4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant A10_001
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
3UAQA 3PQSA 4O49A 5T5FA 3PQUA 3HOEA 4O4UA 2W81C 2LFUA 3VE1A 4O3YA 4O3XB 2YPVA 4U9CA 4AYEC 4AYMC 4O3ZA 2W80C 4O4XA 4AYDC 2KC0A 4QQ1A 3KVDD 4AYNA 5EE2A 4O3WA 2KDYA 3VE2A 4Z3TA 3V8UA 3HOLA 4AYID 2Y7SA 1YS5A
chains in the Genus database with same CATH superfamily
5E2WL 2XE1A 1G7HB 2DMGA 3MV9A 3C75A 3H9ZA 3RVTD 2HJKB 5EZJB 4FFWC 1I8LA 5F3HA 3GZPA 5C6PB 1UFGA 2X2HA 4B9YA 5GZNC 1A6VL 4Y5VC 2ZT9C 3QNZA 1IB5A 5AW8B 5IVXB 4DPCX 2GI7A 3SE3A 3STZB 3VDBA 1CT8A 2P43B 3GB7B 5BNXD 1EHKB 4RFOL 2CU9A 1IM3B 2DTSA 4QT5B 5DQJB 6PCYA 4YHYC 2VISB 4AZLA 1I85A 2VE6B 1R47A 1J8SA 1L9TA 1WPCA 4HGKC 4JRXD 4YWGH 2YC1A 2NUTA 4IGBA 5EN2A 3H2WA 3GMRA 4I0PC 4ECNA 2XPGA 4DO4A 1ORSA 2QT6A 1U41A 4PM1A 4JM4L 5E5MA 5TISO 4Y4KD 4IBTA 2B2XH 1A7BA 3MRMA 3FUHA 2ZTBA 1C7SA 3U4KA 4XVSH 1PL3A 1BM7A 1ZHKB 1LO0L 1NWPA 3K0YA 4NWTL 2ESVB 4W9GC 4NQTA 4G7YL 4YDZA 1VADA 3WE1A 4N8UA 2WVVA 3AU1A 5T1MB 3F83A 2X5PA 1IEAA 2AQSA 2R1YA 2ED8A 4FL4B 1OSYA 2F53E 4KC3B 4B97A 3KNBB 1ZHZA 1OB0A 4HLEA 3BFWA 4FFTA 2CZNA 3EYSL 2B77A 3NJNA 1E40A 1MLBA 2F8XC 3N2JA 1MCJA 3RX7A 4A39A 1BG1A 3KPPA 3LKSB 4O2EA 4M1GH 3S97C 4N24A 5AOLA 3FFCD 2OKMA 4UQCA 4BFFA 2Q7NA 2FYVA 4ZFZA 1TQCB 4MHHI 5HHNB 4BK8A 1E28B 1CLYL 2GHWB 1B3IA 1CXEA 1BD2D 1IAIM 3GI8H 3GNMH 3HS0B 2NY2C 4JO4L 4WJKB 2X4QA 3L9YA 3P4NB 4IOSD 1I3RB 1E6JL 4PRNA 2YSTA 1EERB 2R2EA 5LN4A 1Y18B 3H42L 3Q2CA 1UM6L 5HY9A 1DLHB 3AUVA 4XMKL 1H3VA 2W94A 2Y0SA 3HNTL 3Q3GB 5EPMB 2NZ1A 1SHMA 2J8UB 5LJYH 1JV5B 2HT4C 2Q8AL 3WFEL 4ZO9A 4B9ZA 1OY3B 3UPRB 3AXIA 1LVEA 5H4YA 2WOBA 5D1XD 4LPUA 1OAXH 3ME0A 5FUOL 1G43A 3T6WA 5AB9A 4DK5A 2YPLD 3CQPA 4N58A 2BS9A 3GNML 3VFPB 3NPSC 3D1MC 5ESAA 5BUGA 3LXBA 2CLVA 3GRWL 1KIRB 3LEXA 1A3LH 1SJHA 1ETJA 1FSKB 5I0ZA 3VB8A 1SN2A 1RK0B 5JDPA 4JPWH 4LHQB 4XMKH 5E4AA 3N50A 4BSVA 2QSCL 3H8NA 2Q2LA 4HZAA 1GS6X 3RUGA 2Y1YA 1RJYB 2PCFA 3RLSA 3UYRH 5F9OH 3RAJH 2A74A 1VFOA 2WVUA 4U3HA 4DERA 1DJIA 2ITCB 3MLUH 2OTWB 3JV5A 3FQWB 4KRAA 5HYQA 1GCFA 1O6SA 3E8UL 4UILH 1IEHA 4HBCL 1USQA 2APSA 2NNAB 3DMMA 2R1WA 4DKEH 1FF5A 3ZE1F 1HQRB 4K3DH 4Y4FB 1Q1JH 5DJYA 4KPHL 4XP5L 4PRDB 1R5VA 3VRLE 2VGLM 3EYUL 2I07A 3SN6N 3WN5A 1Q0YL 3AXLB 2DD8L 3B37A 3JVGA 4EUPB 3UERA 5I8EB 2Y3AA 3RDTC 5HVHB 2CLZB 4LLDA 3H1ZA 5CN2A 2YMXH 4OLUL 2QLVB 2VC2L 2VXTH 1IM9D 2VDML 3N5AA 3HBGA 3FU6A 3O6FB 5C8JB 3E9TA 1G7PA 4K73A 3UP6A 4U1JA 3BQUA 4YOKA 3ZO9A 4AYFB 5KZCB 3BGAA 1KLGA 3T3PB 4U6XA 2QSTA 2BSBA 4JZOA 1PKQE 2W65B 4XGZA 5LBSL 4IDJL 4AQAB 4JO8A 2B1HL 2OJ1A 2HFFB 3GHPA 3MLVH 1X7SA 3BW9B 5GIRB 1K2DA 2C9PA 3UTTE 3GXFA 5I5MA 1I8MA 5J06A 2EABA 2VR7A 4HFWB 5IMMA 2EYTA 4DVRL 1TQUA 2OZ4A 4WW2F 4ZMZA 1BEYL 3U7AA 1M05A 1LHZA 1OV8A 3WKQA 1Y6NR 1T22A 2CSPA 1QYGL 3DTXB 5GJTL 5CD5C 3QYMA 2VITB 4L3CA 5I28A 4B7IA 3U4BH 4YIQA 2CCLA 5E94A 2JKRM 5FC9A 2ZP0T 1HKFA 3APDA 5GGTL 1QR1A 2WNXA 5LG1A 2CE6A 3QUMB 4YAQA 4PBWD 3S34L 2XVGA 2XG4B 3EBAA 4H8PA 4X5RA 5DK0A 4PJDE 1BVLB 4RRPA 3TN0D 1YY8B 2UZYA 1SOQA 3UPCA 1D6VL 2HVBA 1CURA 3U4EB 1E5YA 1LO5B 3TV8A 1Z3GL 4KHTL 2LFGA 3MA9L 5J3HC 4OIBA 3QPQD 1U58B 2AXJA 4BQBA 5AVYB 3MJ7B 4XXDB 5BVJB 1UCBL 4JRXB 2X4OB 1PSKH 4AYEC 2H1LM 5D71H 5A6MA 5KYYA 2PXYD 3B5TA 2WJ5A 2H9GA 5GRWA 5K1JA 1CR9H 4HH8A 3N85L 1NCHA 3O41B 3MUUA 4W4OC 3PPSA 3EBHA 2VO8A 2V9QA 4R0LB 5SWZA 1Y0LA 4ZDHA 5KG9B 1Q1PA 4HS3B 3DVIA 4FLOA 5JHAA 4NBZB 4R7NA 1P5VA 4F24A 3TZVA 3BQUD 1FYTD 3V0VB 1UB6B 4ZPTB 3DUUA 3REWB 2VJ8A 1IFGA 2AJSH 3MBWB 4PJGA 3WNNA 3TO4C 4YSOA 4CDHA 5HYQB 3IWUA 2X44D 4HV8A 4Y19D 3D4GA 2XQYG 1A7OH 3CDGA 1OD7A 4LSVH 3DOSA 1QRND 2PWDA 4Y2LA 3OMAB 4QY8B 2YKLL 2GVYA 3ARED 1B4JL 3Q9QA 4CN1A 2GW5A 1Z6JT 2VB5A 4AV0A 4KRMB 4E5XB 4N6QA 1YEHL 5TD4A 1MM4A 4JJHA 1NOAA 3WIHA 3A4EA 4FABH 1MIEL 1IZNA 3ILQD 2P28B 4BSJA 1R9FA 5I8EA 4A7UA 2XV6B 5EIVA 5E8OB 1MCEA 4YGVB 3CMOH 3L4WA 1B6UA 4ZS6C 3R1GL 1JF1B 2BY3A 5F7WC 4FZMA 2R4RL 4YNYA 2AZAA 4OFKA 3RBGA 3V5DA 1FL3A 4EDXB 2HA1A 4BQ9A 3CLFH 2KDYA 3BN3B 3DUSA 4PRNB 2DQTH 3IDNA 4XVJL 2IBGA 4XPAH 3CXFA 1E5BA 4NUQA 2Z0BA 2DOCA 4MJHA 5GZOA 3AS2A 2K4TA 4GO8A 1H6TA 5LBVA 2O6FA 4AEEA 5IBTH 3W39B 3DBXA 3CVHB 3RL2B 1R5IB 3BAIA 4YLCA 3UTPE 2XACC 2VO5A 3LKOA 5DZNA 1NBYB 4E42A 5BMFH 3PQYB 2ZLDA 1X44A 2JB6B 3BESR 1CIDA 2WINB 2YMTA 5F6HJ 1B0IA 1X5GA 3ARDD 4JO5A 3OMNB 4F5CA 5K9KA 4UBDD 5K59F 5JDSB 1JYXA 1BQSA 4J28A 2NW2B 5C7XH 2Z35A 1F0LA 3SKOB 3WY1A 4CJ0A 4OJFH 1XCQA 1QSZA 1ZHKA 1PYWB 2IWWA 5SWSE 3QUZC 3MFGB 4DUVA 3MV7D 4RBPK 1I3RA 1T89A 1IFHH 1JPSH 1SZNA 4GXVH 4L9DA 1S7WA 2J57A 3EFOB 4EF3A 2MHAA 5HJ3B 3ARDC 1BBJA 5H37A 1GZPA 4WI9A 4OD1L 5KBDA 5B4MD 3FSWA 1L9OA 1NPJA 5EU6A 3VWKD 3VFVA 1K4CA 4Z7WF 1IL1B 2XX0A 3GZKA 3IJSB 4N2FA 2A4EA 3V4LA 3BT0A 4UINL 3K2UL 1MFVA 1CZ8L 1BZQK 4PJ8C 2RQ8A 1YEFH 2HN7A 2IQ9H 5D72L 3TNNA 3LQMA 3QCVH 4L8SB 4PJFA 3ZHFA 1W72B 4XP4L 1RIVL 1HHGA 2FEEL 1URZA 1YAZA 3MJWA 4Y1AA 1M7UA 4YO0A 3F7YA 1TQVA 3EBGA 2APXA 