4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant A10_001
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
4AYEC 2KDYA 4O4UA 2KC0A 2YPVA 3V8UA 4AYDC 4O3ZA 4AYID 4O3XB 3VE2A 2W80C 3HOEA 5T5FA 4O3YA 2W81C 1YS5A 4QQ1A 2Y7SA 4U9CA 2LFUA 4O4XA 5EE2A 3UAQA 3PQSA 4AYNA 4Z3TA 3VE1A 3HOLA 3KVDD 4O49A 4AYMC 3PQUA 4O3WA
chains in the Genus database with same CATH superfamily
3MNZB 4RGNE 1VF5C 1QLFB 1NGXB 4LQ1A 4N1HB 2XXMB 3FTSA 4HMEA 2VCOA 4RBPK 4X2UA 1UACH 4EOWL 4PYGA 3KD4A 2YA0A 2V2TA 5C6TL 5J1AB 1AHWA 2OK0L 1ZHBB 3A4DA 3GDBA 4GBXB 4ICXA 1XGYL 5KJRH 4AV0A 1JF1A 2VXUH 2WJQA 5BJTA 5E7FA 4PJ5D 2GITA 1ZK5A 1N4XH 1KTDB 3GXIA 2BIIA 3VWKA 3Q13A 1RK0B 1FGVH 3MRHB 3LPFA 5SWQB 2FWOB 2J56A 1VIWA 3GNML 4XR8C 5FFOA 4PJFA 3NEXA 4P59L 3L7EA 4H26A 4AUYA 2J7LA 2Z64C 3MUGB 3ZXAC 5F6IC 3VWKC 4MHHG 2P5PA 3CXHK 2ZJSH 2YZ8A 3O6KH 3U46A 3MZTA 4TVPE 3GJEB 4LASH 5C07E 3RIFK 4IBYA 3FUIA 1UENA 2WYTA 2RQ8A 1MLCB 4UQAA 3JT2A 3SYAA 2OKMA 3O4LE 2V2TB 1KCRH 5JZ7C 5ICXB 1U4EA 1SLXA 4UINH 3RWCA 1GOGA 1XCQA 5DS8B 1DVUA 4Z76A 2WO3B 1U30A 4NO5A 1IGML 5D2LF 3ARDA 3QHFH 1J0ZA 1WC7A 4NM8L 3VWKB 2OV0A 2CGRL 5JDPA 1MVFA 3H56A 5SWSA 3MRRA 3ARDC 2EUZA 5C07B 4PJFB 3DOHA 3HPLA 3L7EB 4AI7A 4RETB 3RU8L 1PEWA 2D2CC 2NNXA 1OGAE 4L5FL 3V6OE 5FOBA 3AXHA 1KXQA 1T83A 1FFNB 4FA6A 1JPEA 3VFUA 4JAMA 2CDGA 4LK4A 2WIIB 3PABA 3P0YL 5D7KD 3VXRE 4YAQA 3K0WA 3WEOA 4TUUA 3WLWC 1QEWA 3ABGA 1T83C 3I6GB 2EIZA 3T6WA 3ROLA 3WJMB 3RWCB 3CFJA 4MRBA 1HXYA 4TQ8A 3TCXA 3QUXA 2XYBA 3S34L 3NP3A 5G4OA 3ARDB 1FBIL 4GAGL 1OWRM 3K19A 4EF3A 2WWMD 3FUNA 4KWUA 4RFNC 2CGZA 1GGYA 2X12A 4U6XA 3CMOL 4ZNEA 3TEWA 5SWSB 2HG5B 1PLGH 3FOMA 3L4YA 4G7VL 3TJPA 3UEQA 3VXRB 3AG3B 3BVUA 3WFEL 4M9OA 4IOFC 1OP3K 2I9TB 1N59A 1P84J 5HGDB 4GG6E 4ZS7H 3ZZSA 2CDGB 2ITDA 1LD9A 3PABB 2O6CA 5AKRA 1EJFA 3CZSA 1BREA 4E1TA 5GGUB 3C75A 3FUHA 4FNTA 4KOCA 2EIZB 3ULVH 2DD8H 2P44B 2FO4B 4PBVC 1ET8A 3CFJB 3G3LA 1MCRA 3HOLA 5H37A 3DBSA 2FGRA 3DJZA 4TNWF 1KYOK 4AE0A 4MJ6A 1TXKA 1F6LL 1DSFL 4QO1B 4GG6B 4UILL 1XEUA 3LMJL 3H3PL 5A40E 1U8MA 2WD0A 1BEYL 3WKYA 3E3QE 2QFRA 3Q7JA 4L0PB 1N59B 2WVUA 4HZAA 4BZ2H 5BV7C 5E8NB 1HL4A 1H3VA 2FBRA 3SJVA 1LD9B 4KI5E 2BHUA 3L3DA 3SYBA 3KW7A 1UHVA 4LSDA 4F58L 2ERVA 4FQQB 1JHLL 5CJBA 4AFKA 3H6AA 1XH1A 3MXWH 1BZDA 4M61A 4NNPH 5C3LD 2XTSA 1HHIA 4GUPA 5JTWA 4HAKA 1XL4A 3KLAA 4ZOEA 4G80B 4QRQA 3Q1SL 4UNVA 1YNKL 1YMHA 3RLSA 5GSVA 4MJ6B 1HAWA 3U9PL 1LEKA 4LHJB 2DI7A 2FT6A 1M71B 3I85A 4FFTA 4KMTH 5TGBB 1ASOA 2QQNL 3UTQB 3WMSA 5BV7B 3IXAA 4L0YA 4WO4B 4PRNB 4DQOH 5SWZD 3QWOB 4OGXL 4Z95H 4IBUA 2VDKH 3EF4A 2LLGA 3X17A 4E1SA 1U42A 3W0WE 4ZAKD 3S37H 4UCFA 3ROOA 1L9OA 1HKLL 1LO4L 3ZOAA 2AI0L 3SJVB 4HK0B 2J12B 3X1FA 4Y0GA 2R2EB 3L3KB 3ESMA 4CW1B 2JKSA 5C86A 4M6ML 2O6EA 2WTRA 3L6FA 1PU0A 2XWBB 1ZT7A 2AJYL 3QJHA 5DVOA 1HH6B 4Z5RB 3ILQD 5SX4H 2V3EA 3BD3A 3VU1A 2EIDA 1OTTD 3DXAE 3ULSB 5J9PB 3LNIA 4G43B 1R47A 2P80A 5E08L 3MV8A 2ALAA 3O6MH 3KLAB 2UZYA 3O3EA 4QRQB 1BWWA 3W0WB 1YMHB 1WF5A 5HY9A 4ETYA 1N6QH 4WTWA 3HHMA 4GCSA 1LEKB 3RVVD 2EEFA 5FYKH 1B4TA 4LT7A 3ARRA 1E28B 2X9WA 3AB0C 2BW5A 3EBHA 1OAXH 2N56A 3BUIA 1OAUH 3CDFA 1PSKH 3PWPA 1CK0H 3THML 4QWWD 3BXNA 4RRPM 1BFSA 4GS7C 4BJLA 4ZTPL 1CXEA 4JM2A 5T1JA 1TQCC 3QO1B 3BJ91 4OGAD 2HZHA 4Q58C 1MWAH 5FFLA 1GYUA 1KYAA 3VMNA 1ZT7B 3QJHB 4WW1B 1MCHA 3WXVL 4JM2C 2NW2A 3H9HB 4LCIL 4QUOA 5EBLA 2YLHA 3IYLW 2F61A 1Z3GH 1MPAL 5F7EL 5FCSH 3V5HA 5IGXL 4P2QE 1MSPA 2UXFA 1HEZA 1U36A 2QADB 2UZYB 3L9BA 1EAPB 2W0FA 3GS7A 3LKQB 4Y4KD 4YIQA 4JCHA 1JZFA 3AB0B 1RJZA 2FHCA 4YEFA 5F89A 2Y4SA 1DBJL 1OAJA 2H6PA 4BE6A 4CKVX 4TVUA 2Y1AA 5INCA 3NCBB 4C69X 3BVDB 1WCQA 2DM3A 1TQCB 1ET5A 15C8H 4NWTH 1ORMA 4PS4H 3DWNA 2F74B 2DBLH 5ESVB 1OTUD 5CHNB 5DVKA 1KB5L 1BFVH 5I6XB 3LKRA 1B2WH 4JM2B 5E99H 4P2QB 3WUZA 4OUUB 3PRNA 1UVQB 1EXUB 5EIQA 1KJ2B 4I13B 5CJQH 3G5VA 3EJYC 3GI8L 2FCBA 4W1TA 1TQUA 2NW2B 3BC9A 4OT1L 5F44A 1AS6A 2APWA 4K71C 3K2IA 5FYLH 3K2MC 1UXLA 2IANA 4P2RA 3WY1A 4YIQB 2YKLL 5EHFA 1NEZB 4PY7A 4PRHA 5G39A 3QQ3A 4AQEB 5FYJH 1G9MH 2H6PB 4NDMB 4UTAH 2F19H 4ISVB 1RPQA 2KI6A 2XG5A 1N12A 1JD9A 4X9FA 4IRZH 5IJCC 4YFDB 5IJVA 3NJTA 1IVTA 5LBSL 2WAQA 3GZPA 1ADWA 3KH4A 5GISH 2JQMA 1PZBA 5JXED 1XZ0B 3FPXA 3MV9D 1QBMH 4IM8A 5HHXH 4FS0A 4Q7DA 4ZSOE 1N5YL 4JFOA 3UXFA 4APQB 4E5XG 2I26N 2OXGB 4HUVB 3NCXA 3Q8BA 5ERWA 4MMYB 1PKQE 4Q89A 1H6S1 2B1OA 5D5MA 4BHUI 4N8VA 1R0AH 2ZLDA 3MLZH 4W68A 4QT5B 5GGVY 5CN1A 4S0TD 1NBZB 1O7DE 1QRND 2DQMA 2WCSA 5L8LB 1JZIA 1DO6A 4PY7B 3KGTA 3SBQA 1PG7X 2EH8L 3H1ZA 3V7MA 3SE4A 1OM3H 3WUWB 2Q10A 3PJNA 4J8RB 3ZKND 4N90E 3H9SA 3MNDA 3ZUNC 1KGJA 2CKBA 2OMTA 5F72S 3DSFL 3GM0A 1ZLEA 4YE0A 1WDAA 4JQVA 4ZSOB 5D7LE 2HJKB 4ZUVA 2QJDA 4ZUWA 5ITFA 4YO0A 12E8L 1Y1DA 4X8JA 4NZTH 4Y4HB 3KNBA 1KGXA 1PKQB 3MLUL 5DD0L 3S35X 5H94B 5LGYA 1YG9A 1FNFA 5GRWA 4JQVC 2CM5A 4DGYL 2Y69B 4YHIB 3KYKL 3KYNA 3VNZA 1Z32X 2VH5L 2X27X 1R3JA 1WLHA 5JIHA 3WIIL 4DN4L 2XV6B 4DKAA 4L23A 2A6DB 5E1HB 3T6QC 2KZWA 4P4RA 2XG4B 1BQUA 5DD3H 1JF5A 3LQAH 2E4FA 3HE6A 3K1KC 1RUQH 2PWHA 3TCTA 