QJ4B 2EDMA 2EXYD 3GIZL 4ZOCA 3LZLA 4R7LA 3VQLA 1QLEL 2X0UA 3OAYK 5BXFB 2VRQA 2AQSA 2WOBA 3DXAE 1UWXK 4NS0A 2P49B 3NCYS 2JMMA 2BSRA 3WDIA 1Q9KB 2BVPB 4Y4KC 4BUHA 4HWZA 3L2NA 1T0OA 1YDPB 4KI1A 5TISO 1JFQH 2CXKA 2IH3B 4P2RB 5D7LB 5CFHA 4DFIA 1J8SA 2Z7WA 3ULVE 1QNZL 4Z1PA 1P1ZB 2A6IA 5DFTA 2DZEA 2H6PA 2VC2B 2ITFA 4X6EB 2AV7A 3EHBB 5FYLE 3K8KA 2H6PB 3QNXA 1U6AL 4QRPA 2J5LC 4YDKH 2NR6C 5DJ6A 4A2FA 5CJXC 3SKNA 4WV1B 3NUKA 4NQVB 5CR1A 2E75C 4HFWA 3UROR 1NKGA 1WS7A 1RPQA 3AVEA 4WUUD 4Q9CA 5DSCA 5EU6E 1P5VA 3SY6A 2VABA 3HVDA 5A2KH 2N7BA 1BZQK 1AG6A 5FB8A 4PGJA 1CICA 3HC2A 3VFUA 2UWEE 3KLSA 3VFGH 4DUXA 3FFDA 2XKUA 4YEFA 5FB8B 1VZGA 2A6KB 3DX4A 3TTYA 4JM0A 4P4KC 1JV2B 1ZEAL 2Z1KA 3WFDH 4OJEH 1T2XA 2O5XH 3BVTA 2OXGA 2M06A 4P2CG 4YHNA 1RCYA 2J1KA 1HSBB 3II1A 5I1HH 1JGDA 3HZMA 1QRNA 4LRIA 4LCVA 4JB9H 2DF3A 1NCJA 4MDIA 5LO7A 2NR6D 4NWUH 3VFVB 4OLEA 2IDFA 2VE6B 3FJTA 2HLEB 3MREB 4ZUUA 1JS4A 3C5JB 3KL3A 3VXUD 2JQZA 5JQ6L 1JPTL 2FBJL 2OMXA 4YO0A 4UNUA 4E9VA 5LGHL 4OM0H 2C9PA 1KCKA 2DMCA 5J13C 1CZ8L 3MBXH 3ZDXE 1RPUA 4XP1H 3PFUA 3BH8A 3V0JA 1JF6A 1NCDL 3LQAH 5IM7A 3SDXA 4JANB 3EO1B 2G5RA 5F9OH 1PAMA 2A9CA 5KYWB 1IILE 5LQBH 3W9DA 1SDAB 3O2VL 1UXLA 3TBCA 1YEEL 1JZ4A 4P4KD 1MHPH 4XP9L 4AEHL 3IDMB 1UOKA 4BZ2L 2O6EA 3F04A 2X53A 2VDKL 1IAIM 4GIOA 3LH9A 5AFUK 3PQYE 4JFZL 4M7KH 5IMOB 2VLJE 1PNDA 4I9WD 4WHYH 3BRGC 4B9JA 4G1MB 5EBWB 1WAPA 2Y5EA 4L1BA 5KN5A 4R96B 4F8PA 5I19L 1LK2A 3WEXA 3ARRA 2E5EA 4DAGH 5CJOH 1I8IB 1Z7JA 1GFQA 3WIIH 4BKLA 1ITBB 2B16A 4GG8A 3GP6A 3VD1A 4G76A 1P5UC 2YPKB 1CCZA 2MPVA 2CDFA 2WSKA 4MJJA 2IADB 1YEDB 3HZVB 3P40A 3CQQA 4H13C 3D33A 4ETQB 4G6ML 3T0SA 1DSFH 1S7UB 2P8MA 2HFEA 4X6DB 4P04A 4YE4L 4YHIA 4DUVA 