3KXFA 4KKPA 4LRIA 4S1QH 2OMTA 4XE5B 2ENJA 4I13B 1G6RB 3WY3A 4ENZA 1X5JA 3FONA 4IDLA 5JIKA 3BKML 3F5WA 4OF0A 3QK0A 1PX8A 3I50L 4PRPE 4JGNA 1UZ8A 4PJGF 5T5NF 5AENA 4HKZA 1WHPA 5CJBA 4IOFC 3HC0B 3I02B 4I5BA 1R46A 3U83A 3Q8FA 4EE2A 5F71A 2GT9A 4HD5A 4MB3A 4Z76A 4GXUM 1RKRA 3KLAA 1KJVB 2KZ7B 1JERA 1MRCL 3JBG7 2H9GB 4LEOA 1JD9A 3O9WC 5I1LA 4L5FE 1EJOL 2CALA 1JZEA 1A3RL 4OKDA 4K9EH 2MQ3A 2F54A 4N2CA 4AMKH 4BGLA 1Q94A 4JUTA 1CE1L 4Z7VA 4F57L 3BAEL 3U4EA 1VDGA 1TJMA 2F9BT 4OUUA 4JFDE 4ELKA 2OL3A 3T1FA 4Y4KA 5F7KC 4YXLH 2OJZL 4X6CA 3BHBA 3VCLA 2DWEA 2J4WL 5E24E 4PJAF 4E5XA 1MRCH 5F7MC 3LXUX 5IOPB 3D3VE 2AEIT 3LIZL 5FPIA 3CUPB 3LRSA 1IQWL 3GBLA 1OANA 2W59A 4Y2OA 3SO3C 5EOQL 1LMKA 4X9BA 5LGJA 5GS0H 1HDMB 1TCMA 5GV0A 1UXSA 2D31A 4C56D 4QHNA 2IALB 4NQEA 3NAAH 4DN3L 3AY2A 3QJZA 3WEBA 2FZ3A 3WKML 5IEKA 1NGZB 2WXOA 1KYOK 2WLIA 2ZUXA 4O51A 5FK9A 1WEJH 4IHBA 1U3HC 5MEPA 3UAAA 2AAAA 3U0TB 1ACCA 5KVGE 1JVLA 3CDZA 1XF5A 3LX9A 4OAWA 3A6CH 1N9PA 3TFBA 3VYNA 1OQOA 1YNKH 3SY7A 2APVA 2IGFH 5EF3A 5EOCH 1XCTB 2YAFA 3OG4B 4S11A 3E3QC 2XTJE 1MHCA 4JFWA 4RGNE 1XTLA 5AW1B 4AUUA 2R4SL 5I5RA 2P49B 3Q8EA 3LH2H 3QO1A 1PG7L 4PGBB 4JFFA 3ZYZA 4GAJL 3T2QA 3EJZC 1S7UA 4QTHA 2CDFB 1PW3A 3P4MA 4FA6A 4MQXD 2Q5BA 3B3IA 5K5YA 3L3HA 4P04A 5TH2A 5J12B 2R0KL 3IEAA 1MN4A 4WUKL 2BINA 3QDMB 1K5NA 2ZXWB 5C09D 1SY6A 3QZBA 3QQ3A 1HQRA 2FJHA 1QR4A 3L3IB 2X53A 3JTSA 5DHYA 2R4SH 2V2WA 3LH2L 5GRUL 4OZGB 5AAMC 5KVFH 4J3UA 3CFJA 1DVTA 3GFUA 3NACH 2IANB 4G9FA 3L08A 2BVUA 1H3UA 3VRLF 1KV7A 2D7TL 1Y1DA 1FUNA 2ZPKH 4YR6A 2ZKYA 4TQ8A 2NTFA 2VRKA 3CUPA 3LRSB 1OSZA 1IKNC 2X4OA 1ZDSA 4PVBA 3QRGH 4Y16A 2XWTB 1KJ2A 1ZLWH 4GP8B 3C2AL 4X7EC 3TIEA 3U1SH 4B9CA 5DT1L 2C9VA 3PHAA 1KENH 3DA4A 3V9FA 4ABQA 1BYOA 4DEUA 1YY8A 2UZYB 1NGXA 4HJEA 2PN5A 2AJVL 4F9LC 3WL9B 2H0EA 1TETH 4GW5A 1PLCA 4IRSC 5C8JA 3QUMA 4YAQB 1DUYA 4XP1H 4JPKL 5DTFB 3R4DA 3KR3H 3DX7A 1KT2A 3O2DL 2AQ2A 4DUXA 4NAQA 4I77H 5EU4B 4PV1C 3FFDB 5EB9A 3ZQXA 3RTQC 3TESA 3LQAL 3IFLH 4Y8DC 3JV0A 2BSDA 1B88A 3H0TA 1HZLA 2D7OA 4Q9BA 4WO0A 1SXAA 1T2QL 5FHAH 3JV6B 3SSGA 3L7FA 4WI7A 3MRBB 3FH8A 3MRNB 1U33A 1FYTE 1GGTA 2IBBA 1EBAA 1E54A 3AMLA 3O3DA 1CL7H 2H0JA 4EZLA 5AOIA 5CEYA 1UZ8B 2AERT 4GYBA 2H47C 3TH4T 2NY6B 4P3WA 1VJSA 3RDTB 3ZTEA 5HVHC 3FUEA 2VQ1A 1HILA 2C7UB 1KTRL 3CZUB 3QWOA 5BRQA 1J8RA 1JNNH 3ULUC 4E41B 1INDH 4BIKA 1V10A 5IFAL 2IFGA 3LZRA 5HYEA 2IOMA 3AAAB 2VDKL 3OAYH 4BFRA 1QNZL 3ISRA 1CL7L 1GTNA 5FEBA 4RISH 1E2VA 3INUL 4JR9L 1E30A 1XH3B 4D5UA 2CKBL 4FYQA 3P1VA 4MD5A 3OLIA 1ADQL 2UVFA 2V9RA 3IFNL 4OU3A 3GMQB 3L3OA 1NL0L 2DL2A 3SDDC 4ODXB 2V0AA 2E27H 1VZGA 3BP4A 1A7QH 4RNRB 4BH7B 5I1AB 1YNLH 1XGRB 1W72H 4N9GB 2X42A 4IOIB 4KDTC 1LEIA 5EO0A 1FRGH 5CKGA 2JJTC 4MZ3A 1MRFH 2A74B 5D7LD 4HKBA 3UACA 4GINA 3KWUA 3HE6B 3OMIB 3N41F 1W8NA 2AXHA 1X3DA 1YG9A 4F7CB 2NW2A 1AXTL 1IT9H 4Y1AB 1H3PH 2P24A 4YHPB 3GSRA 3WUZA 1NCCL 4KHXH 3DDGA 2VLJB 5DD5H 2K3TA 1MKFA 3AUWB 1FE8H 2IDQA 2HLAB 3K0WA 1CBVH 1S9VA 1PEWA 2CWRA 3ZDXB 1AI1L 3GBDA 2ZXBA 5D7KD 4NJ9H 1QFWM 2FQDA 3QRLA 4C56B 2AJYL 3MRIB 3NDYE 1KJ3H 4HJUA 3VE0A 4ZS7L 1CLOL 1E9QA 1RHFA 4DESA 5EDXA 2UZXB 3QIBC 1R5IA 1XGYH 4WQOA 5EU6B 3V4VL 3AA1A 4MS8C 1FWXA 5LUMA 2A9NL 1RZ7H 5AZ2L 3DIFA 4NKMB 4XO5A 3AAZB 1DVYA 2NNRA 2H32B 1J9QA 4G5ZL 1EEYA 5E1HB 3ZE2E 2ZQKA 3T0EA 5I18L 5ABDE 4RGNC 5FUCE 5EIIA 3ALXA 4NERA 2C9RA 3RZWA 5IWLA 1EZVY 3FFDA 1JFQH 1UD3A 4WFHD 7PAZA 2DRUA 3SKOA 4IU2B 3UL4A 5GJSL 4EI6A 1A65A 4N68A 3ZTJG 4WFFE 3QWRD 4GKNA 4XP9H 5AVTB 4EOWL 1BAFH 2X05A 1Z7JA 4ISVA 4MMZA 3RFZB 4HDIB 4GFXA 4I1RA 1DSWA 3MKKA 5K9QG 1M6UA 3L4VA 4HJIA 4NXSA 1FV1A 1KIUA 2YAQA 1TVBA 3PU7A 4PRHA 1NBYA 4E42B 3ZR6A 2XMXA 1B4LA 1QBLL 2WUBH 3M17B 1U3JA 5ICXB 4GS7C 2P5WD 1EZUA 3V5HB 3DARA 2NTFB 4R26H 5GJSH 5IFHH 2CJUH 4UNVA 4JL2A 2EDMA 1IAOA 4OZGA 3LTVA 4S1SL 2OK0L 1KC5L 5CWSB 2CA3A 5IHZB 3WHXB 1RURL 3HAEA 3T71A 3RWIB 2XN2A 3V2AR 2I85A 4KKNA 3CXDH 3MCLL 1N64H 2CBTA 1OT4A 4PW3A 4ELMB 3BO8B 4OCMC 4A1RA 3NJHA 1MG3C 2QPSA 3FO0H 3QZWB 3HR6A 4HCGA 5JW3H 1UM4L 1E4HA 3M1BB 1NC2B 2BSCA 4KXBA 4OJCA 2QELA 4LGRB 4Z7UF 3O3EA 5C0AD 4XN2A 4OZIA 1I7ZA 3D69B 1AC0A 3SIKA 2QADB 2ZUQB 3MBEC 5ABZA 5DJ2A 4APQD 5EO1B 4PU2A 3UTZA 1WYJA 2CR0A 1JZ3A 3OJDB 4M8UA 5CBEA 2HLEB 3LDBB 3CSPA 3VXME 1WFTA 2QPUA 1QQDA 5IBUB 2BP8B 3N1PC 4JFPB 4DCQA 3GTNA 2G2NA 2CJTA 1G7JB 6CGTA 4KJPD 2PYEB 4MXVE 1KYFA 4XPHL 3UDWA 4FRWA 2OM5A 2WLIB 2PF6A 3HMXA 3QO0A 2VLLA 5JTWA 2CM6A 4ELME 1B2WH 4UUJA 3UJTH 4XNYH 3IFPB 2R0LL 5TPWL 4WTZA 3NSCA 5IG7B 2YEVB 4BYHA 1O7DE 1DLFH 5I74C 5B7FA 3PGUA 3FCSA 3BAKA 3HNTH 3KAAA 5F9JA 2XN9B 4PJBB 3D3VA 4X0KB 1BZOA 1FORL 3MN8A 5I6OA 2PXYB 1P7QA 1T2JA 5HDLA 3HJEA 3T0ED 3WJMB 4BE6A 5L2KB 1KN2H 5JHDB 2PP8A 2WWKO 2XETA 3U1QA 4N4YB 3AMKA 2YA0A 4YDIL 4L1BA 4FG6C 3TX4A 2VZSA 5KZCD 1K9TA 1MREL 4OUUB 5JHLA 3II1A 2ZONA 2YGQA 1DQTA 1CLCA 1HEHC 2AXFA 2GUOB 3GJFK 5BO1H 4NC1E 4NN5C 5DS8A 2DBLH 5IQ9B 3N44F 4V33A 2YWYA 3GXPA 2QSCH 2UUDH 2C1PB 3D0VB 4JKPL 