3UJTL 3LZFL 2Z92A 2AZAA 2R83A 2A9ML 3VACA 4JG0H 1OGTA 3LQZB 5FKPB 3HE6C 3QJOA 1E9PB 5JXAH 4HCFA 1JZ5A 2QV4A 3NQKA 5CNHA 3OQRA 3K2KA 3AC0A 1XGRA 4R4NC 2UY7A 1FYTE 3BH8A 3O2VH 3GSQA 3IJEB 5E8OA 3EYVB 3WKQA 4FXLA 3ZR6A 5F7UA 4ZUWB 3TZVB 1QR1B 3KNBB 5GRVK 4NGHH 3FH7A 4KNUA 5HDWA 3UJIH 4GXUM 4EUPG 2FX9L 2YMOA 1WITA 3Q6GL 3QPXH 3CVHB 1QSZA 3I75B 1X9UA 4X0KB 1MCQA 2AEQL 3VFVB 1XSOA 3H8NA 3QQNA 1HVXA 1ZSDB 1PDKB 4J3XA 5FA4A 4JVUA 3WEXA 4P4RB 4OQ1A 3EJZD 3O6LH 1BQHB 1FYTB 4OFIA 1AIZA 2WXJA 3I50L 2M2DA 5KSBE 2A6IA 3CBJB 4P23D 4F8QA 3QUMH 5JW5A 1QOKA 3OJ2C 4LGPB 1ORQB 4MLIA 1Z9LA 1QX1A 3NCJH 1T04B 3VZWX 3O9WA 1NCBH 4XN1A 1HH9B 3RDJA 3SKOA 4XCNA 2HVBA 4R8WL 1INEH 2LU7A 3FTYA 1JGEA 4XMKL 5E8OB 3SQOL 3TNNA 3LNFA 2BVOB 2OTUA 2HTKD 4XPBH 3U0WH 3O9WC 2AV7A 4LGRB 5MEPB 3OZKA 5LG6A 3KPOB 1LMIA 3IBEA 2EO7A 1H8OA 4RAVB 4AGLA 1SOKA 2R8AA 5KSBB 1FL3B 1N0XH 5DMGC 3TA3B 3EFOA 1MFDH 1MI5E 2VDRH 1MHHA 5TFSL 3WEXB 5D7EA 1AJ7L 1FFOA 4Y8AA 3ISRA 2CRMA 1DJWA 2A73B 1T7ZA 3P4MB 3DSNA 3GSNL 1F4YH 5BO1H 5L2KA 5IVXF 2C26A 2EDJA 2XZQH 2YFNA 4EAEA 4NUMA 1L7IH 3QFJD 3CSTA 1YEHH 5E1GA 4XCNB 5DYFA 1JGEB 4JKPL 4U2YA 2BNRD 1A1MA 1R3HA 1MI5B 3LEYH 4EPSA 2VUKA 4D9QD 2OSLB 4TLTA 5LGHH 1FA4A 4UDUA 1MG2C 3W11D 1XR9A 3AA1A 1A6AA 5AW2B 3DTDA 1C5CL 3MTRA 1X5ZA 3PL6D 5F0MB 1TVDA 4POZD 1E6OH 2F68X 5C0DA 3VWJB 1MHHB 4WUKL 1RIUL 4H25B 3ILEA 2ICEB 2BDNH 5LNGA 1IC7L 3N40P 1EH9A 1RIHH 1JGUH 1QHQA 3DSNB 1BQ5A 4NNXA 5IQ9B 2KZKA 1S7VB 2VO8A 1I1AA 2JTDA 3G6JF 4U3XA 5E2WH 5L2KB 3WY2A 3FUJA 4G6MH 5JW4R 1OARH 4N25A 5CEZD 1KC5L 3NJNA 3CK0H 3S2CA 2R2HB 4P9HC 2NY3C 2HH0L 4JPIA 6CGTA 4QF1A 2V9TA 4UDUB 3NIGF 1WAEA 2CNZA 1XR9B 1KSRA 3AA1B 2FX7H 4DH2A 4E9SA 2YD0A 4HP5A 3SKJH 3QUYD 4XVJL 1DBKH 3HC2A 1HCFX 3P1VA 4JFEA 1R1CA 5D70L 2AQ3A 1IC1A 1G7JA 1UFUA 1V3MA 5CBAA 4ONHB 1BX2B 5KS9A 2NXYC 1NGQL 4F20A 1FCGA 2VMEA 2XPGA 3UYPB 4QHNB 4HJJL 4XVTL 1MIEL 5IB1A 5CGMA 2C1PB 2XETA 2YD1A 1E43A 1IILE 3IGAB 3HMXA 3LH8A 4ANVA 2VZVA 5DO8A 2NY3B 1UC6A 3QZNA 2V2WA 4Q4IA 2AQNA 3HUJA 3UACA 1R34A 4CAGA 4WEBL 3MRPA 5DJ2B 4DQAA 1Q9WA 5KVDE 1NAMB 4LE8A 5KG9A 4JPIB 3HZ3A 1G90A 2YGOA 3SDDA 3N85H 5KVFH 5D71H 2QTKA 4XVUD 5HJDA 4OCWL 4W9JC 1LO0L 2DLGA 4JFEB 3NIDE 1N7ML 3MGTA 2XE2A 3SDDC 3HBZA 4K5MA 4Y4FA 3SQRA 1TTBA 2B1HH 5CBAB 5J1TC 3V6FB 5EMYA 1JPTL 3KM1A 4I3RL 2XPGB 5IHLB 3IJHB 2IWGA 1G7MA 4R7VA 1OVZA 5EDXA 5KYNA 2C9SA 3STZA 1OSPH 2F7QA 4Y4FC 4XOCA 3X3FH 4GW4B 2XTLA 1MCWM 1BOGB 3KXFE 1DQQB 3TNMA 5TDOB 2BSED 2DQJL 3US1A 5EORL 3U36A 3C60D 1N8ZB 3LAFA 1L5GA 1RUPH 3MRPB 1UA3A 5EC2A 3TIEB 4JFFE 3NIDB 3OKKB 4TUOB 1H9VA 1KPVB 1BBDL 1FE8L 2R29H 3FUDA 1NM9A 3HKFA 1MJ7L 4ABVA 2E27L 1MW2A 4H2AA 3HOEA 3RVUC 2J73A 4UDTA 2A99A 2OR9L 4WSJA 4Z7VA 4PGCA 4N0YH 1F3DH 3GTTA 3UOAB 4WNJA 4Y4FB 2IBZY 5C08D 4TVPL 2QSCL 4LEXL 4M62H 5MEQB 1G7MB 1AI1H 3Q8CA 4P3DA 4NFCA 3STZB 1KLGA 4J27A 3WIFB 3TT1H 4JFFB 2Y0KA 5AUMA 1IL1A 2WXRA 3INUH 5MEOB 1MRCL 3OJMB 3QCTL 4N6QA 4YHKH 1PG7L 4R83A 4L29B 4MAZA 1ODUA 3S7GA 2Q0ZX 4JHUA 2PYFA 4K3DH 4NQEE 3IWVA 4QCIA 5T3XH 2WUCH 5AL8A 4LP4A 1FG2A 1NAKL 2ARJA 4Z7VB 2RH0A 4PJAE 1E8ZA 1HQ4A 2PWEA 3TWYA 4M5YL 1B4RA 1UJ3B 3S35L 3FU0A 4F7CA 4LCWA 4HS6A 1IFRA 4KHXL 3VG0L 4PJIE 3FQXB 2ZOOA 1LNUA 3UJJH 1KLGB 3WS3A 3E8VA 3RJQB 1KCKA 3TU6A 4G6AD 1KTRL 3FOLB 2J1YA 4GIAA 1BZ7A 3EJRA 4PJHF 3X11B 4C55A 1M56B 1I82A 1F97A 1OTSC 4NO3A 3DHJA 2JKTM 3QQXA 4NQEB 4OGZA 5A7EA 1NJ9A 1E2ZA 2H2SC 4NJAL 1UATA 4N0CC 5KYXA 4BH7A 4J3OH 4PJAB 3X12B 3RWEA 2EYSA 3QPQC 5K1JA 1KDIA 4UT9H 2HT2C 1QUPA 3JWDC 4WW2F 2AJ3B 1FSKC 3A6CL 4X6EA 4TUJA 1FG2B 2I32A 3SOBH 1F6AA 2ARJB 2TSAA 4MNQE 5DRNA 4JZOA 3V4VA 3VM5A 3S88L 4PBXA 4KKAC 4PB0L 5D1QA 5HI3C 2VDMH 4YE4L 5DS2A 3S3BB 1P4UA 3MRFA 4DO6A 3EJUA 3SZVA 2VL5B 4FXGA 2J6EH 2Y72A 4LCWB 2MKWA 2OJEB 1EVUA 2X7LA 5D1QC 3M8OL 4AUIA 1F11B 3SYCA 4JJ5B 5I16B 4LFHG 4XNMB 4ETQA 1CLZH 5A2JH 1IEHA 4YZWA 1XF4B 2JKWA 4FXGC 2K7QA 3SCMD 2I9LA 3VFWA 2A74B 1Q0XL 2FSEA 2IMMA 3HI1A 4WJG3 4JE0A 1YMME 4PJ7A 4OIFA 2VABB 5F6HJ 4MNQB 3OX8A 1CXIA 1HS6A 3SPGA 1JHKH 3PWLA 4LGSB 2OYMA 3QI9A 1E67A 3WI5A 3H42H 5CSGA 4A7TA 5EUOE 1QNIA 3V4VB 4LEOA 2WLYA 4NC0B 1IBYA 5D1QB 4M7LL 2R8SL 5BZDA 1SLVA 3QI9C 3VQLA 2JJTA 3MRFB 3PV6B 3G08B 1O6VA 4FNSA 4LLUA 2Z35B 4A66A 3IDYB 1YMMB 1HTYA 2CD0A 2NXZD 4N68A 1BD2E 1HDMA 2AVFA 2DB8A 2JJTC 4TOYH 3UBHA 1SJHB 2OK0H 2B2XL 1Z3RA 3HI1B 2M1KA 3ES6A 4MNGE 2Y2XA 4XOEA 4QHMA 4PG9A 3IMRA 1NCJA 5EUOB 1ZVYA 3HBGA 2AP2A 4EI6A 2K3TA 2WHVA 2W9DL 2MTPA 3B9DA 3CFDA 2QQKL 3P0VH 4IMLB 4EDXB 1D6VL 1EAOA 3FU7B 3QI9B 1E7VA 4RA3A 1FZMA 1S7SA 5MI0C 2GK2A 4U6VL 1MAMH 1BD2B 4WHTB 2B9AA 1GGBH 3CFTA 5GZOA 1J8KA 4WLCA 3PXLA 5BZDB 2IGLA 1NH6A 3BMWA 4MTMA 1H6FA 3NCYP 4MNGB 4U0QB 4XNBA 4CMHC 2CSPA 1PKOA 1SF5A 2WY3B 5GZOC 4K3EL 2E86A 3HMWL 4R97C 3LSOA 5DD5L 5KZCB 1R4XA 2Y6SC 5AYUL 4E0RA 2MCPL 4NRXA 2QR0B 3GKWL 4JCMA 1O6SA 4PLNC 4JHWL 4KKZA 2IPUK 4KX7A 5H2FO 5MI0B 4I5BB 4G6JL 1RK1A 2CAKA 4UB0H 4CBPA 1CWVA 5DQDL 1FQ9C 3MREA 1FZMB 4LRIA 2FZ3A 4LLVA 2Y06L 4CMHB 3GBDA 1JP5A 5IB2A 2KKQA 3VRIA 1NCAL 3AMKA 