1KPUA 3QUKA 3DOIA 2YD9A 3T65B 2R4LA 4LVNB 5SWQA 3QQXA 1EXHA 4NQXA 1K5WA 4ZNEE 2BFVL 4CMHB 3SN6N 2WZPD 3PAVA 2EYRA 4X6CA 4IBSA 4ZMXA 3K6OA 3MZGB 3K46A 1T1YB 2NT0A 3VGFA 5AFUL 3GIVA 1HSAB 4W9FC 4J1UA 5LCVL 3WXWL 3ULUC 5FV2A 4PFEA 4L3EE 2KS0A 1EK3A 1OK0A 2ARJQ 3B5TA 3MA9H 2R4SH 4NAJA 5CWSA 4Q56A 2GVYA 5BVPL 2WYZA 1NGYA 4OCNC 3V9FA 5FFLA 1MG3C 1UVQB 4KKZA 4U6VH 2Q20A 3S34H 2CGRH 2E27L 1IM3A 4QRFA 3LRGA 1O9VA 4FG0A 5HHVL 1RZ8A 4YPGB 4PJEE 5DVKA 1QBAA 2C3GA 3A6OA 2OJEB 1SN2A 4LE8A 2DWYA 3REWB 5GZOD 3AWGA 4OGQC 3QJUB 4MB3A 3KZ8A 1NCGA 1PQZA 3RIFK 1XEDA 3RI5K 5K9KA 5INCA 3OQRA 2JFCA 2N59A 2H32A 1B4LA 2FX9L 4HK0A 4ZFFA 3CNKA 3GMPA 2H32B 5J11C 2WO4A 3ULUD 3V79C 3GSOA 1S7RB 1YNLL 3C8HA 3P0GB 4U1MB 1GGTA 2AFNA 2CO7B 2ZTBA 3L13A 1OL0A 2C7UA 3HG5A 3NN8A 4O58L 1TZIB 4QRRD 1NGPH 5EIIG 4Y2DD 1QNZH 2ZFGA 5DUMH 1R34A 1NANI 3AGWA 5DC2A 3KMDA 1FNGB 2IFGA 3U2IA 5GGTA 2Z0UA 1QI3A 4NX0A 1NGWA 4O5LH 4XN4A 4KXDA 1JDAA 4QHMA 2PTTA 1U6AH 4A1RA 4XN9A 1TZOA 3K80A 1I7RA 2BSDA 1R5IA 4AE0A 1AS6A 2Z93A 3R4DA 4DP2X 3HAEG 4J3OD 4KOBA 2XN9E 2JKLA 4HJGB 3QHTC 5CU5A 1RZJH 1J0IA 3B83A 3KPRA 4U1GB 3TZVB 3N85L 1XGTA 2BIHA 3HRZA 4LHUG 3WFCL 3SYSA 2E9IA 3OAYH 1NH6A 1LJMA 3RBSA 4NFBA 3BMWA 4ZX6A 4OTXL 3LDBB 4LHUD 1UWXH 1PZUB 1G1KA 2NSQA 2WMPA 4ZUWA 5I5RA 4X6FB 4YGAB 2Q9OA 1JF5A 5HYSG 1L7IL 1C16A 4KO5A 1MXDA 3PHSA 4GRMB 3SPVA 5HHQA 1PZ3A 4G8FA 4Z7UE 5ADXK 1PEWA 1LNUA 1JG9A 3M1BA 4WGVB 1YQVH 4NHCH 1QLEB 2J12B 1OY3B 3BLKA 1AGEA 2RFXB 3GGWB 1HCYA 1M7XA 1JPTH 2VISA 5JQ6H 2G60L 4XPBH 5F7FA 3MYJB 3WI5A 5DS8B 1XF4A 1AGEB 1TO4A 2R4RL 2X28A 2WIMA 1T5XB 3L5XL 2C1PB 3N0PB 1OZTG 4AKQA 1CZ8H 3I6LD 5C0BD 2CIKA 3T3PF 4J4PA 3UAQA 2VLRB 3EDJA 3MBWA 5DURD 