3RA7H 2V4LA 3QQDA 4MZRA 4BXSV 2LU7A 3NPSB 4WW2A 3C60A 1EO8L 2WGXA 1VHPA 4ZUTA 2RACA 2VIRB 5DWPA 1I7RA 3QJOA 4Z3EA 1I9JL 2YN3A 1JGEA 3JWNE 1DVUA 2Q86A 1KBBA 4HJ1A 4D9RE 4MJ5B 2ARWA 1PMYA 2YQ3A 4JZNA 4LGPB 4B7LA 3QEHB 1AQKL 1WGVA 1YN7B 1IQDB 2FNBA 5FYLL 4Z7WB 3FUDA 2ZF8A 2RTTA 5IR1A 4DAGL 2H2PD 1HQ4A 1FFOB 1G7JA 2UWEA 3H6AA 3TA3D 1KIPA 2KMWA 2BIPA 3DNKA 5CINH 5AALA 3EO9H 5HHPB 2X89D 1T3FB 1TLKA 3QG7L 4PBXA 5KYXA 3FO9B 4ETQB 1W16A 3C08H 3X17A 2IQAB 3ASWA 2ERJC 4OZIE 1AHWA 3OHMB 2FSEA 3UIYA 3TXAA 1YECL 3PIQA 2LW3A 3KE0A 5L8JB 3OB8A 4H40A 5G4NA 3SPVA 3PGFH 1UZGA 3LNFA 4HA1A 1IV8A 3O6FC 4KO6A 5CJQH 4OI7A 4AFKA 4FOZA 3A24A 1KEGL 1IVTA 3QR2A 3Q6FA 2IDSA 2HKAA 4J3OC 3FU3A 3ARTA 3SE8L 4A2EA 2QQLL 3T0DA 3QDGB 1BYPA 2W9DH 5CCHE 1WUZA 3V95A 4Q9QH 4W6XB 1BHGA 1FLTX 2NXZC 3REVA 3E2HC 2MKLC 3VDAA 3UO8B 4OGQC 1NGPL 2WVTA 4X99B 4XE0A 4BCXA 2Q10A 1FZOA 3FTGA 2OULB 3N55A 5KS9A 2YXMA 4KJYB 4K5LA 1JZ6A 4NN6C 1JK8A 1WZMA 3DZMA 1MELA 3B2PA 1FFPB 1PZSA 4LVEA 5DUBB 3VG9B 1WIUA 1DJGA 2H2SD 3QCUH 4JO2L 4RIRA 4F37F 1F4WL 3L95A 1JUFB 3L45A 2WXPA 2PPDA 3H9SE 3MCYA 3L95B 4NQDE 1OGPA 4FTVB 1A7NL 2W38A 3ARFB 3B5GA 4FQLH 3P11L 3P3TA 1MWOA 2ZKHH 1OM3H 4Y2DD 4WFFD 1E9PB 1ACYL 4L8DA 5DK3A 4S1RH 5EORH 3K72B 1YN6B 4W9JC 3MUY1 3C5SB 4HUVA 3SZKC 4BELD 4JPQA 1DBBL 3MYZA 1R33A 4XRCA 4RBPH 2CHNA 1A6AA 1NPUA 5DEGB 1LEIB 2WLLA 5CJXC 5CGTA 1NCWH 5DEGA 3IPEA 1O5DT 1XFPA 1XD1A 4R4NC 3GP6A 3WIIL 2M83A 1UTDA 3SE4A 2HKFL 5JA8B 5T1JA 1E4XL 1RUAL 4POZC 4GG8B 5IV2B 1D5MB 3QAZB 4JNXA 1QHOA 1VF5C 3BRYA 3GHEH 1ZE3H 3NACL 4YPGA 1QEXA 3VD4A 4RGOH 3PHQA 4KH9A 1BA9A 1DEDA 3Q0HA 3K7UA 5D2NC 5H2BB 5DJCA 4F2EA 5A2FA 3VD9A 5FF6B 5D7SH 3UDWC 5FKPA 1SEBA 2A73A 1BECA 4HMEA 3P4OB 4CMHB 1VACB 1ND0A 3GO1H 4BCYA 1D2PA 4E5XG 3FU5A 2ZG3A 5EEUA 3D0AA 5PCYA 1MJ7L 5E1AB 1LDPL 1ZA6A 4HAFA 5F7YC 3B9EA 1F11B 3B83A 5E99L 4FZNA 1YMME 4KI5E 5ERWA 4L1HA 4WRLA 3VD0A 1NGQL 2NW3A 2CNZA 5I0DA 4LHJB 4PJIB 4YH6A 5D1ZD 5C3LD 1FNSL 1UT1A 3NZ8B 4HV8B 1GGIL 5FO8A 4Y9FA 4E68A 1G9MC 1PKOA 4KTDH 4TUUA 3K71A 2CDGA 1WVZA 3R06A 4BUQA 3FU7B 3CVCA 4BQ8A 4TTGA 1MQKL 3P0YH 4AGNA 3CSBA 2YPLB 3Q5TA 4M03A 3TJHC 2A9BA 4Z7AA 1W2KT 1DE4A 1WWWX 1MJ7H 1UH3A 3FQNB 3JVFC 5CF3A 2A77H 3EUDA 5AD0A 2XJLA 3LKPB 3WFCH 3LOWA 1X7QB 3W37A 4YXHH 4O58L 3O6MH 4ODUA 2VDOH 4W4NA 5AUMB 5IHUL 4PSRA 1A02N 2Y7QA 3HG1B 3PG2A 3CDYA 2XTLA 1DSYA 1FLRL 4OCRH 3QB7C 3JVGC 4CC4C 1IUZA 1A4KA 1R17A 3KWWA 4TSBL 1RSFA 3DLQR 3UP1A 1TEFA 3NZUA 1TJIL 1UUSA 1YUHA 2X88A 5CLTA 4JJOA 3PP3H 3WL9A 1BQRA 2GCYB 3QJQB 3WKYA 4FGMA 5FFLA 2R7EB 4YDVA 4K8RC 4APXB 2CIIB 1OO2A 1G6RL 5T1KB 1CE6B 1FFOA 4EIZC 1NCAL 2WCGA 1C9SA 2KZBA 3Q48A 3PQUA 1HSAA 5EBWA 3DI2B 4PG9B 3VMNA 4MJID 3I6GA 5GS1C 1P5UA 3G9AB 1T16A 1TJHL 2B9AA 4M5ZH 4TNWK 4B3EA 4RLDA 3WI4A 1OLLA 3W9DA 2FX7H 1NLDL 3FBKA 1DBML 4FYRA 2JI2A 4WI5A 5F1KC 4FFZL 4ADGA 4MJIB 3PDDA 1M1XB 5IG7A 3HG1E 3OQ3B 3O8XC 4HSAC 1L0XA 5CJ8A 5I19L 2CHDA 3QYNA 4O3WA 2E27L 4P23B 2P44B 1CTMA 2FJFB 5FO2A 1DFBH 3V5DB 4ABWA 1XEUA 5J11B 2OAAA 4G6FD 4HK3J 3B2UC 4G6AC 4GSRA 5D1QE 4DTGL 1DUYB 3LEYL 3WG7B 5DS8B 1TQTA 3H2QA 4AQAA 4P5MA 1EXUA 4QXTB 2GBAA 3KL3A 1K85A 3K2KA 3H2PA 4B95C 1KG0A 2MCPH 1RZGA 2IXQB 3MROA 3BZFA 3Q1SH 1U36A 4U6YB 5SWSA 1N67A 4N0CD 4G6KL 1AANA 3WJJA 1HCVA 3OLDA 1MWAL 1JPST 2JLPA 4FERA 1CBVL 3KYMB 4QY8A 1QFWH 1R3LA 2E59A 2YD7A 2ADYA 4QYOB 5C7ZA 1ROCA 4LLAA 1B9KA 5ESVB 2WSDA 3IU4H 1OTSD 2I07B 4HWBH 3M1OA 4I3RL 4B6ZA 1QZ1A 3A2SX 3S5ZA 2EDJA 3BDXA 3ET9F 4XO4A 4HUCA 1AYRA 5EU5B 5IHWA 1RU9L 4LKXA 1U8NB 4UM8B 4HX1A 1RUKL 1DCLA 1BX2A 1HH9A 5C09B 5BZDA 4HS8L 3RWIA 1PAMA 2VJ0A 1JNLH 4ZUSB 2NXYD 3MRHB 2AJXH 3AB0B 4G2AA 4WCYH 4XNXL 5L88L 2WMPA 2V8MA 1OTTC 5DJZA 1IAOB 1OAZH 2W0FB 1T0OA 2EE9A 1TVHB 4Z0XB 2NLJA 1QFWL 2Y5TA 3T4AB 4Z6AT 2CBPA 2ITCA 5AKRA 3CDFA 1CC3A 1TVDA 2QEJA 4JW3A 3C60B 3I84A 5DFWH 2WO4A 1UGKA 1KTLB 1J86A 3BC9A 1TYRA 4J3OD 3AU0A 4O49A 4PJ0O 2YXFA 2VDNB 3S3BB 2K45A 2YD4A 4XNQA 3ULVH 2E6JA 4S1DD 4J4PD 4OCXH 3DYMA 4PH8A 5DJAA 3VI3E 1JGUH 4MXVF 2IVFC 3BXNB 1QBLH 4H4NA 4K94L 3UG4A 3MV8B 4KMTL 5CIPA 4NFBA 4DWHA 4U1LB 2A2QT 3OWRA 2G2RB 2VC2B 3H9SD 5FYJL 2BHFA 4F8PA 4KUCD 3GMLB 3QJHA 1QFHA 2CXKA 2YMOA 2R2EB 1EFQA 4R6UA 4LOVA 1GOGA 5DO2D 1S7XA 1T4KA 4S1SH 3ULVD 1TCRA 3MV7B 3QZWG 3ULVL 2EUZA 2OK0H 1JMZA 3GQFA 5E79O 1SOSA 4MJJA 1PRNA 3AQYA 2CHWA 4Z9KB 4I5BB 2NXYC 4N1HB 2BNUB 4LFHD 5A1AA 3IJ8A 2C9AA 1GFOA 3CXDL 3EYFB 5CSZB 2VLJE 1MCIA 3HB3B 1FQ9C 1J8KA 4R7DA 3VE2A 1U8IB 4H25A 4A7SA 4ELDA 2EO7A 5D9SB 2PRNA 3UFIA 1KIUB 2BCKB 2BNQD 1OARL 2Y5EA 3A22A 2F53A 3G5WA 2V7HB 3WIFB 4FC3E 1VESA 1R1CA 5ACZB 4XNBA 5K1VA 4J39A 1GZHA 1P7HL 1W15A 4GW4A 1L9QA 3F7YB 1Q94B 2K6WA 5GHWL 5TE7L 4KKQA 4BFKA 3VWKC 4IS6A 4BUGA 1OIOA 5B7MA 5IMLA 4JM2F 1TSHA 1PDKB 1KEMH 2ATAA 1IBBA 3QGVA 3WFBL 1HHGB 3N41B 1KTDB 2ZOKB 2HUEA 4P2QA 5EH1A 5FA3B 1B0RA 5JHDD 5EZOL 2E46A 5IFJA 3MYJA 1ZE3C 3RYMA 5KN5B 1Z3RA 3QEQA 5E8PA 5C6WH 3RFRA 3AAEB 5KTEH 2GEQA 3O3BB 3S96B 2JMMA 