4TF4A 4MYWB 5E94A 5FWRA 3WENA 2NNFA 4R97B 4ZI8A 1DVZA 2MNUA 4F37K 4LRIC 5JHAA 3MJ6A 5FUZL 2BSDA 3WI4A 4WU7A 2W1NA 5ALBL 3G9AB 1BXXA 3HS0A 3LSOB 4C54A 2WJRA 3N1GC 2E0PA 4DGWC 1WCBB 2V33A 2VISA 5KBMA 2AQTA 1H15B 3WGVB 3S34H 1M2VA 4FZEL 1FBIH 2HKAA 1NDTA 2ZOWA 2PTTA 1J87A 4NERA 4P5TA 5K1VA 3V0VB 4HPYL 4QEGA 1PX8A 4XNLA 1KJ2L 4PG2A 1TEYA 1J88A 2HLEB 1RK1B 2OJZL 1NPNA 1ZJBA 3MLSL 4G7VH 4P5TC 5ANME 3WFEH 2NTFA 1WZMA 2D8KA 2FZ3B 4PG2C 4R7DA 5GGQL 3WLBA 5GGTA 5I8EB 3VRIB 5DD1L 1BVZA 1Z5HA 1SM3L 4DERA 2A6KB 3MO1B 4NFDA 4YK4C 2EACA 3RWIA 4N8UA 1USZA 1ETZA 2A2QT 1KIUA 2AV1B 2Y3AA 4WU7B 5CWSA 4N9GA 1AD9A 4FKEA 2FR4B 3BRDA 2QKSA 2AJSH 3BP7A 3N0PB 4D9LL 4XO5A 3RGVD 4DK3A 4K3JL 3AXIA 3FCSA 3RI5F 4NCDA 4OV6F 5ANMB 1Q8MA 4Q6KA 4YSPA 1M2VB 2KXPB 2ZUSA 2UUDK 4E68A 3U6RA 2PTTB 4P5TB 1WWBX 2PP8A 3PP4H 1PCXA 3CDZB 1DSFH 4UILH 3BLPX 3LMJH 3H3PH 1K9TA 5F7DA 3DKHA 3ZE0F 1TT6A 4PIBA 2IGFL 4A7QA 3RUGF 4AYFA 2BY3A 2LU5A 2O61A 3NSCA 4HUWB 1SOSA 4NS0A 3V5KB 3G7GA 3W5NA 3HRPA 4KI1A 4GAJH 2PPFA 3RWIB 4ZYKA 5CWSB 2Q8BL 4N9GB 4B9CA 4XVSH 4KY1H 2AS5M 4F7KA 3TBVA 1JPST 1JHLH 3T8VA 4UQCA 4BWTA 2JV6A 2JKRM 4FQ1H 5E6IB 2F8VA 3J27A 2CH8A 3L4VA 5F3HB 1QBLL 1RZJL 4HKJB 2ZKYA 4QOKE 4H0LC 2BVTA 3Q1SH 4ADIA 3BO8B 3U9PH 2CCVA 1AKJD 2XVBA 3CPUA 2EIEA 3IXTA 4ZOCA 1LEGB 2W88A 4DFIA 3ECUA 1G94A 3DX6A 4ODXB 5G4MA 1A6ZA 2CMRH 4A2FA 1KJMA 1YEWA 1ED3B 5D1XE 1LO4H 1HKLH 4G9FA 4JMNA 2O61B 5CUSL 1L7TL 1NKRA 1FIGH 1UM5H 1XGQB 3WTXA 1P0SE 4UM9A 1VADA 2VZSA 2ZYSA 3A4FA 4FFVD 4UV4L 3VXSA 1MZZA 4M6MH 2P26A 4QOKB 1J1XL 3S9DB 3VW3L 2ZYRA 3Q5TA 2YAMA 1XCTB 2BSBA 3CIAA 3D4YA 5FUOL 2MH4A 1BAFL 2CLZA 2CJ3A 3NK3A 5E08H 1S9KC 1JN6A 2BNUA 3EDKA 3OG6B 4GRWE 3E7JA 3CVHL 4KTDL 1IFHL 2JQAA 1TJMA 2DLIA 1E3XA 2J1WA 1ONQA 2Z7ZA 4PJXA 5LBGA 2EJ1A 2WLNA 3IXTB 3D4ZA 2W95A 1G7HA 3S4SG 2AHIA 1D7BA 4FYRA 4WV1B 3PHQB 4W81A 3D85D 5L6YL 3ZDZE 4A67A 1KJMB 3BFWA 5DMIH 4PGDB 3SHSA 4G9FB 2KS0A 2CO7A 3M17B 3MX0B 3EO0A 4GP8B 3N2JA 4HKXB 4QNPE 4ZTPH 5LQBL 3AM8A 1I1YA 1AD0B 3X14A 3ASNB 4GRWB 4MQTB 3VH8A 3VVVA 3C6SA 4PB9L 1C08B 4OQTL 3IGKA 3AM8C 5HYJA 4IOSA 4LCIH 5IROA 3RP1A 1CFTA 5F7EH 5IGXH 2BNUB 1SHMA 2G3XA 1M2OA 3NJJA 3QDMA 5HDQL 3K72A 5IROC 3FSOA 1DBJH 4AIZA 1UKSA 4L4VA 2H41A 4NBXB 1BIIA 3KWXA 1N67A 5DRZB 1FNSH 3V9EA 1XHHA 5K59E 1LP9E 4Y88A 2XE1A 2RB8A 4ZD3L 4L1LA 3EO0B 1YJDL 3ASWA 5FO7B 5FO8B 4WI7A 4XBGA 2Q9OA 5I1HL 1I1YB 3MRJB 1D5ZB 4JFDE 1YVLA 2Z34A 4UNIA 3H2PA 3DIVA 5HYJB 4WWNA 4OT1H 1XB6A 4JDZA 5JIKA 4Z7NE 1LDSA 3PWJA 4DGIL 4DW2L 3DO7A 2LHAA 3QDMB 3SKNB 1LP9B 2OW7A 5CP3A 1HZHL 1P4BL 2GABA 3MAWA 4HWEL 2C9UA 1A1OB 4FF9A 4G8FA 4B41A 3MR9A 2I85A 2MCAA 1BQRA 4ZXBA 5K9JL 2F7RA 4JFDB 3PP3K 2Y5QA 4XC1L 1VSCA 2QLYA 1JWUA 2BIHA 2VDPB 5LBSH 3NZUA 3GRWL 4ZXBC 3EGDA 4GMTL 4WFGE 5AVTB 4AL8H 2I27N 4NQDD 3VCLA 3FRPG 5AYQA 5CZVL 1E7UA 2VQ1A 2C3GA 4Y19A 1F4WL 3FO1A 1AYOA 3LDBC 3RJOA 4YDZA 1NPUA 4QRTA 3DO7B 4NBYB 3D3VA 4WWKA 3KWWA 2H1PL 1VFOA 3QJFA 1QLEH 4V2BA 3OAWA 4UQ3B 4WI0A 4G7SB 4MQXC 1UXSB 5J7CC 2VJXA 3GO1L 3NFPA 3TJEH 2PXYB 3DJTA 2UWEA 5E95B 3CFUA 3B8YA 3NESA 1NBYA 4WWKC 4Y8DC 3BEVA 5AW8B 3E9TA 4RX4A 3T6XA 4L1HA 3UH8A 4H0HB 3DSFH 5K93A 1A6WL 1AC6A 1YPZF 2EDOA 3C2AH 4MCYB 4OD3L 4BD4A 4Q97A 1JWUB 12E8H 3L1EA 4YEEA 4HEPG 3MLUH 2PCXA 4JRYD 2B59A 3ESPA 4ODUA 5DTFB 5IQ7L 3DHUA 4P9HL 4CU8A 1XGPA 3SDAD 3LDBB 2NT1A 5LO7A 4B9FA 3CN2A 4DGYH 3KYKH 2W59A 3VCLB 5IHZB 4EIZC 2VH5H 4Y16D 5J56B 3WIIH 5HHQA 1QO3A 1KXTB 3U0PA 1IQDB 3U9UA 1NAML 2P8MB 4N4YB 2P8PA 3FO1B 4O02B 3D25B 2HJLB 3UJTH 5JMRA 1AGEA 2QL1A 1TTAA 4DCQB 6FABL 3D3VB 1QFHA 1S9VB 1T21A 3KWWB 3D07A 2GIYA 5CLZA 5DLML 5J6GB 3S8WA 1M3JA 3VD9A 4PMEA 4W70A 2LU4A 4WGKA 4E9QA 2WLLB 2UWEB 1SMDA 3QZMA 3ZO9A 2R1YA 1T0NB 3UBFA 3IK2A 4OZHA 2OMZA 4MB1A 2XTJC 1NBYB 4F7EA 4YJZL 2Z93A 3BEVB 5H4ZA 4JNXA 2PF6A 3VGAC 4GH7B 5IB3B 5JNYB 4JO2L 1NIBA 3KLDA 3WNIA 3HB3D 2WXGA 1CGYA 2HTLD 2EVGA 5B8CB 1I1FA 1ZK9A 2WLHA 4J6IA 5B1CA 3UZVA 5CAYB 2VRKA 3Q6GH 1MFCH 2A9NL 1WS7A 1HE7A 1WAAE 1NEPA 2AEQH 2YD9A 4IBLT 4KY2A 4ZAKA 5HXMA 1WT5A 5D4QA 1QO3B 1QR4A 2CJTA 3UERA 4LVHC 5G26A 1CFVL 1DE4A 1YS5A 2H9GA 2IXQA 3C2SA 4ABQA 4XHJD 2XWEA 4HF5L 2WZPD 1AGEB 4JUSA 2XTJB 1WT5C 3EUDA 3I50H 1CT8A 3VMPA 1L6PA 5CP7B 2OR7A 2R1YB 2HFEA 2O93L 3VX0A 2OMZB 3D2UD 4G8EA 5ICYA 2F18A 2X88A 5ITBL 3SQOH 2OI9C 1CR9L 4UQ9A 3JTTA 1AFVL 3D0AA 4FAAB 3VNYA 5HHNB 4J3WA 5EO9B 5L4JA 2AAAA 1AKPA 3GBML 5E9DA 3WFHB 3GT6A 2KHAA 4PWFA 1KBPA 4N28A 4HULB 3B7SA 4X42A 3MOAL 5E5RB 1DQDH 3ZTJH 3NVQA 4Y5VB 4YVNA 1DE4B 2H9GB 2JQYA 3P3UA 1CFMA 1AJ7H 2C3HA 5C0CE 4ZO8A 1A4BA 4NXKA 5TDNA 5EN3A 3NJIA 2XJLA 4JZNA 1G9EA 4HHGA 4AKRA 1VFAA 4X4KA 1OQXA 1A7OL 3OXRB 3OAZH 3GSNH 5ID1B 3QCVL 5FK9B 5AW4B 2KL6A 4OIBA 3RBSA 4P9MH 2WVPA 3ATBA 5ICYB 3VFOA 3L3OA 4HMCA 4ZFQA 2CALA 2ZD0A 4JKPH 1DBBL 4JCLA 4KROC 3REVA 4XP5H 1J12A 5D7JC 3JBG7 4MWFB 1VGEL 1Z9SA 2Z8SA 4XNXH 5C0CB 3UZQB 5E9DB 1JK9A 1U8KB 5T3ZH 4I0KA 5FDWA 3VDCA 3ELAT 4ZS6C 4E2OA 1XTMA 1L3NA 4G7YH 3RGHA 2C9RA 2X4NB 2I25N 4BUQA 1RIUH 1Z1WA 3MFFA 2HLFD 4YSQA 3NDZE 5CIPA 