2XQYK 2OMYA 4QRAA 4R3SA 1NCDH 3BAEL 4JQIA 1S7TA 3ZZLA 5JHDA 5K9OB 5IHZB 4K23L 4D5UA 2J8UA 5IQNA 3P2TA 4GPVA 4X7FC 2NY4C 5DGRA 3BVNB 1MI5B 4QXGL 2GCYB 3O2VH 1AKJB 5AW6B 4AQEB 2D7MA 1YEEH 3GSVA 2DQFA 4QXTA 4UQIM 4XP9H 3F64A 1ES0B 5JA9A 5J1SC 1ZA6A 4N2HA 2X42A 4XOAA 5GRWA 3NJKA 4XOBA 1X5KA 4AWJC 4BZ2H 2YMTA 4LL9A 3KLAA 1EH9A 3VO0A 1KJMB 3ZTDC 4NN5C 2AK4B 3P3SA 5KS9E 4P5MA 4BWWA 2ERJC 2JLPA 2VMJA 3AT9A 5ILTH 1D7DA 2XG5B 3M86A 5DEFA 4ODTL 4G42B 5M95B 3LIZL 4TLSA 5ADXL 5FYJU 3N2JA 3CN0A 4HEME 4ZDHB 4IYKA 5IB2A 1O7DE 2O6PA 2PYEE 1V3JA 4FTVD 3FN9A 3NEEA 4P46C 1ZHKB 2YA1A 4GHBA 2AJXL 3BO8B 3W56A 4WTZA 3FU0A 3JVGA 1XZ0B 3S97C 1TNNA 4AV4A 1MN4A 5KOVC 3G5VB 4G6MH 1E4WH 2NY4D 5LAXB 1P4BL 2EDTA 4YE4H 2XV0A 4WLCA 1EDQA 2HT4C 3BDXA 1A47A 5IBUG 1H9VA 4BFRA 1DQKA 5IMMA 4K4KA 1GZQB 1ZSDA 1JMXA 2DJUA 3VGDA 2E7MA 2BFVH 3FBKA 3CXHK 5JOPD 2IMNA 3QDJA 4OCRL 5ANMA 4Q97A 4OD2B 5IVOA 5J7CC 4NNXA 1X5IA 1L3NA 3NJVA 1N59B 1K8DB 3EZ8A 4H1LA 2YO3A 3GT6A 5C3LD 5I6LA 5DUJA 4LGRB 5DZPA 4GJTB 5F1NA 4APQA 3RG1C 5I6MA 2VITB 3CZUB 3DSFL 5D1XB 4ALAC 2WQAA 4OQ1A 3GUTB 2FATL 3QXVA 4FQLL 1WEJL 4KHXL 1KY6A 5D7KD 4Y5YA 1GFNA 3GTVA 5BVPH 1DZ0A 4H26A 3MV7B 2BINA 2GJ6D 2GHZA 2KT6A 1P84K 3ZGHA 3IFOA 4KZ0A 3L5JA 1UGNA 3AA7B 1T0NA 1XR9A 2HT4D 2VDKB 4U33A 1CU4H 2VM9A 5HHVH 3S96B 1DZBA 5B7FA 3T4YA 1XR9B 5HDBF 5HHME 1AOHA 1THCA 1W15A 2OYMA 3D50A 1U4FA 3QDAA 5EZJA 5JHMA 4AQAB 3NTCL 4KAQH 2AXHA 1AE6L 1OAKL 2FH6A 2LOEA 5D7JA 1PLAA 3DNKA 4TMPA 3D4CA 4GO9A 2NQ3A 5MI0B 5IREA 4XMWA 2DLGA 2X4UB 4ZO8A 2BLFA 2FX9H 3O2DL 3EOAA 1TTBA 3FDWA 4OJAA 2A99A 1RJLA 3GSQB 2G75B 2A83A 1N3NA 2J44A 1YNLH 4NENA 4PREB 1VESA 3F6JA 4XPFL 4DO4A 3QQ3B 1XB6A 3KM2A 4O58H 4MXVF 4BUQA 