1IAII 3L5IA 5BJTB 4XCCL 1Q9KB 5E7BA 1W0WB 3CZLA 4GG8A 5IV2A 3CHOA 4GIAA 4DN3H 1NUNB 2YJLA 5GRUH 1E9QB 3VGEA 3G5YA 1IGMH 2EILB 2H41A 5F93C 2VE6A 4XR8C 4N8VA 2ZWZA 3P2BA 2AQPA 4JQIL 3DWOX 3JUZA 3LRHA 4ZFOB 1OE2A 4O4YH 3UBXA 2OI9C 2YPKB 1E2ZA 3BP6A 5D5MF 4GRLB 3AACA 5DL6A 3LK3B 2VDRB 3C5ZC 5KTEL 3V0JA 4Q8BA 5EEZA 5AFUK 4A67A 4QRPD 4U6VL 3LS4L 4GT0A 4LCYA 4PWHA 1BFVL 1HSBA 2OTUB 4OKVB 4OD2A 2ID5A 1F13A 3NCYS 4NQDD 4FXKB 5JW4M 2ARJA 4XN4A 1UM5H 5D7EA 1RZ8A 4AIZB 1XGQB 3NJGA 1SHXA 2DBLL 4BFOA 4XBEL 4L23A 4EDWL 2LQRA 1QD0A 4R84A 3PL6A 3S3PA 3D0LA 2EDFA 1JK8B 2LOEA 3KCPB 4O02B 3O3DB 1EO8H 4JBSA 1TMCB 1YNTA 1MCPH 2EDDA 1ZOXA 3W0WE 2JQMA 5IM7B 5C0DA 2X9KA 2WXGA 3OTTA 1AOZA 2WLLB 1FO0B 3IAQA 4TUOA 3ZIYA 2KLSA 2JQAA 1I1AA 1RLWA 4UQ9A 4N8PA 4B3VA 3QIWA 2Y72A 2VLKB 4EDWH 2Z35B 3VFGL 4X6DE 3UYRL 2N1TE 2QHLA 3ZMRA 4JCHA 4NRZA 4QF1B 3WDJA 4UM9B 1HXTA 1WJ3A 5ESQA 3QRGL 2WKGA 3EO9L 3MLWH 4X8XA 4N2BA 1H19A 3D33A 3IM1A 4FD0A 1H0DA 1MFMA 4OLXL 2DBJA 2ICEB 1N6VA 2IO5A 2P5PA 3C08L 2R1YB 4QOKB 2FLMA 3QXVA 1FFPA 4R7DB 4QHLA 3U7WH 2O72A 2F68X 3P77B 3RWJB 4OQTH 1VAHA 1DQJA 2A83B 3MCKB 3KR3L 1NANI 2NY0B 5T5FL 3W0WB 4HIIA 4PRPD 3QZOA 4G8FA 4HXAL 4G72B 4WV1C 5DHXB 4EN2A 3N91A 5LN8A 4KJWC 1A64A 1G7QB 4MA7L 2HRHA 1LE5A 1PZ3A 4JZJB 4M7KH 5BRZD 2YMXL 4A2FA 2VC2H 3VJ6A 3PABB 1KEGH 4OB5H 3WAJA 2BC4B 1KN4H 5JIDA 2IPTL 3HUJA 4K3BA 1AKJB 2FAUA 2NXZB 4U1NB 4OLYH 4GF4A 1XH0A 4FQXB 4NM8H 1YMHA 1XH2A 3BKCL 3B8SA 4Q0XH 4GO9A 3ULSB 3HFMH 3STZA 3NMEA 1OQXA 5B1JA 2CDFA 1SVBA 3AM8A 3EFDH 3NFSH 3WNMA 2PPCA 2FSEB 4KZDH 4PGBA 2FX9H 3MNVB 5ADXL 4Y4HD 5IFAH 5IMKA 4CADA 1A0QL 3OHXC 2VT0A 3TJEH 3KPSE 4YDJB 1ECZA 2X1WL 2Y9RT 4PG2C 4CVZB 4JR9H 4K3GA 1RZJH 1RJZA 3DXAB 2YUWA 3ARPA 1NMAH 4FI7A 2E76C 1T7VA 3QHZL 3G7GA 4MB5A 1UKQA 1RP9A 4S1RL 2WBKA 5EORL 3CBJB 3K5SA 5FK9B 3DXAD 1UKTA 3U6XS 4NPJA 3DO4A 1TQSA 5DRXB 4N0YH 4YFLF 3TCXA 4BA0A 1K5NB 4PGJA 4Q6KA 5MENA 3FN3A 3NABL 2FHFA 1XGUB 5AAWC 4NUGH 2YNKA 2IH3A 2D4DA 1OCWL 3LNIA 3RDJA 4YGAB 3S36L 2GI0A 3QAZC 4PFEA 1A6ZA 2Z92A 2YARA 4W9EC 1VZIA 4PY8J 4JQVC 1BZ9B 3BP5A 2QVMA 2A6JB 3WIHL 1FFQA 2WJ7A 1E8WA 4HWBA 3IRPX 1YEKL 1KG0B 4HWEL 2BZ7A 4RGND 4BFGA 1AIFB 1OP5K 5JW5A 1W9XA 4P5SA 3SDCC 4OAWB 5DJ0B 2FJGA 1LDPH 1JZ5A 2WZAA 4OVVA 8FABB 1NEZB 5BVPL 3HVDA 4O51B 3GK8L 1YEGL 4BGDA 1A7OL 1UC6A 3R4RA 4GKZA 3FCBA 4X5QA 1Y6MR 2Z4QA 3QUXA 5DRWB 3IU3A 1P4LB 3SDAB 4E0RA 1NMBL 1PCXA 5F7NC 2XZAL 3T24A 4Q4EA 4MTMA 5BV7H 5AW2B 3GF8A 3T09A 2O5ZL 2Y4SA 1S5IL 1UJTA 2MTPA 5B39B 4FABL 1JFQL 1MUJB 2CAKA 4G8GE 4GQ9L 4YE4H 3LPPA 3QDMA 3RJOA 4ILDA 1TQBB 2VLRE 2XIDA 3FUJA 3GS7A 2P47B 3EFFA 4L4VB 4WEBL 1RV6X 3IJEB 1QQDB 4E9WA 5AL0A 4YWGL 4GRMB 3E1F1 3HE6D 3ZTJH 1MI5D 4JN1H 4JRXE 4Q6YA 3X3GH 4X42A 4HOZA 3BH8B 1MAML 2UX6A 3WFHB 4QGTA 3BZFB 1DL7L 5IZ7A 4LB8A 3BD5A 3I6KB 4B96A 2A6IB 4JKNA 2HRLA 1KJVA 3ECWA 3ME0B 1E4WH 3OAUH 4XWGL 1ZLWK 5EBGA 3T2LA 5HPMA 2CGRH 1L9RA 2PYEE 3QORD 1FVCA 1UA6L 5DVKA 5I24A 4IQHA 4XMZA 1OE3A 1JK9B 5JW4N 2J8UF 5L0QC 1XBDA 3O8XB 4FFZH 5I1IL 1U8QB 3Q7JA 2ZUVA 2X2JA 5IW6B 4NZUL 2HRPH 5B5EO 4NEHB 2XTJD 3ZKND 2K1MA 3RWGA 4L8CB 4J12A 1O75A 2CPCA 2ZP8A 3UIZA 4QNPF 4Z7UE 4HPHA 2D2OA 5I6LA 2AP2A 3TZGA 3KHOA 2LABA 2J6WA 5TF1L 3HZMA 3PUCA 1QNIA 4X6CB 3RY6A 2WCPA 4LOUD 5DO2C 4AJ0A 3G6AA 4FRTA 4R5TA 3UEQA 3DVGB 4JFDA 3PHQB 4KRLB 2DI9A 3A4FA 2C3WA 4EIUA 3G08B 5DD3L 2FBOJ 4ABUA 3BJ91 4M93C 4NO5B 5C07A 2OYLA 1M9WA 3ULUL 2AABL 3T2PA 2BC4A 3U48A 4PBDA 1FIGH 2W07B 2R0WL 4JQVA 5HVWA 4I3RH 1HU8A 3EJYD 5KAIO 5EIIB 2J88H 1T1XA 2R56L 4LO9A 3QNXB 4XC1L 1E3ZA 1ZLEA 2VERN 3AM8C 4JANB 5FYKD 4ZAKC 2NY4B 4FP8H 1ORSB 1A2YB 3CN4A 2Y23A 3L1FA 1D9KB 1QASA 3SJVB 5DZPA 4L3FA 4FA8A 3B7SA 2DWDA 4LLMB 3RZCD 3ZDWA 3GSXA 4L1DA 3FFCE 1GJIA 2KZKA 2YHGA 1EAPA 1RUMH 2Z7ZA 2TSBA 4D3CH 5BRZE 4QJ3B 1J5OL 4U05A 3BUTA 1HHKA 1V3JA 5G55A 1JUFA 4ZTOH 1CDCA 2ZOLA 5DZAA 3L48A 4FE9A 1LK3H 4FKHA 5EFIA 4X4XB 2P45B 2DLTA 3PWPE 1Q1JL 3QQ4B 4JGUA 3ABGA 3IWVA 4ZFGH 3DHUA 1MCCA 4KI5F 1NLBH 4N2DA 4QCIB 4UT7L 3PFUA 1HK6A 2KHAA 5D7KE 3UTSB 1TDQA 4GFTB 4W1TA 4H20H 4HJTA 4YE0A 4MMYA 1U3ZA 3VXQB 3ZRCC 4HOWA 5GGVL 5EO0B 3SB3A 1OZUA 3IGKA 4OZ4A 1Z9MA 1FFNA 3SJVE 1MEXL 1BFOA 5IY5B 3VSQA 2J2ZB 3V6BR 4AQ1C 2CCVA 4HWZA 3LNHA 4Q2ZB 4I0CC 3QZNA 1U8PB 3KCPA 4ZOEA 5I66A 1JPGB 1WICA 2J21A 1DBJH 3D07A 3P30H 1PQZA 2WP3O 5D6DC 2MHAB 5HJ3A 3L7FB 1DQIA 2BSSB 2KI6A 3ARBB 3II2A 1AQKH 5DRWA 5I74B 4ZK8A 5FYLH 4ELMF 4G76A 4FRXA 1BD2E 3HC3L 5DQ9B 2WBXA 3DPBB 4FQ1H 3B2UD 1BLIA 1SVCP 5C6TL 1T7ZA 4ORZC 2BDNL 5EC2A 2A4ZA 5D7JD 2IWEA 3DX7B 2HT3C 1E9PA 3BQVA 1Z9SA 3JWNC 2HTLD 3HEIB 3VFMB 4U6TA 2FJGB 3CHQA 1F4WH 3WCYA 3OF6D 3AS1A 5C0JB 2C8NA 3P9LB 2OMVA 2OMYA 4G9FE 4XH2B 3MQIA 2MQ0A 4TVPD 1SJEA 2Y5QA 4BDVB 3ZIMA 3RGVA 5C71A 5IJBC 5HJGA 3AITA 1TEYA 5C0AA 4YHKL 2L7UA 2C1OA 2XY1A 4ZXBA 4CNIB 2A6DA 4AKMA 3LZFH 4N0UB 2EXWD 3WNPA 5F8RC 1XD0A 1A6ZB 3L1GA 3Q8AA 2P3YA 4LSEA 3GMNA 3S96A 2VWEC 1F4HA 1P4LA 4WI8A 3U9PL 1FVDB 4WU7A 4QAWA 