3WTTA 4HJGB 4LBEA 1G1YA 4QRRD 4AKRB 1OSEA 4RLDA 3WTSA 3AWGA 3UG4A 4U3HA 5H4YA 4TQEL 5M7QA 5D7JB 3MRKB 4XZUB 5D7IF 1QJ9A 5TE4L 4Z7QF 1XL6A 2IWWA 5C0AD 3F85A 2YHGA 2IQ9L 1AZRA 1CFQB 5KSAD 4EQ3A 4PBDA 1SY6H 3IRZA 4CTDA 4HIJB 4I85A 1Z9SB 4OZGF 2FO1A 2LVCA 1X5YA 4OAWB 1DUZB 3VGHA 3RIKA 1OE2A 1JK9B 2Y07H 1I8LC 4X7DC 1Z9OA 2YMTA 4XVJH 5I74C 2YUVA 3QJZA 2Z8VC 4L4TA 5D70H 1XD1A 5CS7A 3MFFB 1HXUA 1KCLA 4GO8A 3QWRD 4FFZL 3V8CA 1MCCA 4LBEB 1ECYA 1PYWA 2X3BA 4P4KD 2VLRD 3JVFC 4XVTH 5DI8A 3DJSA 3U2JA 3UG3A 5KTEH 2YUZA 3ZPDA 3IDIB 5AWNH 5J13C 3QIUA 2PO6D 4NO0D 4BFBD 2G75B 3NFNB 1RLWA 4W4OA 3K71B 2NDGA 4OZFB 4WEBH 2KZ7A 4YGAB 2BWIA 2DTML 2RCSH 7CGTA 2V5MA 2ZXCA 1RURL 3OAZK 5I74B 2YA2A 5BZWB 4WWID 1L0YA 2YPKB 4W4OC 3CC5A 2CLRA 3HRZB 3NYKA 1LLAA 3N42B 2A4CA 2P43B 4Y2DA 4UIMA 4HD9A 5IUCA 1OPOA 3W9EB 2DW5A 5L7XL 4L4TB 1D5BB 2EUWA 3HR5A 1YEDA 4I3RH 5J13B 3SSGA 2NUTB 4LESA 4R5VA 1PYWB 3FMGL 4FHKA 3GB7A 1N68A 2GEEA 1U95B 3F5WA 2Q20A 2DQJH 1FC2D 4LOFA 5EORH 5KYWA 1Z9NA 2C7UA 3AWEA 4QXTA 3WD5H 6PCYA 4XH2B 1HXXA 2WKLA 3CH1A 1KLUA 1L3WA 3IJ9A 3D0LA 1BBDH 1FE8H 1UGKA 4ZJ9A 1S7WA 2WUBH 2HT4D 4QYOB 2E27H 4HMDA 4QHKI 1NCWL 4UIMB 4Z77A 1VENA 3T24A 2I7OA 4PW9A 4FRXA 1BVOA 3LIZL 2NW3B 1ZHXA 4GF4A 1S2EA 1SN0A 1TVHA 2Q86B 4KKLC 3TH2T 3HR5B 2J72A 1DVSA 8CGTA 1KWKA 4KXBA 4QRPA 2QSCH 4TVPH 3R7RA 4ACPA 4AEFA 4HJ1A 1V10A 1AGFB 1IARB 3NQIA 1OEZW 2Q76A 4PLJD 1BJ1H 4BXSV 5BS0A 5IV2B 1GS6X 1IM9B 3T6VA 2G2NA 3DX9A 4IBQA 3F5WB 4X8GA 3GP6A 2BHFA 3T0WA 4QXTB 1MRCH 4NKIH 1PZ5A 3SYPA 3QCTH 4UTBL 3BYYA 2OMNA 3V0FA 1FO0H 3QFDA 1KLUB 4KRPD 1PG7H 3HN5A 1HCYA 3EUUA 1CG9A 3D0LB 4M4PA 4XNYL 4DAGL 2M06A 3V8OA 3SDCB 5B3SB 4DO5A 1E9OB 4MB3A 3ZL2A 4DGVL 1J9TA 1ICTA 5PAZA 3KAAA 3ESNA 2EXWD 2Z7UA 2DDQH 4U4IA 4MNHB 3V4PH 4CDGC 4M5YH 3AAEB 3EH2A 1ZKAA 3U4BL 4JFTA 1TZHB 1HKFA 1OPGL 3PPSA 1MIML 3UC0L 4KHXH 3RX7A 3ZL4L 1LE5A 1I1CA 2XQYK 1XZWA 5J89A 5EZLA 4XPAL 2ZP9A 1VCAA 3GFUA 3TP4A 3FQNA 3RNQA 5F8QC 2F58H 3E0GA 4HIQA 3L95A 1ZWIB 3L4WA 1PEZA 4AM0Q 1FPTH 3BKYH 5L4MA 2AGJL 2NLJA 3OB0H 4U0RC 5SX5H 1JD7A 2QFPA 1UGNA 3CX2A 1CG9B 1IZNA 2DH3A 4K8RL 3PQYD 4U1KB 5GGSB 3A6CH 3UYRL 2IV8A 4PN6A 4P5RA 2BSCA 4JDVA 3GHBL 4QHLB 1KB9K 5IW3A 2J55A 3CDGA 1F90L 1FDLH 5E8EB 4YN3A 3S88H 3MUJA 2NY0B 2NYYD 1GVIA 5AD0A 3LKSB 3EJQA 4U05A 3WFCH 1JJUA 5C6WH 3E38A 1SUHA 4ZNCD 1FNAA 1YSOA 1LE5B 3ZQXA 1NUGA 3QULA 5EZLB 2LLNA 5EBWB 5DO2C 4BK5A 5BRZE 1K3IA 5T1KD 2BJMH 3KHOA 1I9JL 4WI3A 1Q0XH 1R3LA 2V17H 3MV01 2A5UA 2FWLB 3OXSB 2M26A 2X4TB 4I2XE 5EZOL 4BK5C 3PAZA 1IZNB 1FLTX 4HAGA 1BFOB 4L8BB 3HZVA 4YBHA 1HIML 3NJLA 1T1WB 2TAAA 2R9HD 3FT2B 4EQ2A 4ZUTA 3RWDA 2E46A 3TN0A 1FAIL 3D69B 5DSCA 2V3FA 4M7LH 5BRZB 1GRWA 2R8SH 3DX2A 4LSSL 1VKXA 5GJTH 3CFMA 3QEGH 1F5WA 4EXPX 3IJYA 3GGWB 2FEEL 2HN7B 3G5ZA 5DT1L 3TN0C 2L3BA 2JCCA 3B1TA 3D4CA 1MJUH 3S96A 5JOEA 2MQ3A 4I2XB 4EN3D 3QULB 3DETC 4LCCA 4I3GA 4LLDB 3QUZD 1XCWA 2F54E 2EZ0C 2N59A 4RMQA 3GHEH 3KPLA 1WFIA 2B2XH 2OXHA 4LCCC 3DWOX 4DTGL 2CHWA 4OLUL 4NAJA 4Z0XA 2XZZA 3QJXA 3ABMB 1NCNA 4DGUA 2W9DH 1J5IA 2GK0B 2BNQE 4J6RH 2QQKH 3TXAA 1D6VH 4FG4A 4H44C 1X7QA 4WIQA 2Y1ZA 2I60L 1Q94A 2E56A 3T4YB 5SX5K 4PJEA 1MREL 2CJUL 3FU6A 4U6VH 4ZMOA 2AJVL 2H4EA 4HJ0C 3MFGB 3FUEA 4JFBA 1OF2A 1K5NA 1VKXB 3QS3A 2WKOF 4R3SB 4ZFFB 5T5NF 1IFGA 2PUQT 3IJYB 2EE9A 2C9XA 1D5IL 2O5ZH 5DXWA 1I7UB 2HLAB 4Z3FA 2WXQA 2XBZA 2IO5A 4K3EH 3AS1A 3HMWH 4WVRA 1S7UA 5AYUH 2GSGB 2BNQB 3QQ9D 1SHXA 3SGDH 1D5XA 3D52A 1G7LA 3BE1H 3VZTX 5DWPA 3IJSB 4OLZL 1D3CA 1OP9A 2I07A 4PI0A 2W91A 4Z0XB 3ZE2E 1JYXA 5T1MA 1WVZA 4POYA 4XPGL 3QR0A 4F2MA 4DFHA 5I75C 4G6JH 4NP4L 3A21A 4IK7A 2QZQA 1FFPB 3WNKA 4BKTC 2JXMA 1VLXA 3FO0H 2ZONA 1EPFA 2LU3A 1ACYL 3BGMA 4PP1C 3RVTD 4AYNA 1OF2B 2NCEA 3BW9A 5HHOA 4ZMZA 5I18L 2BO0A 2WQRA 2P24B 4S2SA 5I0WA 4UYQA 4X4XA 3HTLX 1TCRA 4EXKA 1M9SA 4QLWA 2EDEA 2J88L 2NX5D 2G2RA 5ALBH 1EXGA 1S7UB 2GJ6E 4WFHE 3UMNA 1D5XB 1QP1A 3MLRH 3LCYA 1G7LB 2JJSA 2Q5BA 1JS4A 3DROA 5I75B 4FZEH 1U8PB 1JPGB 3C8DA 4F7PA 2YPLE 4HPYH 1WWWX 3ARFA 3EF7A 5T1MB 3AA0B 1NANI 2JJSC 1BVKA 3ML8A 4XXCA 2EDXA 1UCBL 2OJZH 3MLSH 4JG1L 2K78A 4PLKD 2DWYA 4HKZA 1G0YR 2Z91A 3ARFC 3MRLA 4UWQB 3E8UL 1ZDSA 3K3QA 4XGZB 2MNWA 2TRHA 4LSHA 1YDPB 5DD1H 3EXJA 3QEQD 3O11B 3VDAA 3N1PC 1SM3H 1J5HA 2H2PD 1P5VA 1XSKA 1OM9A 2CDFB 3SYSA 4PJCE 1JBJA 2RR3A 5FF6B 3US9A 1S7TA 2G2RB 3T3PE 2YPLB 4DWHA 5HHPA 4D9LH 2X1QA 5IMOA 1NPJA 4K3JH 2VDPL 1AP2A 3IDGA 1TZOA 5GRYA 1LL1A 3ET9F 5DA4A 4YDMA 4H20H 3FQUA 3BI9X 3ARFB 3KPRA 2XY2A 4U1SB 5AW3B 1BVKB 1CUOA 1EDHA 2EYRA 4K9EH 3BGFC 4OF7A 1H3TA 4Q9RH 1AO7D 3V2AR 2PPDA 4AQAA 1B0GA 2NY4B 4PJCB 1KIQA 4OFYA 3SKMA 5JR1L 1MLBA 4E9LA 3T3PB 1O6TA 1SZNA 4PV8A 3HWBA 2VR6A 2A77H 3CFBA 3ZDYF 2FGWL 3M1OA 5E2UL 1EJOH 2XACC 3LYRA 4DP1X 1P5VB 4G70B 4KO5A 1C7SA 3HNTL 3Q8FA 4X6DF 5DEFA 2OFQA 2Q8BH 4L3EA 4AITA 3QAZB 4YXHL 2KH2B 4X4YA 3QIWA 1I7ZA 2XYCA 2X2UA 1RHHB 4Y5XC 1H6UA 3EOTH 5DEGB 4NAMA 3A67L 1HL8A 2CIIA 3IDGB 3FF7A 2APSA 3BGFB 1QBLH 1RZJH 2VN7A 1DJYA 1NL0L 4J5VA 1BZQK 5IFHL 1OF0A 5DCCA 2EKSA 3IJ7A 1PD1A 