2K9FB 4U6HA 4A68A 4AUJA 4V2BA 3TN0B 1FC1A 1SYSA 3VCLB 5HI5C 3SY7A 1FP5A 1IGMH 4UNTA 4FQIL 4RMQA 3LEVL 2ZOUA 1B2YA 3HMWL 4N2CA 3WKMH 1OPGL 3CSPA 4PR7A 2FBRA 3E7JA 3OKOB 4HKBA 1FL3B 5IB1B 1QFWL 1VFAA 5L4IA 1UACH 2W8CA 5LCVA 3PHQB 3S36H 4GMSL 4PJXA 3O9WC 1SBBA 3MGOA 4XB7A 4JUTA 1NL0H 3KJ6L 3S36X 4GRLC 4GSQA 5KSBA 4KOCA 32C2B 2HKFL 3VYOA 3N85H 3SE8L 4BHUA 5ADPH 4UYQA 4EN3B 3TPUB 4AUYA 2BSED 2G5BB 2CBMA 4BKSC 3LD8C 2QBWA 4L1DA 3ZUCA 4EI0A 2XU9A 4L9LB 2FGWL 1G7QB 2WXJA 1TTCA 1L7IH 2XV6B 4MMYA 4Q6IC 3C60B 1IM9B 3IGFA 3W39A 3WLBB 1VFMA 3ZUNC 4ETYA 2FJHB 5I8KL 4FDWA 5F7EL 3TBVB 1JUFB 1Y0LA 4D3CL 1L0QA 4IKKA 2AJVL 3WTUA 1HZLA 4ZMYA 2JCCA 4PTTB 1N9PA 4Y88A 2FL5A 1FJ1B 2EIZA 2BP0B 2IH1B 2G60H 1OIOA 3O9WD 2R4RH 4LSEA 3KR3H 4KXCA 5C0AA 3TV8A 5CJ8A 3F83A 4PJCF 3L5XH 3NFPA 4GRLD 1X6LA 5AVSB 3VH8A 1XT5A 3OGOE 4FYSA 4KH2A 2WLNA 3BUIA 4KBPA 4CVXB 4Z3HA 4NUJB 3MRMB 2Z4QA 1ROCA 2DWDA 4K23H 2AAAA 5CO1A 3ML9A 3QR0A 5D9SA 5I6NA 3IVKB 4NQCD 1HESA 1IEAA 2CKBL 4LP5A 1A64A 2ZSVB 1C12A 2WXMA 5D5ME 3HLAB 2B0SH 3TL5A 2EDBA 4RDQF 3OB8A 2V9UA 4QJ3B 1NIDA 5AL0A 2F9BT 2MNHA 1RJCA 2NZ1A 5TDPA 2R89A 3C8KA 4ODTH 2YR3A 4QJ5B 4NZRL 3LIZH 4I18B 1HDMA 3U9WA 1LP9A 2YA0A 2OV0A 1YNKL 4KNSA 3CVBA 3UFIA 4I2XE 4ZMOA 4YHZL 4L0ZA 1CT8A 1WG3A 3FRPB 4AC4A 4GG6A 3QB7C 2IOMA 3GC3A 1J86A 1NGQL 2AJXH 4U9CA 3CX5J 1KELL 2KXPB 3QC6X 3QA3A 5GIRA 5JO5B 3VXPB 4X6BB 4XNMB 3UBXA 3UAAA 4NKOB 4HMDA 1MY5A 2FSEA 3DX0A 2GFBA 4KITB 4MSWB 3CHOA 4LVOC 4LLVB 2OYPA 4E41B 1YN7B 1MFVA 2WXIA 4WNQA 1MH5B 2Z7UA 4KQ4L 4QOKD 3FB7A 4IW4C 2PCPB 2PPEA 3PU7A 1JGIA 5D1ZI 4NCC2 5FYJD 5SWSB 3UTTE 3RVTC 3JBG7 5DMIL 3SE4C 4OCRH 5T3ZD 1NCWL 1RAMA 1CXKA 1RIUL 5AWNH 2P5WA 1BZ9A 3GSNL 