3IRCA 4D7BA 3FQRB 3VH8A 3HI6L 2V2XA 4Q9QL 5D93B 2AV7B 3FH7A 2FWUA 3ABMB 2YAMA 2CHXA 4XHJC 1RK1B 1AR1D 1PG7H 1HXYA 4U6HB 1DQVA 3T3ME 5IYUA 5IQ9A 3VDCA 4OSUL 3X14A 1KB3A 2R0ZH 4Q9CA 5C0AE 1DVFC 3FB8A 4BD4A 2PO6A 3WYRA 2BP8A 1LO0H 2PO6B 5AEAA 3D05A 4BZ1H 1IGIL 4NFCA 4J4PC 3M88A 3VMPA 3NIFB 1OCOB 5F3BB 1G7LA 2EIMB 2NCEA 3OQRA 3TBTB 1SXZA 3FQTA 4QMEA 3H9HB 4RZCA 4MS6A 2A9DA 1PD6A 3EOTL 4DGUA 1OOAA 3QIUB 4EUPH 3FUIA 3NA9H 3PWNB 4XNZC 5T5NG 2AMGA 3F04A 4FXLA 3NCBB 3NBNA 5HGGS 1TJXA 4F2ME 5E6ZA 4PRAB 1UB6A 4ZPTA 2PPEA 1AKJA 5CJOH 3RU8H 4KH2A 2NY5C 5D1QA 2W8CA 5ICZA 2BFVL 2A7BA 1IC4L 3E2HB 3N9GH 5CIPB 2IALA 4E9LA 4FAAB 5JPNA 2ESVD 3MRQA 3RGVD 4QRRB 1TQWA 3OKYA 4JFPA 3CMOL 4Y1SA 4DCQB 3DPDA 4M62H 3B2MA 2VDNH 3LVEA 5ECGA 3BVDB 3OZ9H 4JY5L 3RILA 3TU6A 4UQDA 2P5WE 1CWVA 3AG1B 4KMLB 1A14L 4TSAH 3U2SA 3CSYA 1VFMA 1N2RA 1B0GB 4K07A 1WIPA 5ILTL 4JHWL 4XMPH 2GUOA 3QQNA 5ID1B 4PP2B 4NNPH 2VXQH 1T2QH 5JO5A 3K6OA 4M8QB 2ORBH 1V7NH 2ICWI 4XPBL 3WXVH 1MJ8H 4MB4A 1CQYA 5DGQA 5C1MB 1ML0A 3NESA 2E4TA 1KBGH 3FTXA 4HCIA 3GJEA 1P53A 1D5BB 1YPZA 2DKMA 3JUYA 1D3CA 3ARUA 4QKTA 1YEDA 2DYSB 4M5ZL 4NSKB 4ZW7A 1WFOA 4O5LL 5BZDB 4N26A 4PSPA 4YBLC 4FNTA 4L18A 3JWDC 3HW9A 3VJ6B 1JHKH 2ROYA 1AXSB 2HKHH 3QG6A 4LL4A 1S8DB 3U82B 2YD3A 1T03L 1H3GA 4D9RD 2ZAHA 5I1GH 4GRLC 3IDMB 3ZW3A 4KVCH 1AD0B 3LRMA 4IMKA 4MVBD 3KPMB 1A8ZA 4GEIA 3ZYIA 5HYFA 2G75B 4B5ZA 4KUZH 4JFHE 3F62A 1XH1A 4ANKA 4WO4D 3DHPA 2VXQA 4GY4A 5F7BA 4DGYH 1ZV9A 3VXPA 4GBXD 3VQ1C 3LSOA 3Q1SL 5DUML 3BRDA 1LNUB 1KTKE 1QPXA 3EH5B 1A9VA 1R3IH 3PAVA 1DQKA 3RX8A 4BZ1A 4HCRH 2H1PL 4L4TA 1N0LA 2APWA 3OHXB 3GLEA 1K3ZA 5GRYA 4FEMA 4KQ4L 2W9EL 1DYZA 1AZNA 4GP4B 4Z7OB 1WA0X 5BQDA 1MZZA 4D9QE 1ZMYA 3BGMA 4NWUL 5HDWA 3TNNB 2JQYA 4GBXC 4LSSH 5E5MB 5LBSH 4JFSA 1BJ8A 4FN0A 4YSQA 2X40A 3PL6D 2BSSA 3ARBA 2R23A 2IADB 4HS8H 3HC2A 1G4MA 1CDUA 1GGCH 1I7TA 3OG6B 4FQXA 2ICWJ 3EDEA 5KOMC 4F9PA 5LGYA 5J6HB 4FTVD 1MH5B 4XCFH 3ZPDA 2CO7A 1CL7I 2I7SA 4LCCB 3VM5A 5B8CC 4N74A 2F7IA 5GS2D 2C1OB 1OT2A 3V6ZA 1G90A 4F15C 4XXWC 1NC4A 4QPEA 1P4BH 3GXNA 4XNDA 2RH0A 2WIIA 4G8FB 4DQAA 5MERB 3VXRE 2QR0B 2B9BA 5FIEA 1LP9E 2WXRA 1IBGH 2Q0ZX 1Q0EA 3E1ZA 1AFVH 1NEZG 1QRNE 2A9NH 4PCKA 1RZJC 3IS1X 1G5AA 3UGXA 5K9KB 2KC0A 4FNLH 4RWHA 3HE6A 2EKJA 5GGTA 4L8CA 5D1QC 1QLEB 4I3SL 2C5DC 3GZQA 1M2VA 2Z31A 3GUTB 2FLRT 3EW3B 1Q0XH 2YN5A 3THMH 5AD0B 5IQNA 4QHPA 5BVPH 4K9EL 4Z7NB 2FSDA 1K4CB 3ZDXF 3ZTNL 2J8UA 2FGQX 5F8QC 3GSXB 4AEFA 3CX2A 1AFVL 4P5RA 4NJAH 3TGXA 4CVXB 2X09A 3IBOA 5DC2A 4G8AC 3VGDA 1BM3L 2W80C 4C54A 3NSFA 3QDJB 4KROB 5IW1B 5I75B 4JANA 2BRQA 3MO1A 3GXUB 1OAZL 2VSDA 4MNHA 3ZE0F 4WEMB 1XMWA 2ENSA 2LT9A 3NQIA 4X9GA 3ZKMC 2EICA 1U30A 1HL5A 1W0VB 1EA9C 1HKLL 1PD0A 2WWMC 5E1AA 1UT9A 4P2YA 1EHLH 3RX5A 2HJLA 1LP9A 1USZA 2CUIA 1I4FB 1NJ9A 2IDCA 3OC8A 2BERA 4DGVL 4Z3FA 5B38B 2VN3A 4NOFA 3L5XH 4C56E 4JN1L 3NAAL 2NR6C 2UZIL 5DC0A 3HB3C 4NB7A 2X1XR 5T3XE 1AS6A 2PP7A 2WC7A 3NSXA 1MAMH 1B0GA 7TAAA 4ETYA 5H35A 3S37L 1D5MA 2E86A 3HMXH 1MF2H 3ERXA 3EYFA 4F91B 2ERJB 3ARGA 1U91B 3QQ9C 4L9LC 2NSXA 2QTVA 3HTLX 3CFBA 2IGFL 4AQEB 1DVFD 3S2CA 2QKIA 5HHOA 4FQIH 5F72S 4ACPA 4OLZH 2V37A 5E56A 3I74A 1FO0L 3OBAA 4Y4KC 3MRDB 4ODHH 4U4IA 5DS2A 4E9RA 2KPWA 1G9HA 3Q6FB 1YN6A 3EJPA 5CKAA 4J4PA 4NZUH 1U8NA 4EO5A 5HP5A 4IBUA 1J1XL 2LAGB 3RNQA 5I15H 1BQLH 2M1KA 4HT1H 4XVSL 1L5GA 3OZLA 4JDZA 1NBCA 4Y7OC 5IQOA 3NA4A 1FH5L 3MLZL 3RB7A 3BZ5A 3VXNB 5IWLC 1TO4A 4PJXE 5DI8A 3B7TA 2YLKA 2ESVE 3VGAC 1G7HA 4QNPE 2FGWH 1KBPA 5KVFL 3NCEB 4F9PC 3HOEA 1SUJA 3WN5C 2ZNWA 2ZUYA 2YGVA 3ARGC 2WN2A 1DLFL 3QPQC 4XCNB 2Z3FA 3P0VL 3PE9A 5I76A 4M1DH 5JQHC 1KNOB 4P9HH 1MHHB 1R3JA 4XPGL 4UIMA 5CXPA 1I3GH 4P9HC 1YN7A 3ARQA 1OAYH 3HE6C 4ALAH 1QR1B 5GQBA 3ULUH 4J2QA 1FH5H 2XFGB 3MLZH 5J4MA 4NQCE 1KBVA 1X5ZA 3KJ6H 5JQ6L 2R56H 4HX1B 3QEQE 5D4IA 4BKSC 1E6JH 1XAUA 2WLKA 3JV6A 4KV5E 1KTBA 3WTUA 2NRDA 3FQRA 4HUUA 2X4NA 3VH8B 3B2DC 1OSPL 3ZRFC 4KK8D 1NUFA 4ZT1A 4PPTA 5MP6L 3WHE1 5JORA 4JPKH 3P0VH 4HUWA 1TITA 3GWJA 3QFJD 1RAMA 2LU5A 3DC0A 4JQIA 4LQFL 5F7UA 1FYTB 2HUHA 5HJBA 4D3CL 1OAYL 4K55A 1OK0A 3KVDD 3D4ZA 4HMCA 4F80A 5CEZE 1M71A 2CIKA 1T1YA 2BIOA 3AT9A 4KXAA 4CVWA 1UCTA 1HXUA 4XH2A 4AI7A 1J7VR 2DLFH 3EF4A 3QJSB 1NCGA 3GRWH 4M1CC 1ACZA 4E41E 1EXUB 4AEIL 1PGRB 3V10A 4P23C 3EDKA 3G7TA 3KLQA 2F8OA 2I7OA 4HHGA 1A4KB 3KWWB 4JB9L 4IBSA 4LZKA 1IEBB 2XG5B 3S5LA 4EZJA 3HUJF 5G39A 4FCAA 5IBLC 4D8PA 2V2TB 2FRGP 2V2XB 4WUUA 5E6IB 3JCUO 3TURA 3CTTA 3OKLB 1IC7L 3KEDA 4LSRH 5CNHA 2E9WA 3WHE0 1PQZB 2DLFL 5FR3A 4OCLC 2XVBA 2GYSA 4BFIB 4KI5C 5IOPA 2E7HA 3OR7B 1NCDH 1C5DA 5D2LE 2VH5H 2PMZA 1KFGA 3EYUH 3PAYA 3PGFL 4U7SA 5JDJA 2D7MA 5KVDL 4PJIA 4NZTH 3TH2T 1WT5C 4OIIH 2BDNH 3IJHB 2ZF9A 1ZSHA 1HEZA 4QR7A 1IGCL 2JH2A 3RUGB 3MOBH 3UTSA 1OW0C 4LL9A 1BGXL 1JZ7A 4M93B 1UZ6F 4NBYB 4XPTH 1LP9B 1DJWA 1BWMA 3IF1B 2C9XA 1MPAL 1RMFL 2DWYA 2W9DL 4F20A 3TO4A 3CH1A 5I1DB 3FOLB 5CS7A 3UJTL 3X12B 5L4FA 4HLZH 4F5CE 2OSXA 4ZAKB 1F5WA 3GGWB 3MRLA 