1JHTA 3NG5A 3KPRB 4M3JA 3ME0A 5DURD 1A47A 3S3JA 3GBEA 3N3EA 4HHWA 2EYRB 4PRAA 4TQIA 5EH1A 2V4LA 4XB7A 1OZUA 3ZGHA 1JV2A 2DQHL 3AAZA 3AITA 3H55A 2V7HA 4GKZA 4O02L 3R0MA 4AQAB 1A4KA 4PRIA 3X1GA 1KIQB 4Z9KB 1OALA 2R1WA 3K6DA 3WTUA 4PV8B 5CUSH 4QRSB 1L7TH 2G5RA 2OMBA 3CFBB 4KKCC 3T2QA 4WKZA 4Y5XB 3IU4H 1J8HE 5I8OL 3BAJA 5K9OB 4UV4H 2R69L 2YQBA 2VLJD 1HI6B 5DEFB 4CGUB 1AQDA 4FQXA 1J1XH 3VW3H 3MGOB 3RG1C 3GTNA 5FUOH 3RKDC 3AABA 4HWNA 1L9MA 2QHLA 2Z0BA 5FHBL 1IC4H 4X99B 4JDTL 3L9EA 5DUJA 4AQ1A 3GSRA 4QQ1A 4KJQD 5J57B 3MOBL 2JKNA 3CVHH 2YSTA 1IFHH 2LTQC 3OKEB 1JHTB 3ME0B 2R15A 4F33B 4PRAB 4Y1SA 4AQ1C 1J8HB 3MRCB 1TU2B 2V7HB 3FB6B 4GKZB 2PCPB 1D9KD 4L3AA 5L6YH 2BRRH 5DC0A 1GMIA 1OAKL 5CGYD 4UZSA 5FLUA 4IBVA 3QIBB 2VW7A 5LQBH 3B43A 4ADJA 1UURA 3L3JA 4ZMXA 3WL9B 4KHTL 4UT6H 1AQDB 5CILL 3UG5A 2DWSA 2BSRB 4KXCA 5AB0A 3HAEA 5AVSB 4OQTH 2EUXA 1GPOH 5EBMA 3FT4A 3UTPE 2Q6WB 2Z0UA 3IE9A 1ZS8A 1OO2A 5I0YA 3K5RA 1SXSA 1WFJA 2AQPA 3AROA 2CHZA 1ZMYA 5EDSA 2K0LA 3MLVL 5I6PA 1OSZA 2YD4A 3ARED 3R1GL 4Z7UF 4G42B 5DFVD 3GQFA 2VLKE 4G71B 4NO2B 4WI6A 2BWQA 4FEIA 3IDNB 1ZVNA 1MF2L 5GS0C 1UT9A 3LB6D 4ZD3H 4FRWA 5AFUL 1ESOA 4XE0A 1XF3A 3ZHFA 3IAPA 4UANA 1YJDH 4FQ2H 3EBIA 4GSQA 4ENEC 2AQQA 4S11A 3OGCB 1LXMA 2KQNA 1IGFL 4MAYD 2W07B 1U8JA 1P5UB 1LE9B 2EDLA 4TUKH 4GO6B 4ANKA 2AABH 1XT5A 5F9WC 4HHAA 3F58H 1GW6A 1MCFA 2ZKHH 1EAJA 3CLFL 3FT4B 3POQA 1SEBA 2VLKB 4DGIH 4DW2H 4YHZL 3WTVA 1KTCA 4M8VA 1UWYA 3VSTA 3BZ4B 2EICA 5EZIL 3VQ1C 1H3PL 1HZHH 1P4BH 5T5NG 3M86A 3UPCA 4HWEH 1OLLA 4ZZFA 1M9WA 1KY6A 4PJGF 3ZTDC 4IGBB 4J7RA 5D2NA 2H8PB 5IHHA 5K9JH 3RZCD 3CFCL 4HGMA 4HXBL 4JR9H 4XC1H 1JTTA 2D9QB 1XX9C 3VUAA 1CI3M 2R7EA 3RVWD 1W6LA 3LKOA 5D2NC 2OW6A 3EMNX 4GMTH 5FGRA 4F8PA 4LLAA 5A2CA 4MA3A 1QSVA 5CZVH 2OL3A 4JK0D 1PNCA 1F4WH 1F6FB 2FBJH 3CZEA 3MRQA 3O3BB 1EEYB 1S6NA 3WEMA 1OOAA 2VQUA 4ZX6A 1EEZA 2H1PH 3ARYA 4MBOA 1CYXA 3SN6N 3IMUA 4KXAA 3WE1A 3GO1H 2YLKA 2YQGA 5AOLA 4DK5A 2AK4D 4PJ6A 1PPIA 2I7SA 5E24E 1IAOA 5D2NB 1O5DT 3O0LA 4Q6IA 4OD3H 5EULV 4O3WA 1R75A 5CD5C 5T5FL 5BO0D 3FUMA 1ZT1A 4O00A 3CFEA 2OMWB 1NLBL 2R7EB 4KVNH 1V7NL 4RA0C 5IQ7H 2VZ3A 4PTTA 4OV5B 2NDFA 4Q6IC 4WTQA 5FWQA 1EVTC 3L13A 3TS8A 4C56E 1BXVA 2YSSB 2Z7WA 2FUTA 2OL3B 2ZX6A 1ZE3C 2WLMA 3EGSB 1NAMH 4FNUA 5IF0A 1RZIB 3VI3A 4FG0A 1TJGL 2KDGA 3RHWK 6FABH 5DLMH 3QXVA 1T5XA 4KJYB 1QPPA 1S7XB 2A9AA 1MY7A 2P42B 2Q3ZA 3TVMA 4PJBF 5AW7B 1M1XB 3Q1EA 2WBKA 2AJZA 2F15A 4YFLF 2PYEA 1LK3L 3SY9A 4K5PA 3VY9X 1IAOB 2Z3FA 3MLTA 4U1GB 1EZSA 4BZ1A 4C56B 5GHWL 4MLSA 1Q0YL 2AZUA 3DJ9A 4MA1C 1GAFL 1ZT1B 3TVMC 3CFEB 5KVDH 4ORGB 3K46A 2WVVA 1KT2B 3BUPA 4GQRA 3ILPB 2IBBA 2A9NH 3TJHC 1SYSA 3SBWA 3O8XB 1NWOA 2Q7YB 2BS9A 4YGVA 4B50A 1AXTL 4ZOAA 5IF0B 3VI3B 3WO4C 1WFNA 5E70A 3SBWC 1M6OB 2IGTA 1NC4A 4LLWB 5BVJB 5IQOA 4ZMYA 1FIEA 4IIQC 2DRUA 2YAPA 4MA1B 3TVMB 2DN7A 4XTRD 1NFDE 3GDCA 5F7WC 2AJZB 3NCMA 3A23A 4I18A 4DN3L 1WSST 5ITBH 2J8UF 3CIQA 1AFVH 5F7FA 1K6QL 3L1GA 2HVKB 4JN1L 4U6YA 3B9KA 3A4AA 3QRLA 4JY4A 4I18C 4E9YA 1T1LA 1QBBA 5DUPH 1GZQA 3QZWA 1SYSB 1JDCA 4AYEC 3MOAH 3B9KC 1OGPA 5F97E 2WWOA 2L7JA 3O2WL 3OWEA 3D39A 4IIQB 1HOCB 4PFEA 3VFNB 1SRDA 3V5DA 1T66D 1NFDB 2B39A 1D6EA 1UD3A 1JAEA 1PZ3A 4PTUB 1NCHA 1A7OH 3P02A 3JV5A 3HG1D 1TZGL 4HEME 4GEJA 4PJDA 3V0IA 4Z7IA 1NMAL 3BT2L 3FT3A 3T2NH 3UDWA 2WBJB 4I18B 3QWQB 3OSKA 1VA9A 3SPVB 2CO4A 2F5BL 5HP5A 4G9DA 2GCYA 4JM4L 3O3UN 2ZKXA 4U6YB 1VGEH 2JI2A 3B9KB 4GSRA 4X5XA 3UDWC 5B4MD 5G2NA 5JDJA 1MQKL 3B2VL 3QZWB 2VKWA 3RX5A 1B3IA 3L5HA 4K7PX 4L05A 5KVEE 4NN7B 3CU1A 1OB0A 4JFXA 4U33A 3P9MB 1A1NA 1VFBA 2XOTA 3D39B 4NPJA 3V5DB 4CADA 1KENL 1FGNL 3S8FB 5H8DA 3VFRA 2FJFA 2QVIA 4OM1L 2OYLA 4ELMF 4ZMTA 1FNLA 1RVFL 4LKCA 3BOVA 2C4FT 4QGYA 4UQEA 4R2GD 1KCSL 4XPFH 3ZDZF 1TETL 3NJVA 3FT3B 1Y6KR 3M1BA 2X89A 3OHXB 4GW5A 4HCRH 2IQ9H 3HFMH 2DKUA 4FE9A 4GAYA 4NHUB 3B9AA 2F8OA 4PJ9D 5TQ2L 3WHXA 3HZKB 4JN2B 4QNPF 4WDIB 3VI4F 4IRJD 4RCAA 1K4DB 3BQUB 5HDOA 2CO6B 3ECBA 4JRXD 5DK2A 4ALAL 1JERA 2DYSB 1Q1JH 4N5EC 5C7XH 1XFPA 2IF7A 1URZA 1IGTB 4QHUB 3A5VA 1VFBB 1FFQA 3FJTA 3SOTA 3RFRA 3S36H 3Q6FB 1ZSHA 2VZOA 3D4GA 4JFHD 4P07A 2DMCA 5HHVL 3VFRB 5AG9A 1CICB 4NN5B 2VW4A 3NCWA 1R46A 1A9EA 3DRTB 4QKTA 2I5YL 5AOZA 2PR4H 3IDJB 3CSGA 2CIKA 4JW3A 4KV5E 1DVYA 2BY1A 3H3KA 4XX1G 3ULVC 1RURH 1Z7JA 1CD0A 4KDVA 4TL5A 1J0JA 2OCCB 3IU3A 3KPSD 32C2B 3ECBB 4EI5A 4D8PA 5L7XH 2YXFA 4XN4A 5E2TL 3L48A 5GIRA 3ERXA 5KJ7E 2HUHA 4Z7NF 3C5OA 3BFOA 4B95C 4EZJA 4BZ2A 4EI5C 1JFQH 3H6JA 2DQGL 1RK7A 1XGTB 2IH3B 3FMGH 4MAUL 5B3JE 4FTVD 4A2LA 1A9EB 3L3IA 3TEXA 4G6FB 5ID0B 2ICWJ 2FD6L 1CQKA 1MCSA 1U93A 5GZND 1I7TA 1JRHH 4FG6C 1ZTXH 1ZV2A 1A3LL 4NQCD 3RL1A 3EFFB 3MRGB 1DQVA 5EF3A 2FNBA 1LQBC 3BKCL 4MS8C 3BVWA 1GKOA 3W39A 3LH9A 3I6LD 1EHLL 2A1WL 2C8NA 1UT1A 4GKOA 4UQIM 4ERSL 4EI5B 2B16A 1A9BB 2YAOA 4TNEA 5E4EB 4O4YL 4D8PB 4PJ8D 4BQ8A 4LDCA 1M7DA 3LIZH 5DFWH 1TFHA 4ODWA 3B7YA 4MB5A 5FOJA 3AGWA 3DDGA 3GYRA 5JORB 3AMLA 1DJIA 5KEZA 2P5EA 3UTTA 4UAOC 4FQHB 3DUUB 2ZOLB 1RERA 2IWVA 1MAKA 1C7TA 5JW4Q 1I7TB 4S0SD 