1W9XA 4GQRA 4HIHA 3POQA 3KEHA 3P2DA 1SJEB 1FH2A 1I8LA 3NJHA 4HKJB 5JIDA 1TFPA 4JPVL 1M42A 2Z7YA 2R9HC 3D09A 4L0YA 5AVXB 4PLOB 1KLFA 3UPCA 2EYTA 5C3IA 4GI8A 3DSFH 3QEUB 4FS0A 5D93B 4HWEL 3OLIA 2FATH 2XX0A 1F3JA 4FQLH 4PCKA 3WY1A 1FNEA 1N4XL 1MUJB 1Z9PA 1OF2A 1UXWA 4K3EL 1PX4A 1OP3K 4Z7VF 4G7QB 1M2VB 4ZSOE 1QA9A 2WW8A 1ZRUA 2VJ0A 4MD4B 4PJCB 1NLBL 1J9TA 4MKTA 3B9KB 5JOEA 3HE7C 1MAKA 3LVEA 1L0XA 3C5SA 2OMVB 2BVUA 3RX8A 2KDGA 3SJVB 1KZQA 2HVKB 4PB0H 3RL1A 3FB6B 5GZNA 3RVTD 5EEZA 3AA1B 3BAYA 2V5TA 3TBBA 3AMLA 3PNRB 1AE6H 1ET5A 5EU7E 3ESMA 5D2NA 5DVMA 2APBA 1BQUA 3ZTNL 5KAQG 1IQWL 1X9RA 1ZJBA 4PRAA 2OXHA 2R1XB 3W82A 4AKPA 4URKA 3HPLA 3O2DH 3HR5B 3MYZA 3CVDA 3V0VB 1HH6A 5IF0A 2UV3A 2OR8A 3VACA 1G7IA 5DA4A 4HAKA 3SZDA 4XPFH 5HHOE 2B14A 4WWPA 3WELA 3GMQA 5C0CD 4YHPA 5I2IB 3K6NA 1JPFA 4HCRA 4LO9A 3V9CA 1E9OB 2PCFB 4WDIB 4CTDA 1LK3L 2OP4L 4CNIA 4YWGH 2H2SC 4R4FL 3WY3A 3DUHA 3HE7D 4FQIH 5I0DA 1FFPA 3LEVH 4N8VG 1OPGH 3MLWL 3Q7JA 3RY4A 3CHSA 2BSCA 3KS0H 4XPGH 5GTIO 3FO2B 4UIMB 5BV7L 1Q1JL 3PPSA 1I82A 3MV8D 3O11B 5IT2H 3V0AC 3CVCA 3K1KC 1J9CT 3L48A 4KTDL 2PXYC 2DMKA 2O6DA 1A5FL 3GSWA 2AK1H 4OZ4A 2HKFH 5FF6A 3ILPA 4RZCB 2FQDA 3OKYA 4FXKB 4PJBE 3A2SX 3SE8H 1X9UA 4B7LA 3NCCB 4HU2A 4OCSL 1HCZA 4J27A 1DQTA 1GZHA 4RGNC 4F1ZA 1KCSL 1PG7H 1EFXD 1JL8A 1UXSA 4M8VA 4M8QB 2WLIA 1JXDA 2DQEL 4JKMA 1ZA3A 2R69A 2FGWH 2XXGA 3FU6A 1SVBA 4JPSA 3QFJA 1VRSA 1BECA 4OM1H 1AO7D 3KNBB 3DI3B 1J9QA 1SUJA 1U9KA 2H2SD 1UB6B 5EC1A 3T0EB 5I8KH 1KJ2A 2K6ZA 3IMUA 4FERA 5F7EH 5K9JL 4AVKA 1IGJB 3H53A 5DDHA 1AGBA 3QRGH 2OL3L 4JPIB 4TLTA 1BF8A 4ATWA 1TEFA 2WHVA 1O5DT 1TZGL 4WHTA 2VXVL 1S7XA 3Q44A 5I17B 1B4JL 3RDTA 2OTWB 4I5BA 2KLTA 5K1VA 5C0IB 4WHTB 