1T04A 4H44C 4WK4B 3WS6C 4G82A 5I1CH 1QSFA 2J56A 2ZAIA 4L3EB 4PTTA 2E6QA 2EDWA 3GSOA 2GAZA 4HFUH 1HNFA 4J3XA 1TLMA 5HD8C 3FFCB 1IAIH 1VZHA 6FABL 4FFWD 4N59A 1MCHA 1U4EA 3RB5A 1P1ZB 3BUIA 4DP1X 1TZOA 2E6PA 1F3DJ 4EN3B 1PX4A 4QWWC 1NKGA 1F56A 1MCNA 2XBZA 3LMJL 3VFUB 3ZE2B 2OLDA 4HPYL 1C08B 1LO4H 3SDCA 3ZY7A 5K69A 1RJYA 1WFUA 1P0SE 3E6FA 3V5HA 4PJ6A 5A16A 2Q7AA 1XGTA 1HSAB 2P1YA 3O3UN 5EBWB 5H94B 1G7IA 3GIZH 4BINA 3ZDZF 1ZSDA 4HIPA 3LK3A 5DF0A 3FKUS 2AI0L 5IT2L 4KTEL 2K78A 1BJMA 4ZG1A 5ISZD 1ZGLB 1M42A 2YD0A 1TTBA 4JGJA 5LNGA 1QJ8A 4M5SA 4PMFA 2AEOA 2L4OA 4WDIB 3WO4C 3IJSA 3NJMA 4NQCA 4PJ5A 2ZXGA 3CMGA 3MHZA 2PWEA 1WWBX 2HX7A 4WV1B 3WDIA 5L8LB 4W9HC 3POCA 3ZMEA 4UDUA 3HG1A 4XCEB 2D4FA 4ZNCD 1IIIA 3C2SA 2FO8A 5KSUB 3OKKB 3V0GA 2CXGA 2QGEA 3ZGIA 1A6WH 2ITFA 3BKYH 3IFOB 3WN6A 1YYLH 4M5TA 4K8RL 3QDGA 4OIFA 2HSIA 3BP7B 4XC3H 1FC2D 1AXIB 5L4IA 3COOA 3N9GL 5F1NA 4JM2A 2QQNH 4I2XE 4CILA 4FESA 3SDAC 1KPUB 2GY5A 1AE6H 4LPCA 4K7FA 2OMXB 1RJCA 1T21A 4FSPA 4QKXB 3HRZA 2Z31B 5ECJE 3G9VA 4P8QA 5AWNL 8PAZA 4QO1B 3HRZB 3F2LA 1S7SA 2YKLH 4CU7A 1JTPA 2XBTA 4LPXA 4HWEH 3N04A 5DUBA 1WAAF 1TQBC 3GTTA 2C3GA 4AITA 2GJ6A 3V8OA 3UJJL 4KITB 3JYBA 1JD7A 3LZQA 3NJLA 4Z95H 5HGAB 1XF3B 3GLZA 4RDBA 3IDUA 3JWDH 3NN8B 2QR0A 1EO5A 4XAKE 2MCMA 1EZLA 3TYFB 4G8IA 4XOBA 1MIML 5KANI 3EFFB 3I9AA 3PP3K 2BRRL 5DEZA 3WEXB 4BUMX 4NI6A 3MBWA 4PJDA 3P4LA 1PLGL 2I9LB 5AKTA 5FYKH 4LRIC 5GS0D 3B6SA 5DJ6B 4GG6F 1MH5A 1CVRA 1SUHA 4JFOB 4KRNA 3SO5A 3SQOL 5F88A 3ES6A 3N1FC 4OBSA 3VYOA 1JPTL 3AROA 3MACL 5MEQA 2EH7L 2P8LB 5E23A 4HU2A 4YDLC 1IM3A 4NPYB 5IMOB 2XUWA 1AGFB 4ZUTB 2P8PA 3NRQA 2XWZA 4HKXA 4JFBA 4N8CH 4NQCD 2HLAA 1KULA 2RFXA 4PP2A 3QEQD 5E03A 1E8ZA 2VZTA 3L3KA 4CMMA 4CGUB 3QZPA 4AT6A 2DYPD 1V54B 4P3CH 5JHDE 2R89A 3U7YL 2BSTB 1AIFA 3SDCB 3FT3A 1DEEA 1RUPH 2NY5H 4UV7L 2F53B 2Z65C 5CCGE 4WTXA 4XPFL 2HZHA 3V4VB 2R27A 2ZUUA 3ASOB 3VFSB 3QJTB 3V0WL 3QEGL 4N5EC 1RI8A 5E4EC 3OWEA 3EGXA 5ICYA 5CSZA 3FMGL 3H7LA 4NWUH 4ZO7A 4DFIA 4F7MA 2BOBA 5DEJA 4A38A 3LVTA 4MMZC 2J88L 5EIIG 4Z8FH 4XBGB 1SM3H 2R23B 3O3BA 3IU3B 1ADQH 4RMVA 1HYSD 1M05B 2BXZA 5BO1L 4LLVB 1EEZA 3EH1A 3IMUA 3N1GC 1WS8A 3DHMA 2A0LC 4LCCC 1IVLA 2CKBA 1K8DB 4Q4IA 4CW1A 5B8CB 4GG6B 4WGVB 2J1ZA 1RH8A 1RUML 5GRXG 3LNGA 3DYOA 1KCUL 1GZQB 4JRYA 1KPRB 2NY4C 4F7TA 1CIUA 4MA8L 1NCIA 5CCJA 3PRNA 3BXNA 2IQ9L 1KB9J 4FXTA 5D72H 5E5LA 1VCBC 4Z8FL 1O6TA 4CVZA 5AVRB 2JIXA 2JTDA 3SKJH 1BVLA 4K5MA 2H8PB 4OJYA 4YDJA 2CO4A 4HLZG 3BOVA 4P5MB 4OI8A 3KL5A 2GSGB 3WTWA 3Q43A 3AADB 2XYBA 4WJ5A 1AR1C 4YHNA 5C9KA 8PRNA 2YOCA 5B66O 2Z92B 4JFXA 4LHUA 1AI1H 4C47A 3UTSE 5ICUA 5SV3A 4X7SH 1OAQH 2J71A 3KBHE 3VYPA 3V0HA 1GOFA 1KJ3L 2IH3B 2X4NB 4EBQL 4ZS7H 2XA3A 2Z93A 3D34A 4XC1H 1MAKA 3IFPA 4PRPB 2EXWC 3W3BA 3QEHA 4KK6C 3ATEA 3Q13A 5T1DL 5AZ2H 5DJDA 5CJ5A 2EDLA 3U0PB 2ZFGA 4XAWL 2V3EA 4BJLA 3PQYE 3H3PL 1QLRA 2H26B 3P3RA 4WU5A 1MDAA 3FQWA 3V4VA 3UTPD 5FUCC 4XCNA 2XX1A 4FULA 4X7SL 1C1EL 1KIQA 3B9DA 4Q89A 1KFAL 3D87B 4MAYD 4ATTA 1XB8A 3RNKA 4X8CA 3PNWB 4QHMB 5JIQA 5B7EA 4AL8C 2EC9U 4CU6A 3LN5B 1UWFA 4RDQG 3CC5A 1JWMA 1O9VA 2YAOA 2G3NA 3CV5A 4KFZC 4HULB 1BIIA 4UIKH 1MG2C 2X87A 3LCYA 3LK42 5SWSB 3QC6X 1G6VK 1S9YB 1J5DA 3IE9A 4ODUB 3F7PC 5LAXA 2XQBL 1J11A 3KPRD 4I0PA 5LLIC 4GH7B 4F7EB 1EX0A 3NUKA 1KFAH 4JRYB 5MHSE 3X13A 2BVTA 3C5ZD 4Y19E 3B2XA 2FEJA 3NSYA 1HXYB 4U6HA 3D3VB 4XMXA 5CWSA 4NQEB 4LKXB 4UM8A 3H4FA 3P30L 3SPGA 5DURD 1KNOA 3H53A 1WSST 1FFNB 4KJQC 2ZAGA 5C0BB 1KJMB 3FT2B 4ZW8A 3GRWA 3GMOA 3L13A 1TTGA 4WAFA 4LLWA 2DN7A 4FT6A 2VW6A 3QUMH 3VWKA 4N75A 3IXTB 3LXAA 3EHBD 1GC1L 1HAUA 3RWJA 1I1YB 5LDUA 2AANA 1EVTC 2NCMA 2R0ZL 4I18A 4PJ9D 1FGVL 3Q2WA 1HXMA 5F1SA 1S7TA 1UM4H 2ZWLT 3ARYA 4A7TA 4NS0A 3WXWH 1CD1B 2AW2A 2ZE0A 3BISA 4OQ1A 1ZT1B 2FQFA 3W57A 1FNFA 4D9LH 2UUDK 4JVPA 5PAZA 4H8VA 1SY6H 2ZUTA 3IGUA 1JZ4A 4LLYB 2RFXB 1JGDA 2XC8A 4HKBB 5HSFA 3FCGA 4CBPA 4KKBC 3ZE0E 3DROB 3MXWL 4TLKA 3Q5YA 4AQ1B 2OP4L 3E38A 1UXSB 2NQ3A 4PJFF 4WTWA 2VZUA 2OSYA 1A1MA 2YEZA 2FNWA 4NN7B 3T8XB 4HKZB 3VUAA 2WKOF 3RVXC 3D25B 3BVNA 1HJCA 4DP7X 5J8OA 1NSNH 3QQ9D 5FO8B 5B1JC 2X27X 2E47A 5DHDA 1TNNA 3QI9A 5HHOE 5SWQA 1EWHA 1MQKH 1IARB 3NN8A 2BSTA 3P0YL 5D70L 2LE9A 3B2VH 3KYNA 2JCCE 3O45A 1GAFL 3QS2A 3SCMA 1F11A 3BCFA 3HE7D 4AT6B 5JXAL 3DO7A 4IHOA 3HB3D 1SJHB 2B20A 1U3HB 4JDVA 4IHOB 2FJSA 4X4XA 5EC2B 4OUOA 3POUA 3QHFL 2OL3L 2KZ7A 4M61A 1KBGL 1V55B 4TS6A 3VFUA 5EWIH 2ERVA 3BE1L 4KX9A 4JFTA 3B9KC 3VFWB 5BW7A 2AKRB 3NCCB 5E2VL 4OFDA 3HHSB 3B2VL 4RAUB 2XYCA 1E5UI 2VN5A 5J6HA 1E5CA 5FYKE 3RPIB 2YAPA 4OJEH 2Y2XA 1DDTA 1T03H 4PTTB 2APFA 1S7WB 1VGEH 4GUOA 2V33A 5SX5H 2Q6WA 1WCQA 1G6RH 4FMSA 3J2PA 4IRJB 1U8CA 4MQSB 5KAQG 4KUZL 3ULUD 1XCXA 4HCRA 4AIOA 4OLWH 4PJEB 2Y0HA 2Q9OA 5E2VH 2K3HA 2DMKA 4AUYA 1KCWA 3P4OA 1DBMH 5KYXB 3ABLB 1CXHA 4U7KA 4NQSA 1BP3B 2BP0B 4G7VL 4WIQA 3K2MC 3FSVA 1A6UL 4DEPB 4AZ8A 2UWEF 3IMWA 4CSPA 2J55A 2XWRA 4FZLA 5DQDL 3SD5A 2WVVB 2GJ6D 2AQNA 4NM8L 2DH2A 1N12A 