1MM5A 3DK0A 5J4MA 4GQQA 2IPTL 4UTBH 4W9GC 4OZIA 2XHNA 2BX5A 5DJXB 1ZHLB 5HHME 3VE0A 5IBLD 2BY2A 4I1NB 5DGRA 4EIUA 4GI9A 4UQDA 4XNYH 4DAGH 2IH1A 2NY6C 4U9CA 2ZUQB 4X9YA 2A0LC 4AKMA 2PMZA 2B4CL 1W91A 4YHML 5LAXA 3ARBB 5JOPD 1GGCL 1CZ8L 3H9YA 5EEUA 2GJZA 4Y7OC 4OBRA 2W60B 1FFTB 1MIMH 3UC0H 5FYKE 5EUKA 2AJUL 3ZL4H 3F00A 3QXDA 5HHMB 3FO2A 1U92B 3LXBA 2Z31D 1C16B 4XPAH 3DX4A 1A6TA 2EDMA 1JVKA 1MWAA 4NOFA 1COBA 5H2BA 4XCEB 5B38A 2XKNA 1JFHA 3P4OB 1HQRA 35C8L 3C09C 4LKXA 2NY6B 2VMFA 2OZ4H 1FL6A 1CIUA 2EDHA 2JH2A 2DYPB 3PFQA 3O3DA 3QH3A 3RJDA 1EEQA 2H0JA 3ZYZA 1J1OL 5AZUA 1DN2A 2IH1B 4K8RH 1P7QD 4O9HL 4ODVH 4OY9A 3T0AA 4BK8A 3DX8A 4M48L 5E1AB 2D7NA 3T0EA 3UYRH 1TKWA 4E9WA 3GHBH 1OLZA 1QSEE 2A4EA 3OHMB 2H1LM 3EADA 1YNTF 3M7OA 4MXQD 4M9PA 3VXMD 3MNWA 2FUQA 5JDSA 3T0EC 3PNWA 4V2CB 3G7TA 3Q3GB 4GP4B 4FP8L 5DJ6B 1EMTH 2IPKB 1T2QL 4HLZH 3C09B 4M5ZL 2CK0L 4C59B 5CN3A 4S1SL 4DZBA 4J12A 1DDTA 4JMXA 5HYEA 4N22A 1A6TB 2ATKA 2XVKA 4LIQE 5H2BB 3L2LA 2XKNB 3S0PA 1WEJH 2PN5A 3K6OA 4WEMB 4UAHA 1RPUA 4F2EA 1S9YB 1QSEB 4DVBA 4P2OB 5DK3A 4G8GD 1T7WA 4H4NA 5EZOH 4LOVA 2PW1B 2E75C 3QH3B 3SE9L 1WIUA 3GMOA 4KMLB 4LPXA 4AIOA 3POXA 1AYRA 2XKSA 1HIMH 3DX8B 1JXDA 1UXWB 5HDBE 4AGNA 2AXJA 4AC2A 1F1DA 4UTAA 4L8CA 3QISA 5H35A 1FAIH 2E8ZA 3E1ZA 3GSWB 4Z3JA 1GTNA 1A14L 2VSKB 4LSSH 4IRZA 5JDSB 3RIAF 1GOFA 1G9MC 2GI7A 5EOTB 1RKRA 4J23A 4C8XA 4BFGA 5DT1H 2R1XA 5LGKA 3FTWA 3RWFA 4WUUE 2LGNA 2N2LA 1W15A 2JB6A 4GMSL 5I23A 5IWLA 1QFWM 5DJAA 4TTDC 3N44F 2VLLA 5HDBB 2V5SA 1H3WM 4DTGH 3RX9A 3U83A 2D3NA 5IWLC 3MSPA 4AEIL 2HFGL 3JQOB 4LOUD 1JCKA 3GUTA 2EDQA 1KNOA 2K3HA 5JHDA 3HIZA 4EN2A 3ZVVA 2I60H 2GFBA 4P04A 4GBXD 1AGDA 1MREH 1FNGA 2CJUH 5H35B 2AJVH 4KJPD 4KK8C 4I89A 5CMAB 2ZTBA 1E42A 3KBHE 5D2LA 5T33L 2D3LA 3VXUA 4PJ5E 3S5ZA 1LEIB 2OP4H 3FU3A 3DTXA 5FA3A 2Q2EB 4IKKA 4K7PL 1SXZA 5FO9B 1TQTA 1PAMA 2EE0A 2JB6B 1NKOA 2ADJB 4LHUG 1JNJA 2AMUA 4U1LA 3RYMA 5IM7A 5ADOL 4W6XB 1OB1B 2WXNA 1MCPL 4FQCL 4NPKA 2VM9A 3DX1A 4MMZA 4HC1H 5C2BL 4GRWH 1PZCA 2XFGB 4XPGH 1XF2A 1EUTA 5F9JA 3LQAC 1VEMA 4PJ5B 5HI4C 4MMZC 2B1AL 1NFIA 2F7PA 3BPOC 3RTQA 2WTOA 1DN0B 3VXQA 1FNGB 2VE6A 1NUDA 4YOKA 3FTZA 1ACYH 1TJHH 2R51A 1F3JB 1A7QL 2WXOA 3LEVH 4QIRA 1X5LA 4F15B 5I18H 2OSYA 3GLEA 5D2LB 3RTQC 3DOSA 3VWKD 3VXUB 1DTUA 5F9OL 2APBA 4NUGL 3QHZL 5EN2A 1YNLL 1CDUA 3ARGA 1WH0A 5AAWA 4CGTA 4Z7OF 4E5XB 3NRFA 4JS7A 2AEWA 4U1LB 1F3RB 4GCPA 2V7NA 4HFWA 4JHAL 5EPMA 5IM7B 4B60A 3E1F1 3NZ8A 5HPMA 2IG2L 3ARGC 3MRDA 2CK2A 5AAWC 1LILA 4MMZB 4YDKL 1I7RB 3BPOB 5D7KE 4K3BA 1PIGA 3PS6A 4TM9A 4XBPA 5DJ0B 1P1ZA 4UT7L 5A2IH 3QUMA 4YHYB 4JG1H 1B0RA 3QHTC 5T1LA 1NFIB 4I77L 4JGJA 3NMEA 5LUMA 2ID5A 2VE6B 4LSRH 3ARDD 5KJ4A 1I8MA 5DJ8A 2WWMC 1WWAX 3DOSB 1S78C 3TL5A 3DK2A 5SWSD 1IAIM 5EN2B 3L4XA 3C6LA 3VXRD 3VAEA 1IBDA 5BW7C 1EZLA 4FFYH 1ITCA 4X5RA 4XI5D 3WLWD 2V7NB 4HFWB 4DT2A 4QRUA 1KGWA 4YSDA 2XIBA 4LAQL 3UYOD 3VFPB 3C6LC 4J3TA 1ODAA 3MRDB 1MUJA 4ZTEA 1YC7A 3NSYA 4BBWA 2P1YA 2X4SA 1PGRB 1SN2A 5IKCA 5J5EA 1MFAL 1P1ZB 2XN9E 3ISWA 1IX2A 2J44A 1T80A 3AG1B 4A7UA 3WNOA 4AXWB 4Z7WA 5E8PA 3HCVB 5T1LB 4Q8BA 1Y18A 3WJJA 1FRGL 3BDXA 3QUXD 4BXVA 2F2HA 4CSTA 3EKCA 3C5XA 4IKIA 3G04A 1QTPA 4E9TA 1B9KA 1P2CB 1GIGL 1MQ8A 4YWGL 1A4CA 2FGWH 5I17B 5E2UH 4ZQTA 1XVSA 4EUPB 3HNTH 4IOFD 5FGBC 3WJJC 4FXTA 1PD6A 1PJ9A 4YXHH 3C6LB 5HYQB 5J3HC 1ZS2A 3TO4A 5KN5B 3DMMA 2XN9B 1VAHA 1MDAA 3A67H 4RMWA 3S37X 2VDRB 3QRCA 4JPKL 3ZT5A 1NDGA 3MLXL 3S5LG 4OLXH 1NL0H 3LN4B 4BQBA 3TO4C 1AZZC 1MUJB 3DMMC 5IFHH 2VIRA 5IKCB 1RZGB 4R7NB 3MRBA 2BZ7A 2A9BA 3BT0A 3QB7C 3JV0A 4QXUL 3FTXA 5E8PB 4ZMQA 2EDBA 2DQHH 1M4KA 3QFGA 1RZKH 2B8OT 2HFFB 4N6RB 1C12A 1S46A 5ISZA 1BM3L 2XWZA 3QZPA 1EX0A 5ILTL 1RU9L 2E9WA 3G04B 1CDHA 1I9IL 4BCZA 1IKNA 4FXKA 4BUHA 5I8OH 5AG8A 2XFXA 2R69H 3BKJL 4KK6C 1X5KA 5K9KB 4AW4A 1IT9L 1KFAH 3DMMB 4NXSA 1ADQL 1IKNC 4FXKC 2YN3A 5SWZE 6PRNA 5C0BA 1WZ1L 2XE3A 1NIAA 2A9CA 3CSFA 1MVUB 2WV3A 2XIDA 3GS0A 1JDAA 3L3GB 4HUXB 3SJVD 1YUHB 3MOBH 5I1IL 4EN3A 2WN2A 4MD5A 3J2PA 4UOJA 2KZBA 2Y7OA 4WI2A 3GTVA 2R88A 4K5LA 5HDLA 4XXDA 1EEUA 4JLRA 2P5WA 4YHNB 1EAQA 1OAKH 1KV7A 3S3SA 1RIVH 4XP6L 1U8QA 3LZNA 1HHGB 1U3HA 2YAQA 3SGDI 5SWZB 5E5UB 1E5BA 3QUKA 2JMMA 4PWJA 3FFCA 3IFOA 4TNVK 3DVGB 3KJ6L 5A2KH 3QZBA 1Z9MA 1JI2A 1U8HA 2HRLA 5DD6A 2Z8RA 3EHBC 3FF8A 3PGSA 4QWWC 5DJCA 5KVFE 1ND0A 1IQWL 3TF7C 4GJTB 3P73A 3MLVH 3K4DA 1F45A 4QDGA 3R1GH 2WJ7A 3QRGH 4H8VA 4UQ2A 2YD3A 5HJ3A 3HHSB 2XJKA 2X4RA 1K4CA 1N64L 2BERA 2K4WA 4Y89A 3D87B 4MFHA 1MF2H 2RQEA 1PLBA 2FIRT 3AQZA 4NKOA 3KS0H 2P9RA 2H45A 1UACL 1U8QB 3MV8D 1W2KT 4PSRA 5F7HA 2R29A 1S9XA 2D0HA 4P99A 4KZEL 3C8KB 3NA4A 4NAQA 5HVHB 5I8KH 3CLFH 4N86A 2VXUL 5DD6B 1AR1C 2X0VA 1N4XL 4YHZH 1U2CA 3PWPD 1JI1A 1WTLA 4L8DA 1DL7L 3FQ2A 2DEXX 3TBYA 3IVKB 4MD4A 2BY0A 4HPOL 2ITFA 2IFFH 1H3PH 4JM2D 4Q0XL 5HYSG 5HJ3B 1IKOP 3MJ7A 1MRFL 3FL7A 1BP3B 1UB6B 5C0JB 1IGCL 3D48R 4BYHA 5E51A 4GI6A 2J57A 4C4KO 4LASL 5A2FA 2HAZA 1SMAA 1T4KB 3ZU8A 1HSBA 1WFOA 2BFVL 4FI7A 4MSWB 5KYUA 4AUJA 3T77A 3GINA 1DJZA 1PRNA 1MHEA 3TTSA 