2PXYD 2XRAL 2OK0L 5J0BA 4WI0B 4WKXA 4R97B 1FZMA 1OGAA 5KW9H 1CFSB 4TLKA 5B8CC 3NIGF 1EHAA 2ICWJ 4GF4A 1O5PA 1OGAB 3ATDA 2IAND 5T1DH 1RULL 1WAAF 3DHJA 5EOQH 2FZ3B 4UOZA 3UC2A 5JMRA 2W80C 2VN3A 4PCTA 1KTCA 2E4FA 3GBNL 4QRQA 3ZRCC 4CVZB 1RZKL 4NC0B 4QPEA 4WUUE 4XCNA 2C3VA 3O3AB 4FE9A 3BP5A 5FFOA 1ZE3H 2OMBA 3PWNA 2GYSA 3AJ7A 3PNWB 3SPIA 1PLGH 3U30C 2DH3A 1MSPA 3RLSA 1DVFD 4HBQA 1OSMA 5I1EL 1MDTA 3DROB 4X5WB 4NZRH 2XCMC 3N40P 2QQNH 5DQ9A 4E5XG 1E2WA 4MMXA 3VRLF 2V2XA 4IK6A 3ZO0A 3S4SG 2K8QA 4YHZH 4U1JB 1MW1A 5MERA 2RHEA 3NT0A 1HIML 1MVUA 5JW4N 3N3EA 1V8HA 1EEYB 3PORA 2I24N 3FN0L 1AP2A 4O4XA 5DI8B 5ICZA 2R29A 3FTVA 4EQ3A 2R23B 1E8XA 2VERA 4DPBX 3OXRA 3ZDZB 1TYJA 4Z3TA 3ZXAC 4XI5D 1AZUA 2F54B 3OAWA 2Y7NA 4ZBJA 1RZIA 2AMGA 1HI6B 4ZUTA 3EYSH 1ZHYA 2F53B 2FLRT 2C34A 4RZKA 4D7PA 2ZKMX 1RZIB 1Z5YD 1ACYH 1NBQA 5DMIH 4RBPK 4JPWH 5KYUA 4RX4D 3GSNH 3MSPA 4UB8O 3FCSA 3F7VB 3CVHH 5I1LB 2XDHA 5IVXE 2I5YL 2YZ8A 5ICXB 4JPVH 4X99B 3FQXB 3ZN6A 4EO5A 5AEAA 4G5ZL 4OLVL 4CC4C 5GS1A 2CKBA 2RALA 1WBYB 3BCFA 5EEVA 4PJ9C 4OZGB 1H8NA 1L9QA 1KDJA 3DETC 4PRIB 2E8YA 1FL6A 3HKZA 1CLCA 3FH7A 1G5AA 4L2LA 2D9CA 3MRFA 2F7QA 2W88A 4K3BA 4MJIA 1FFNA 4JFOA 4XX1E 4P2QD 1NLBH 5E5MB 5AVVB 5EE2A 1H6TA 2LW3A 4IOSD 4PTUB 4Z6AT 3D39D 5E1AA 4ZFOB 5KVDL 4NO5A 1A14L 2NW3A 2WNKA 3NIGB 1EEZB 1WWWX 5D2LE 4XMPH 5DTFA 3B2VL 2EDNA 3FF8A 2XKNB 4JM2C 1MF2L 4MNGE 1JVKA 1D5ZB 5ESVB 3ZTNH 4DQAA 4NRZA 1IQWH 1IZNB 1V27A 3UAFA 3QPQD 4AQZA 1RL1A 5GSRB 4PJ9D 4DP0X 4CILA 4CVUA 5I6XB 2IMMA 2IBGA 3WHE0 4HLZH 3D0AA 4RFEA 4ZFGH 1HS6A 3VI3F 3X1FA 1NANH 4C4BA 1USZA 3ARUA 2VGLM 1ESOA 2NDGA 5I76B 2GBVA 3M6DA 2NUPB 5JHDE 1LK3H 1KIUA 5TPWL 3V5DA 1MWOA 1ZLSH 1IAII 3P4MB 