3T77B 3U30B 5L6YH 5D1QD 4AVKA 3BIAX 2XV2A 1LO2H 5KJRL 4YR6B 2WTOA 5D2NE 4LLQA 2DD8H 2X6MA 4KJPC 3VXUB 3I3BA 3EFDL 5TDOB 5KSUA 3DOIA 1I7RB 2QMJA 4LLUA 3WMQA 5IB3B 1GGCL 5IVOA 4APQB 2WZPA 5I1AA 4PHZA 1XGPB 3SY0A 1JK9A 3QORB 1I8IB 4ZUSA 3SYOA 4JDTH 4N90E 5LB1A 1HAWA 1GCYA 3BSZL 4AY0A 3CZJA 3K72A 2OXGA 4J8RB 4ZTEA 4NC2B 4G5AA 3NEXA 3IU4L 4HWBL 1UJ3B 4B0MB 1ZA3B 4NKDA 4OM0L 3BEVA 3K6FA 3LNDA 5D4HA 4FQPA 2JJWA 2R29A 3B43A 5E2JA 1GIGH 2WB1A 3GRBA 3IVKA 1TXKA 4PJEF 1ZSDB 4QHKJ 3ASNB 4U1MA 2J12B 2Z8WC 2VZ3A 5SWZD 4JDTL 4TVPE 2B08A 3GI9H 3VFTA 3W39A 1YEIL 5F7EH 1FZMB 3QRBA 1NIFA 3WE6A 3MJ9A 1JYVA 3PDOB 4QOKD 2WJQA 2DIJA 3D48R 5L2KD 2H26A 2XU9A 1J0JA 3ALWA 3B7RL 4NRXB 4P2QD 1Z9OA 3UYOD 4U1KB 3MC0A 3FYEB 4NO0D 3BIBX 1XHHA 2CUAA 1H8LA 5E2TH 2GSIB 2OTPA 5ID0B 1A1NA 1C16B 1U8LB 1QUNB 3UTQB 1F4XL 5GGUA 2C9UA 3I3EA 3RKDC 1IM9B 1IGFH 3QDJE 3U6RB 3CD4A 4ADIA 2XE5A 2FUTA 2OMFA 4UT6H 1UEMA 3WFHA 1JDAA 3D0VA 3DVNA 4PJXA 1F4YH 3SD2A 4KMQA 1JWMB 4HSQA 2I5YL 2YBGA 3GBEA 4DGVH 4N0RA 3HRZC 4CSZA 4NZ8A 4RWYH 3D52A 5C9JA 1AP2A 1WUNT 1X4ZA 4YL4A 5FUZL 2BO0A 5C97A 3NJIA 2A74C 3MLSH 5HI3D 4LVOC 4PIBA 3UJJH 1V8HA 1IGFL 2A6JA 3D18A 5HDBF 3RY6C 3U0TA 3WKPA 1I1FB 4UT6L 4FNRA 4QLWA 3TZVD 1NAKH 5E2UH 5I1LB 1OARH 1P7KA 4PJCF 1FNSH 2ICCA 1GZHC 3CFTA 5DO8A 2MH4A 3TBVB 1QBML 1XSOA 2E5EA 3QIUA 5H37H 1U93A 4JFXB 4X0NA 2GSMB 3QIBB 1ZHYA 3KPNA 4PG9A 1N5AB 2XA8H 1FN4A 3NGBB 3BIKB 3PWLA 4Y9GA 1NAKL 4PV8B 3L3HB 1GRWA 4E36A 3TO2A 3DECA 4OCRL 1KOAA 2VLRA 1F1GA 1MVYA 4JZJC 1BZ8A 5CBEB 2QPDB 2MIZA 3KH4A 4WKXA 2VXVH 2ATPA 3TOPA 1U8MB 4I4WB 2HRPL 3BD3A 4LAQL 3HMXL 4P57B 3K81A 4C83A 4RSVA 2HP4A 4TUOB 2Y1VA 2GJZB 1AQ8A 5DQ9A 5EG6C 1NOLA 1I3GL 2XJKA 4Z3TA 4DK3A 1XF5B 1N8ZA 1AOHA 2LLLA 4N85A 4LL1A 3OGOE 1NDMB 4W6YB 2VUKA 1XXFC 3PUUA 3WD5H 1HWGB 1T83A 2ICES 3K6DA 4JDEB 4X6EA 5KOVC 3ATAA 4P2OD 4NC1C 3DX6A 3ZT7A 2J25A 5FYJE 4E9TA 1BXXA 5EEWA 4Y5YC 3AW5A 3GLDA 1QWNA 2GIXA 4KTYA 5EA0L 1S5LO 2WXFA 3VTMA 2VTFA 3GS4A 1QTSA 2Y7LA 4X4KA 4YSAA 4MQXC 1N70A 4BDVA 3TJPA 3O2VH 1SYVB 3TH3T 1Q9LA 4JFFE 2R2HA 3AG3B 1HTYA 1FCCA 4U1JB 2QZQA 3T08A 1KCUH 4LCYB 4G83A 1ZXKA 4ZFFA 3VWJD 4RAHA 4DO5A 1KIRA 5HYJD 1D7FA 3OLEA 5DHVA 4F8QA 1MREH 2Y7SA 5ITFA 1C5CL 3SKJL 3S37X 4HALA 4GMSL 2GTWB 5C0NC 4PJHF 1FIEA 3X1GA 4HDIA 5SV4A 2VKXA 1ZWIA 1T21B 1KZYA 4U0RB 1ZLDA 3K8KA 4ZODA 4G8GA 4M48L 1J87A 3HHMA 5BRPA 3CCHA 1HL8A 3WLWD 5HGBA 2YAHA 3HHRB 5EZLB 3QORA 1I7TB 4YDKH 3NJVA 2J5LB 1Z5HA 5CBAB 2VMJA 4MNHB 4Y2NA 1CFMA 1UFUA 4AL8H 3VGBA 1L6ZA 4PS4H 2H32A 3VXUE 3KBPA 3QISA 3PF2A 3TYFA 4CVXA 4XNZB 4AQEA 4BZ2A 3SCMD 1I8KB 2GK0A 1WE5A 1MFBL 1BLNA 3JWOL 3MCKA 1ZPLA 2AJXL 5L88H 4N20A 1KMGA 3MBEA 3T4YA 3MODH 1SJXA 5HPOA 2EE0A 5K93A 3VXSE 3TT1H 4QEGA 1NTDA 1RUQL 3AA0A 8CGTA 2PCYA 5CINL 3K3QA 3C6SA 1LILA 4M7KL 1RHHB 2XBDA 1M2VB 1IGCH 5I8KH 4XMLL 5TFSH 3ABKB 5BO0D 5GGRB 4ANVA 2WP3T 4X7CC 3WNJA 5AW5B 5JZ7D 2BIQA 5KBNC 1AO7D 1ZLUH 4EI6B 4OLYL 3V0DA 1A66A 1F8TL 1PFCA 3QWQB 3Q3GA 5EPMA 4OFPA 2COVD 3QNYB 4QRUA 4IBVA 3EUUA 5CZVL 4EZKA 3IMTA 3UH8A 4FG6D 3D8MA 3MO1B 4K9EC 3L3GB 4KRPD 2BS71 5CMAB 2VW7A 1BAGA 3C09B 5CLXA 6FABH 2AGJH 2ITDA 5BRZA 3GMRB 3ZXAC 3CFIC 3NCJL 4ZFZB 1CE1H 2P5EB 5IB2B 5A7BA 4RAUA 4U1LA 5IQMA 3A3YB 3NFNA 2R39A 2AXGA 3ESOA 1TF4A 5AAPA 2ADJA 3QEUA 1NGPH 4N3UA 2CM5A 2NY4D 3QUML 5KJ7E 4GP5B 3MRLB 3I6KA 2WB7A 3KNBA 5FWQA 4RDQF 2XWCA 3O2DA 1KSRA 1RPKA 2XRAH 2IC2A 5ID1A 3DSFH 1U3YA 5K9JH 1UA3A 5FAAA 5GISL 3MOBL 1F86A 1QABA 3OGCA 4NENB 4G7YH 3QA3B 3RVUC 1ZANH 2DY2A 3W82A 3IJHA 1A7NH 4BUHA 2GK2A 4AMWA 5HDBE 1E27A 3BT2H 4JFEA 3RWEB 5CCKL 4MAZA 4FTVE 1XGRA 5T8IA 4PJGB 4HH9B 1S2EA 1P7QD 4JG1H 3PQSA 5D2LA 2B0SL 2FJHB 1A5FL 1KGJA 4P2OB 2WIMA 4Q52A 4V1DA 4M7LH 2N0MA 1AS8A 4OJAA 5HGHB 4B9KC 5D6CB 3C8DA 3IDMA 3SBRA 1A3ZA 1QSFB 4KK5D 3MV7A 3Q05A 5IFJB 5JHLH 5B1CA 2A6IA 3VB9A 1IJ9A 4P4KA 3H6JA 5E08H 3H56A 4TNFA 4PJ8B 5TF0A 5JLZA 1M4KA 3FYXA 3EO0A 3H42H 1K2DB 1NSNL 1G1CA 1AE6L 4MHHG 1R24A 4PJCA 4QD2E 2J1XA 4DOHE 4XO9A 2MOVA 2VLRB 1KXQA 1A25A 5E9DA 4LBEB 5D7SL 5HDBB 2X41A 3ESPA 3QWOB 1A3QA 5E9DB 4L4VA 5BV7L 4R4ND 1KACB 3EYOA 2EC8A 1ZGLP 2R2CA 4K2UH 2Q76B 1EXGA 2LU3A 4Y19B 3KD4A 3W38A 4P2AA 3V5KA 1NAMB 4RJWA 4OT1H 5LCVL 2ADIB 2V7NA 3KPQA 2EXTA 4XZUA 4FNSA 5DVMA 4V2BA 2WKLA 4TNVF 2XE3A 2BRRH 3OKLA 1KB5H 3BWAB 1CGSL 3EG9A 1CF8H 5KVEH 4RMTA 1HYRC 1WD9A 5FDWA 3EG9B 5ES4B 1B4JH 3V4PH 3OR6B 4UZSA 1DHKA 4LCUA 2GFBB 2WNKA 1UXMA 2E56A 4LDCA 2E3VA 1HCZA 2VXQL 4L1TA 3GJFB 4DOHB 3VD3A 1SLWA 1DL7H 4U49A 5K9OB 1XEDA 3D18B 5J7CC 5LCVH 5CILH 3FT0A 3CGTA 4PJAA 5C0RH 2VAAA 4KPHH 4O9HH 2HTLC 5C0GA 1NPNA 3P9MA 5C2BL 5JW5B 4XTRD 4D7PA 1LEKB 5CFHA 2VZOA 1CGSH 5KVEL 1T1YB 1L6PA 4GKSA 1Q0YH 1R5WB 3K1DA 4Z7VF 1BVKB 2DAVA 4UMSA 3MJ7A 4XXDA 4FQQA 3V52H 5I8OL 3KHQA 3NCFB 4FFYH 1M56B 4NUJB 1T6BX 4RFNB 5LWYH 2ITEA 4PD4K 4P4KB 1NKOA 2OMWB 4RH4A 2I9TA 4UB0H 2EDXA 3PCYA 1N4XL 4UBDC 4UTAL 5E0QA 4B9FA 4GKNB 3EJYC 4ELMA 2LHAA 4DQOH 1GL4B 5KJRH 4K71B 5EU6D 