3HI5L 1KYDA 3VD1A 2IALA 1OP5K 2ATAA 1LK2A 2QPEB 3QHFL 5KVEL 2UX7A 2NRDA 4HG4K 2JK5A 2ZYIA 5DHXB 2DS4A 3NA9H 3ZE2F 3GEFA 4EKJA 5E4AA 3EJYD 3WMQA 1F8TH 1AAJA 4PR5B 4PS8A 4JO5A 1Q9KA 2AXWA 2EECA 2GT9A 4OFQA 3MV9E 1HSAB 4X6BB 5TPWH 3UAJA 4JO8A 2DICA 1I3VA 2XY1A 3BP4A 1L9SA 2VWEE 3OKDA 1CDGA 1Z5LA 1FJ1A 3MCKB 5T5FH 4F92B 1ZLUK 1W0YT 2IAND 4P2RD 3UAJC 1MFEL 1NLBH 1V7NH 2OM5A 2Y0LA 1QRNE 4PRHD 5DVPA 4UT9A 4KKBC 4OZFH 3CZFA 4ZOBA 3AW5A 4ZQKB 5E9AA 3ZKNC 2XZAL 4J3OC 1JUFB 5AFUK 4LP5A 1U8IA 3BYTA 4WSKA 3FAWA 3MV9B 4J2QA 1KPRA 3F05A 1TJGH 3FCTB 2E7BA 3V0WL 1KEGL 1Q9LA 4PREB 1PLGL 2J6EA 2DJSA 4N2MA 5E79O 2H26A 1E3FA 1Q9KB 4O2CA 3EOAA 2BSTA 4YVUA 1E6JL 1LK3H 4ZS7L 3E6FA 3BP4B 5FUCE 2CO3A 1VRSA 2CRYA 2VAAA 4MZ2A 2B20A 1Q0YH 1FJ1B 1AGBA 1GAFH 1XH3A 1QUNA 5PRNA 5AVUB 1CLCA 1IC0A 3K6NA 2G9HB 3NACL 4LDOB 3FO9A 4LF3A 5DC2A 3AS0A 3MJ8A 2YD8A 5CSZB 2CBPA 4YC2C 3H9SD 1AXTH 2ED9A 4XC3L 1U6AL 2VDMB 3QARA 1KPRB 4C4KT 1N0LA 2IIJA 2E76C 3OZ9L 5D5MF 1CYWA 1RJLA 2K45A 4KVCL 4EEEA 5I73C 1Q9LB 3LVEA 1GGIL 4Q9BA 4YSUA 4N8CL 1TYEB 2H26B 2WN3A 2XXFA 2HVJA 7PAZA 4I4WA 3EOAB 4WF7A 1SYVB 4PP2A 3TC9A 4BZ2L 5IT2L 4DN3H 4YDJA 4HWBL 1JWSB 2VAAB 3HE6D 2FSDA 3PGCA 1AGBB 1QUNB 4Y2OA 4S1RL 5AOMA 1CBVL 2BC4B 4JN1H 2UZPA 3CFNA 4R4ND 3S3DB 4YHPA 4PEEA 4LPVA 2L7QA 4LF3B 1CXLA 4XCFL 3ZSSA 3WYRA 4NNPL 3U4KA 3HLAA 4J1UB 1L9QA 5I73B 4HWZA 1MZYA 3O2WH 1SVZA 2ADFL 4NZUL 1IBGH 2J1ZA 4MKMA 1E90A 2H3XC 2HTKC 3RNKA 1GL4B 4OZ4A 4JRLA 4KMTL 4LPCA 2LAGB 2WJ5A 3SDXA 1E30A 4MXWL 4AOFA 3R19A 4DQOL 5IVXE 1R24A 2NYZA 1N5AA 4I4WB 3L1FA 4RFEA 1NMAH 4B9JA 1MRDL 3T1FA 1K3ZA 4U1IA 2YGQA 1TYRA 1W0WB 3DV4B 3NAAL 4NRYB 4JM4H 5ICZA 4AV4A 3O4OB 1QFUL 4YHPB 4B9KC 4MQ7B 1MQKH 3GF8A 3W9DB 1KBKA 1MNUL 1U3ZA 5H37G 4KRLB 3HLAB 2FHFA 3O9WD 4P46A 4FI8A 3WFDL 2ESVA 1JPFB 5IVXB 5LDUA 3QFJE 3UP1A 4DPBX 1UCTA 3VRLF 5T1DH 1KF9B 1N6QL 2BNRE 4IKLA 1KENH 5DMGD 4D7BA 4P46C 1I31A 4JFYB 5FYKL 2MMXA 3KBPA 1CDCA 2FWUA 3G6JE 3CN3A 3DBXB 3I3DA 1RVFH 1N5AB 4B7LA 5EU5A 1G7QB 1KCSH 3GSOA 3OKYA 1TETH 2GSIA 3T1FB 2R0LL 2BIOA 5MHSD 3KWTA 3MJ9L 4E41A 3NIGE 4DKFL 4XN2A 1NGYA 1EK3A 1B0WA 3QFJB 4XOBA 1LO2H 4FFWC 1P53A 1I8IA 4B7IA 3GZQA 4M8QB 3IFNL 5H37H 1P69B 2WGXA 3FUFA 4A7GF 4CUCA 5L2KD 5I1DA 1OIOA 1WFMA 4RAUA 2R4PA 2R2BB 4FNPA 1DVFA 2LT9A 4HUMB 4NUQA 5CEZE 4N75A 5DYOA 1MG3C 43C9B 4XO9A 2P28B 1A7NH 3BRZA 1X6NA 5HHVH 2NOYA 5C0GB 1CXKA 1DVFC 2DMBA 3TPUA 3GMMA 1WBXA 3NIGB 3WFZA 4NQXB 1PCSA 3FHAA 5EU5B 15C8L 2Y3NA 4NWTL 4LIQL 3GSOB 3SE8H 4IRSA 1JOIA 1GXEA 3ABZA 4MMXB 3IPEA 5JPNB 3OR6B 3VTMA 4CC4A 4F80A 1BFVL 3PAUA 4ANWA 4M7LT 1UOVA 2HX9A 2RFXA 2ZNXA 5E99L 4E41B 2A6JB 3C5JA 1JZ7A 3DVNB 3DJRA 4IRSC 1DJHA 1I85A 2B77A 2D03H 1W0VB 2KPNA 4FGMA 4G8IA 2BOCB 2YO3A 4KPHL 4CC4C 1BT9A 5JOFB 1MHCB 3L5WB 1BVNP 5I1DB 4V1DA 4HH9A 2YRBA 1I85C 1NCDH 4EBQH 3U30C 5JLZA 5DYOB 3G5YB 1ANUA 3HNVH 1IJ9A 1QA9A 5EU3B 5FYJL 1HEJC 3J7HA 4XO8A 2X10A 3OAYK 4XNQA 4UTAL 3A47A 4MAUH 4EIGB 4BQ6A 2F19L 3GMMB 4MD0B 2IH8A 2NXYD 2X9XA 1OD9A 3KZ8A 3QDJA 1XB3A 2NY1C 3GK8L 3HFFA 4JFED 1D5MA 3DX7A 4IRSB 2HFTA 2G5BA 1DLHA 2CHNA 1A3LH 1P84K 3FB5A 3L4ZA 3FT1A 1M7XA 1VGKB 3C5JB 3NEOA 3OVUB 4U4BA 3BKCH 5IW1A 1BBJA 1A8ZA 4OCMC 5JHBA 4QGTA 4GAFB 1EHLH 2A1WH 4PGBA 2WB7A 1ACCA 1YZZA 3LKPB 3IE4A 5KSUA 2YJQA 4ZW5A 1SJMA 4O4YH 4ORZC 1R0AL 5EB9A 3ARWA 4DKEH 4GKNB 2E4TA 1RXLA 2COVD 3DHMA 2HJFA 2XIIA 4XWOC 2D2OA 2NY1B 5KS9F 1OM3L 1RFDL 3SDDD 1WRFA 5ANHA 2NY2C 1N10A 3PWUA 2CM6A 4AH2A 3T2OA 1T0MB 2WXMA 4N2OA 1YO4A 4ZPVB 3QDJB 3MA7A 3RQ3A 3BH9A 3WHE0 2BVQA 2Y7NA 3DX7B 3RBGA 1O9WA 2IPTH 4Y4FD 2A7BA 2X5PA 3GZOA 3HUJF 3MV7A 3FB5B 4KZ0A 1THCA 5C08E 4IBWA 4X98B 5E00A 3QO0A 3C60B 5F1NB 5IW1B 4U2ZA 4AJWA 5C9JB 2BVPA 4NC1E 4LLQB 4CN1A 1SJXA 5KSUB 2CHDA 5F1KC 4YHMH 5HGHA 2MFNA 4PJHA 4QKXB 1B0IA 1DQJA 2NY2B 1GGCH 3CSPA 1CZ8H 1RMFH 5JHLL 3RVUD 3LJ3A 4EO5A 1ZA6B 2FYYA 2HJFB 3D08A 4IU2A 4JG0L 4BFNA 1P6AB 3PWNB 1T1XA 4PGJA 3VGBA 1CE6A 4WHCA 2R4LA 3O2VL 4OSUL 1BZ9B 4TPRL 4GOSA 4U3CA 1ID5I 4HD5A 3MA7B 3GPEA 35C8H 2BVQB 7PCYA 4F3FA 1KJ3L 1R3IL 2Y25A 1M7UA 2XWJB 4KRNA 2CLVA 3BPNC 1R5VB 4OJYA 2HRGA 4K7FA 1T6WA 2GTZA 3LRSA 2OMXA 4LLMA 3QO0B 5FGCE 1J1OH 1F1GA 2PPCA 5I6LA 4D7PA 3KH3A 1NMBL 4N8VG 1SMOA 3JV6A 3S4SA 4PCSA 4AQZA 4NQVA 3GRGA 3P77B 4DPRA 4ODSH 4DVRH 4P48A 5HGHB 2YD5A 4PJHB 3BZFB 4DEPC 4XODA 4ZMNA 3HPJA 2AQ1A 1KB5A 1T2QH 2B9BA 3MBEA 4JFQB 2KZ1B 2FLRT 3UU2A 2CK0H 3KEDA 2V0AA 4HPHA 3NCJL 1T1XB 5D8JL 4YPJA 1WZKA 1CE6B 3QORA 4MBRA 3NSJA 3ULUF 5FGCB 4WW2B 4JQIH 3MBEC 3DO3A 1CDBA 5L4FA 2C9VA 1NFAA 1NICA 3UROR 3QJUB 4XPBL 3D2TA 1QTSA 1R5IB 5F7LB 4BK4A 2W81C 1OAQH 4K7FB 4LDEB 3FQWB 5F1SA 3UTSA 2GTZB 3X1BA 4LCWD 4LLMB 3K6FA 5E6SB 1G7PA 2H2SD 3A6OA 2DWTA 1MFDL 4W9FC 5HGAB 4N0CD 3S4SB 2VDRL 5C09A 2E5EA 4D64A 1TZIA 4FMVA 2FVNA 5KUKA 4MCMA 3QPQD 3ARQA 2HT2D 5IOPB 1A14H 3HPJB 3BIBX 2DL2A 4JY6A 5LBSA 2CKBH 1F4YL 5BO1L 2XTQA 5I8CB 1H3UA 3LZQA 1INQB 5HI3D 1TTGA 1NDMB 1L7IL 4GMSH 4O3YA 1YEHL 1KG0A 4W93A 1MXDA 5FM4A 2VGLM 4AM0A 1OY3B 5JIDA 1D7DA 3LEYL 3PIQA 5D1QD 4E9RA 5LGHL 