3QDHA 1UD5A 3ULAB 4EVNB 1B4TA 2ZXCA 3GSNB 3A4AA 4IOIB 4B0MM 2EDQA 3MLWH 4L0PB 2AAVA 5F0JB 3OTTA 1Q1JH 3CE1A 2O72A 2V8MA 3MLVL 3CZKA 4Z7WB 4UQ9A 3GZQA 3DVIA 4F4BA 1OE3A 4JM2D 1A3ZA 1KLGA 3BAIA 3C6LB 5DUBB 1OB1A 5IFJB 4KTDH 1BCIA 5I75B 3IGKA 1VACA 2GBUA 3I6GB 2QTVA 5I16B 4QHKI 3U6XA 4OCSH 3NEOA 2ROYA 4G72B 2AITA 5I5MA 1KCSH 3HZKA 2IGFL 2UUDK 4GXUN 2DQEH 4PJDE 1PD1A 4FI6A 1YC7A 3IT8D 2L4OA 3QG6A 2YRPA 4FFWC 4H5SA 1OGTB 2K9UA 4DEPC 5JXEA 2PP9A 3TH3T 3LEXB 4Q6KA 1ZTXE 3UJIL 1OSPL 1IVLA 4ENEC 1F5WA 4HPOH 2OL3H 4LLMA 4QRRE 4PV8A 1TSHA 5HVWA 2VXVH 4NUPA 3S8GB 1R0AL 3WN6A 2X7LA 1R3JA 1Q0EA 2WBJD 3QDJE 4WTQA 5F7KC 5T1MA 4UCFA 3STLA 2NNXA 3WS3A 2XRAH 3ARDD 3B9VA 2OK0H 5FK9A 5TGBB 2X7LB 4MB4A 4W81A 4L2YA 4ZG1A 1LM8V 3Q1SL 4N2BA 1ZVSA 1RULH 4NYLB 4Y4FA 4F7EB 1A1MB 4X50A 1INDL 3GBNH 5EZOL 5I1DA 1RZKH 4WWKA 4LCYA 4PWHA 1IC5L 5BUGA 5EZLB 2XPGA 1NM4A 4GEJA 1JNNH 3NACL 3BC9A 2JI3A 4BSWA 4WI8A 4ENED 3AFLA 3KM1A 3FQUA 4J6RL 5ABDE 5FOBA 5KVFL 4ZW6A 1U91A 3UG4A 5T5FA 1Q9WA 4ABVA 5J56B 5ID1A 5I71C 1XMWA 1ZSHA 1F2XK 1QFOA 1Z2KA 3QIUA 5J4MA 3C9NA 4NUGL 3EF4A 4OUOA 4UAOC 5IMKA 1HIMH 3I6KA 2YD2A 4NPYB 5AVWB 5IOKA 3FN0H 5AZ2H 1PYWA 1T7WA 1R33A 3BGMA 2IWEA 2GTZA 3ERXA 3AQDA 3FRUB 5JPMA 5GJSL 3ZX1A 3F7QA 5DLLA 5AAMA 1KIRB 5BO0D 4RNRA 3K6FA 4QO1B 2X12A 1VEMA 5L8KB 1S2EA 2MHAB 3BYYA 1AGDB 3MCG1 3O8XC 4IKJA 4WEUD 3I6LE 1HXYA 5C0BE 4H0HB 4F58H 1FYTA 1K72A 2OL3B 1BXVA 1EO7A 2HVBA 4JFDA 3P4NA 4X9FA 2P3YA 3MMEB 4S10A 1WCQA 1YC8A 2OW7A 4WU7A 4N0FA 3TA4D 2PCYA 1KCVH 3Q6GL 4XOCA 4YH6A 4B50A 1JWSB 1U8IA 8CGTA 3UAJA 3FL7A 4YZFF 2I5YH 3HE6C 2XZCL 1IMHC 4YLCA 4G5ZH 1L9NA 5JR1L 5MEQB 3CZFA 5L0QB 3Q13A 1B0IA 4WHDA 1A6AA 2HT2C 2H8PA 5HDWA 2AQQ