3REWA 2A83A 3TWCH 4AL8C 3SE6A 2ZXQA 2M07A 1IAMA 3I6KA 3WN5A 5KBNC 2ZAIA 3L4TA 3SCMB 2HFGH 4GINA 2LFGA 3DPDA 2W0LA 2E9IA 4WHYH 1E6OL 3AA6A 2J1NA 3WN5C 4J3SA 3MDJA 3QEHA 3WU2O 2WZAA 1RIHL 5T33H 4JY6B 1ZXQA 1JRHI 3WGUB 4BA8A 5E2WL 5CO1A 4RJWA 3LPGA 3QDGA 5GGSY 3ZRCC 3QI9D 1OARL 1QJ8A 5DL5A 1KG0B 4E9XA 2X05A 1G43A 3ARZA 3A2SX 1I9RL 1LHZA 5ADOH 2E8YA 3PIQB 1SXCA 3FSAA 4PCYA 3G6AA 1MCPH 4I9WD 2KDYA 3VO0A 4AYSA 2FX7L 3I6KB 5C2BH 2YJLA 3EYOA 4PJ7F 2BXYA 4MS6A 1QLEB 3S3CB 1JZ2A 2ADIA 4OB5L 2HX8A 3TBWB 4KXDA 3LK2A 3EO1A 3ZX1A 4CN6A 5KSVA 2PTUA 1J05B 5IEHB 1JE6A 5EO0A 1ZVSA 3QYCA 1PQZA 1A7QH 1OAYL 1J8SA 3ORJA 3K4ZA 3ZJAA 1O7VA 1S8DB 3Q48A 1MH5A 4LCYB 4MZ3A 3BIKA 4NI3A 4NUGH 3W82A 4DEUA 4DP7X 3QHZH 5BOPA 5CFAA 3KYAA 1BPVA 1BWMA 1YNLH 3TBSA 5A2AA 2XTRA 3FRPB 5JHMA 1NA8A 4A2DA 4AE1A 4JHAH 4HXAL 1E2VA 5GZOD 2IG2H 1KY7A 3CTTA 4M1CD 2N7SA 3F7YB 5KVFL 5EFIA 4ZFGL 3TT3L 4UT7H 3EJJX 5GSRA 3PLYA 3D12B 1WS8A 5EOCJ 3KPNB 2ADIB 3LD8B 2Y5EA 1XBDA 2YFOA 1CL7L 3BZ5A 3LK2B 3FSWA 5KSVB 4CDHA 2B1HL 5L4IA 5AOKA 2JJWA 2VN5A 4HV8A 3PQUA 4XWGH 1ZVSB 5CEXB 2GIMA 1HNFA 4X8CA 4YDNA 1NUNB 1SDDB 1XXFC 1G84A 3BIAX 3P40A 3VFSA 2OMUA 2VXVL 5B3JF 1FVCA 2L0DA 1G9HA 1KFGA 4A37A 3BPLC 4H5SA 2FIKB 1U91B 2J4UP 1H3GA 4PD4K 5A43C 2IAMA 5HYIA 2V5YA 1RJYA 4OUOA 3B9EA 1URIA 3FONA 3APFA 4LAQH 1DFXA 5E4OA 4AK1A 3CBKB 4W6YB 4G1MA 5ESAA 2DWDB 4P3CL 2IAMC 5A2BA 5EFIB 3FN9A 3INOA 1IM3B 5HJBA 4KUCD 5LGJA 3ZE0E 5GSRB 2F53A 5TQ0L 3EOBB 3GSNA 1A02N 4N0YL 4Y1AA 5DFTA 4AWJC 3B7UX 2YQ2A 5IUSA 4PRPA 3RUGE 1L4IA 4ZDHB 5ACZA 1S5IL 2ZXWB 3WY4A 4M62L 2JF1A 3JUYA 3WAKA 4P5TD 4YWGH 1AI1L 1E0OB 1SF3A 4NWUH 2V9QA 1SBSL 1FZOB 1FVCB 2ZG3A 3INUL 3QA3A 1U8OA 4FRTA 3DUSA 3JWNG 5IVZB 3GPSA 4AZ8A 4F7TB 3ZE0B 1K72A 4IOIB 2HYMA 3R4RA 4YHKL 5EU6A 1PJWA 3TYFB 2WSPA 4F7MA 3MLXH 4PU2A 2UZXB 3RUGB 5MENA 3VU2A 5C9KA 5JA8B 2OA9A 3RGVB 4YBLB 4C47A 4OCNC 2Q2LA 2WUCL 5EA0H 2FQFA 3D05A 4UI2A 2F53B 4QXUH 2HKHH 3DGCR 3F7KA 4KX9A 5E0FA 3N06B 4PRPB 1HHHB 4LSTH 1BM3H 1BV8A 3HMXH 4JVWA 1RU9H 4GT0A 4YS4A 2Y7QA 1I9IH 3KPQA 3UJJL 1JZDC 3UGUA 3VXPA 5ABZA 2XLLA 1UH2A 1T1YA 3GIVA 1E4HA 3BKJH 1FV1A 4BSVA 3ZLQC 3JWNH 1IT9H 1U8OB 1K2DA 5GS2D 1ADQH 2KLRA 1AXIB 2CGYA 1ZIBA 2E6JA 4DO4A 5E1QA 5EU6B 4HIEB 1WZ1H 4BFOA 4ENZA 2Y23A 2QMJA 4N0UE 4PRBA 5I1IH 1DDHA 1KYFA 2K9UA 4NKDA 4FFVC 1FCCA 3SOBL 4QOKD 4PPTA 3FQTB 2A9DA 3WNJA 1BQLH 1RP9A 2C1OB 5KAFO 5ES4B 1ZV5A 1WO2A 1AKJB 3MNMA 1LDPL 1YC8A 2ZOKB 3Q2VA 3KPQB 1A64A 5J1AA 1E4XL 3GIVB 1CLZL 3IDXL 3C08L 1BZEA 2WINA 1ZHBA 4N0UB 4WTZG 2JTYA 5KBPA 1K2DB 2QKIC 3JCUO 2XQYA 1T2XA 1ZGLP 5D4JA 1RQ5A 3BZDA 1NCGA 4A1RA 4G9FD 1KTDA 3RX8A 3U48A 1RK0A 1B6DA 5I30H 3MRHA 3F83A 3BRFA 4FQEA 4UM9D 1E5ZA 2RIKA 3MUGA 3VXSD 4RGNC 1UM6H 2G3MA 2GUOA 4LL1A 3SEPA 1N64H 2DLHA 3DURB 5EZPA 1XGUA 3ULUH 2XWRA 3GJEA 3F12A 4Z7AA 2EADA 1MLCA 1B90A 1XAKA 4YL4A 3WTWA 2OMFA 1JXFA 2QKIB 3IAGC 2V6HA 3D85B 1X7SA 3DHPA 4P5KB 5BNXD 5ICXA 2PW2A 1CLVA 4QD2E 4TOYL 2WINB 5DS8A 4KZEH 1C8QA 4RGOH 3GMLA 3P4NB 2P4AB 4NLAA 2ITCA 3O0RH 1YQ2A 2XKUA 1JWMB 3D8MA 4RGNB 3LNEA 2RBLA 3GBLA 1DL7H 3P0VL 5AYTA 5IBTH 3BD4A 3GMPA 2CG9X 5C07A 4HPOH 2K6WA 4Q0XH 5HVGB 5FHAH 1UQSA 1CLYL 5IB4A 1O7SA 1MAML 4K0OA 5FEBA 3O4LA 4PJXF 2GUOB 1MRFH 1FFNA 1GGBL 1XGUB 2X4OB 1CGVA 1IGCH 2D4FA 4XBEL 5HYJD 3MN8A 2WIIA 2XX1A 4IOSD 5IROD 1SDAB 2N0MA 3F12B 1B4JL 4IHOB 2V9RA 3HR6A 4AY0A 4CJ1A 4G75A 1C8PA 3QDMD 2ZKMX 3QW9A 4FSPA 1ML0A 3I6GA 3LTVA 2BFVH 3FTVA 3Q5OA 1FZKB 3WJMA 2PW2B 1L6XA 2P46B 5DRWB 4L4VD 1H0DB 3K80A 1DANT 3GMLB 3UTZB 1BF8A 3HI5H 2ERJC 3AT8A 2ITCB 1WICA 1OGAA 4K7PY 4YX2H 5KVEH 1I8KB 3V6OA 1W72B 2FE0A 4NZJA 4LVOC 1OE1A 1WP6A 3WG7B 4TNFA 2HG5A 3GMPB 4FG2A 4UB0L 1UD2A 3VXRA 2O6PA 4X9GA 3V6OC 3VFMA 1UQSB 5IB4B 3II1A 3O4LB 4NQDE 5HI5D 2I9TA 1ZDQA 4BSWB 5HGDA 1YPZE 2IMNA 3F7LA 5FPIA 2QV2A 4FHJA 3B2DC 4ZPTB 5GGUA 5HGGS 1FO0B 4F91B 1MFEH 2ERJB 1QFWL 3JTYA 2DH2A 2X70B 4FABH 2FO4A 3MYZA 4DP4X 4X5LA 4TYUA 2B14A 1GS8A 1E54A 1CLOL 5D1ZI 4LVOB 5FB8B 2XNAB 1MJJB 2XZAH 6TAAA 2J6WA 4GUOA 3B3IA 2EQDA 2VERA 4ZXBD 1NCCH 1OGAB 3F6LA 3V4PB 4NQDB 5CEZL 4K5OA 4W9IC 5AVXB 4QO1A 4GG6A 1YPZB 2ZFGA 5DUML 3V0WH 1KEGH 1YEJL 1IO4C 4XCYB 3BKML 4JRYE 3SDAC 3VFMB 1YN7B 4OD1H 2YUWA 2EUVA 2J2ZB 3LZOA 2YRLA 2AFNA 3BUQA 3FYXA 1HINH 1E6JH 2WQSA 4MQXD 3QSKB 4RMBA 4Y19D 5E8NA 4KK5C 3M07A 4MCNA 4W4NA 2Y24A 3LHPL 4HOMA 1KTLB 2G0KA 4KMQA 3D3VD 4RMVA 4JBSA 1YEKL 3NACH 4WWKD 3BH4A 3TEYA 1QQDB 4PRDB 5HVWA 4FQQA 4NRZB 2AJSL 4A6YB 3LV3B 4TTGA 3KYOB 1MWOA 1WTGT 4JRYB 5IMLB 3G6DH 1BG9A 4H0GA 4YSCA 3EBGA 3B3IB 4RX4D 3AT9A 4G80A 3SDAB 4XC3H 1U6AH 2VYRE 3PP4L 4Y16B 4UZGA 3OZ9H 3FHEA 3CHRA 4KTEH 1M71A 4KVCH 5TGBA 3UTQA 3E3QC 1GGIH 2WP3O 4MVBD 4N8CH 4L3CA 4WO4A 4PRNA 3QWOA 5A16B 4L9DA 3EYSL 5IT2H 3ZHKA 1HJBC 4KI5C 4HK0A 4WO4C 4HWBH 5D6DA 2R2EA 3L3KA 1MCBA 1VZGA 4CW1A 4GAJL 5IG7A 1XO8A 3IJ8A 2WAHA 4S1RH 1CBVH 3JWOL 2XTJD 1HYRC 1GFOA 4XVSL 4KY1L 1WA1X 4Z5RA 2XWBA 5D6DC 4XCFH 1HH6A 3N41F 3BDYL 5J9PA 5M94B 3IFLL 1NQBA 4JFZH 4FQ1L 3ULSA 4F5CE 2ZCLL 2MQCA 4G43A 3EDFA 5C97