5JXEA 1IMHC 1DN2A 2LV4A 3SCMC 2K9FB 4APQA 3ILQC 2XFXB 1T22B 5BZWA 4J7RA 3AQDA 3AWEA 3NK3A 5CSGA 4HQQL 3T0EB 1RJZB 3DXAA 1PNDA 3FL7A 5DJXB 4KQ4H 2XXGA 1N4XH 3C6LB 1NFDB 3OXSA 4N8VG 5ERWB 1K8IB 1CO1A 1G1YA 3GJFH 3GMMB 1ECYA 1YC8A 3Q1EA 1IJNA 1SVZA 2YD9A 1AQDA 1UACL 4M6AA 3INUH 2BHZA 4Y1AD 3WLWC 1SGKA 3PWPA 1H8SA 3HFFA 4LSSL 3A4DA 4JO1H 3HZKA 3IMSA 4JDZB 4UT9L 1CGWA 1S7SB 1QLEL 4FNQA 4ZOCA 1GIGL 1OF0A 2AK4D 2DJMA 3RGBA 4BBWA 2VXTL 3JV4A 4M9OA 1A7QL 4HUXB 3O6FA 1H8OA 4PJCB 1EAPB 1T66C 4FSOA 1WQVT 5J12C 3TASA 1DUZA 1YEIH 2HTKD 2O5YL 1E7UA 1I8KA 2BY1A 2GK0B 1FRGL 4KK6D 4P23A 3LN4A 3FO2A 2JCWA 3DPBA 2JVUA 2N59A 3BZ4B 4XVOA 3HZ3A 5PRNA 2CHZA 3PYCA 2QPFA 3CHSA 1MFUA 1QWUA 2F58H 2Y36H 5J56B 1JE6A 1IGTA 1ZT4A 3ZDZB 4P2OA 2BOBB 4HIHB 4L0YA 3OAZH 5FYJD 5ALCH 2WVPA 2VDQB 2WAHA 2NY3C 3AREC 4P5TB 3POXA 4OZ4B 1UQSB 3RGVB 3ARFA 2EP6A 4LSPL 1XGQA 1QSEB 2XQYA 1C12A 3GB7A 3C5OA 1XR9B 3FONB 2AS5M 3N42F 2AVGA 5KAFO 2WINA 1CLOH 3IKCA 2JKNA 3RUGF 3ZO0A 5AB2A 4XNMB 1JZJA 3OKOB 4UB8O 2IWFA 4MJ6A 1CK0H 5HYJE 1YEWA 2HXAA 3LKOB 4X6FA 4P4RB 2PETA 4JFQB 4ZBJA 4I88A 5CIPH 4RWYL 2ZCZA 5GS1A 1S5HB 5AW9B 3E6FB 3HI5L 1JWUA 1QI3A 1QRNA 2R2HB 5DJCB 4XVTL 4MJIE 4X99A 4CAGA 4PLKC 1AYOA 1EGJL 2A1WH 3TIDB 4K94H 3SYBA 5T3ZH 2LFEA 1PLBA 5DMIL 1O0VA 2KS0A 2P8LA 4L4JA 3AA6B 4H8WC 2AXWA 1I1AD 3ILPA 2QTEA 4OV5A 1HCYA 3PWPD 1FL3B 3ETSA 2EYSA 4J6IA 1R0AH 1KGWA 3S3CB 3FQ4A 1T0PB 2YEZB 3LKQA 3MRGB 4JK0D 4TN9A 3ORJA 3BSHA 4FFZA 1N8ZB 1KGCE 4XN5A 5DL8A 2EIEA 1ZHBB 1AKJD 4N5UA 4GAAA 2WUBL 2EZ0D 1TFPA 1EUUA 3PIQB 4OW6A 1S5IH 5I6XB 1OAJA 2VN6A 3TBYB 1MF2L 1MXGA 5JUEH 2Q87A 3B1UA 2K6ZA 3AY4C 1AQMA 4MYPA 1R0AL 2CJUL 1FP5A 1S7QA 2BY0A 4GW5B 2OYMA 1HEZB 1QSED 3J7HA 4P9MH 1JXKA 3PDGA 1OGAA 1H5BB 4PAZA 2V5TA 1FO0H 3BLPX 3HZMB 4Y16D 1HQ4B 2O30A 1YQVH 1AIZA 1AH1A 2XZCH 3BJLA 5I15L 4NM4H 2MEJB 3MRNA 3E80A 1E4WL 4H1LG 2QADD 5J1TC 4CDGC 1N18A 4MA1B 4G9FD 4GQQA 1B0WA 3QUXB 2Z31C 5DWUH 1T4KB 2FYYA 1WC7B 1A6TA 4XCCH 5FFOA 4URTB 4NRYB 4ZPVB 1FPTH 1D9KD 3SJVD 5EZLA 2FGWL 2CA4A 1D6EA 2NNXA 5AQ0A 2DH3A 2Q7YA 4HLJA 4NSKA 3G08A 2H3XC 5F9AC 2NPLX 4GW4B 2PP9A 1FZJB 2F5AL 3FUMA 4ORGA 2L7QA 1KY7A 4S0TD 5CJOL 1COBA 1X5LA 4YEFA 3MLYH 3QCVL 4G6AD 3U2SB 1KTLA 4DN4L 2Z4TA 3QIBA 3PNWA 3TEWA 1BF8A 1SDYA 2P5WA 4QQ1A 2E9BA 5EWIL 2EDRA 1JIBA 3MJ8B 4OZHE 5D7IA 4NC0B 4L9LA 3EO1B 2XFXA 2QHRH 1J10A 2CMRH 4GJTB 3BKMH 5ANMA 3C9NA 4B9IA 1TOXA 1YPZF 3UMNA 1MNNA 2J5LC 1M7IB 2BMKB 2EE6A 5DLLA 4NNPL 5IEKB 5EEVA 1ZGLM 3QQ3B 1KYUA 1QKZH 35C8H 1IBDA 1WDAA 4LOFA 1C8QA 3QRCA 1UD8A 4O3XB 2XV3A 3LZLA 1DBAL 2E7BA 3P4MB 3DETC 4X6BB 1KLGB 5JR1L 5L4JA 3F12A 4LVHB 1TEGA 2WGNB 4JB9H 4HK3N 3UZEA 3FOLA 3MODL 4CC0A 1JSYA 1S9XA 4JY4B 1NAMA 4UINH 2VLKE 1E6OH 1VRSA 1ZY9A 3VD1A 5J1AB 2FX8H 3WO3B 1YYMH 3CE1A 1VB9A 4I48B 4XMLH 5I1GL 5E5RB 1HINH 1VFUA 4C55A 1WFIA 4KROC 3US9A 4F57H 1VCAA 5D1XA 4ZUUA 1OTUD 2CRIA 4WU5B 4EXPX 2F19H 4PGCB 5AYUH 2XNAB 1SMOA 4OF3A 4AYMC 5F9WC 3NEOA 5DJDB 1INEH 1FL5A 3QHTC 4L4VD 3C5JB 3DMMD 1U42A 1BQHB 1RK1A 3ARVA 2NSMA 4M6ML 4PRAA 3UABA 1QAWA 1A7RL 3S5YA 3L8QA 5TGBA 3X1EA 4BWWA 2EUVA 4QHNB 3LIUA 1SYSB 1NGYB 3U30C 1D5XA 5D7LB 3QAQA 3GMNB 5HHQB 1EMTH 4JRWA 5ANHA 3BLBA 1CICB 4V1DB 4W9KC 3I02A 2Z6FA 4J3WA 3EBIA 4N86A 3SBWA 3J27A 3FHEA 3T77A 2ZYRA 1CDBA 3HE7C 3TBTA 5E0FA 2AF2A 4L5FL 2QADC 5I1HH 3HFML 1JWSB 1U8HB 4PV9A 5I1CL 4S0HA 2EVGA 1A7RH 3CZNA 1BJ1H 3RP1A 3ILEA 3OX8A 4Z77A 4BXVA 2ODIA 3OKEA 2OW7A 4NENA 1PU0A 3CZEA 4PWKA 2BSRA 2A38A 4YSTA 5KSBB 3ULVE 4CMMB 4J3TA 1CXKA 2EXSA 2X1PA 3L17A 3SKMA 5L6YL 3TBYA 4HGMA 1X4YA 4MSWA 3VSTA 1KDIA 3EGDA 4E2OA 3EXLA 2VDLL 3A6BL 4HIJB 3S8GB 1JGVL 5GGUB 1I3UA 1EEYB 3CU1A 1D5ZA 1I8AA 3MFFA 4LPYA 2EDHA 1AXTH 1IT9L 3Q01A 4ZD3L 1JXDA 3HW7A 3LKQB 5EO9A 2X3AA 4M7JL 4BV1A 3D0LB 3G6JB 3NABH 2YSSB 3ZDYF 2OX5A 1GY2A 3BSZH 5DLML 3TLRA 3VE0B 4DKFH 2VXUL 3EJJX 2ADFL 3HA0A 3OKMA 1ETZA 5GJTH 1E5AA 1UG9A 4ZQKA 4MQTB 2O6CA 2EKSB 5IJKC 1IZKA 2BPBA 3WTSA 4HEMA 4OFVA 4U2ZA 4WFED 4U1HB 4KNQA 3CC1A 5F7HA 1R34A 1U21A 1YZZA 3FAWA 3OZKA 4NJAL 4F7CA 4FOMA 4FQXC 3VVWA 3FDWA 3KLSA 3QFJA 1BMZA 3VSVA 2FR4A 1R4XA 1CXLA 1G9ML 3NP3A 1U0QA 5K39B 3QI9D 2QMKA 4BA8A 5I1JL 1ZEAH 3C6SB 2B4CH 1UCBH 3P3UA 5EU3B 3SGJA 3ZHDA 3V4PA 2AAVA 2Y2WA 4RMBA 3RY5A 4ZTPH 3PV6B 1CYGA 1MFCL 5D7JC 2HT3D 1BAFL 1HIMH 1AD9A 3IYLW 3L5XL 1NMCB 3DURA 1SXBA 4N2KA 4WUKH 3U1PA 3WLBA 2K4WA 3SQBA 4AVHA 1VFBA 1CT8B 1G9MH 4XX5A 2ZOWA 4P05A 3BQUC 1MCSA 4AVIA 2PCFB 3RWFB 2QQKL 4EXKA 5C0CA 3K6IA 1U3HA 1EUTA 4JDVB 2H1XA 4PLOB 3OHXA 1NEUA 1KJ2H 3OMZA 4LSUH 2VDNL 5ACZA 4G6ML 4CVUA 1MW2A 4AGMA 1V7MH 2HCZX 2OR9L 2RQEA 3VXPB 2X1OA 3I9IA 2L7EA 1WFJA 4OY9A 3V52L 3W81A 1AGCA 2CRMA 2HT2D 3D2UB 4I9WE 2DQDH 4DZ8B 3KDMA 3WFCL 2ZD0A 4F2MA 1URIA 3K6NA 4MD4B 3CX5J 5FDYA 4IRJA 3JZYA 5FKAA 4Z1PA 3MJ6A 1E3FA 3R1GH 2Q3AA 3IGLA 1IKFH 4N8VB 2CO2A 4QWWD 1OCCB 2FBRA 3G5XA 5TK2A 4GI9A 4IKIA 1TFHA 4CTDA 2QQQA 4DEWA 2W81C 1KB9K 3TZVB 4Y2DC 3U46A 4HUVB 1CDIA 5FYJU 3FUKA 4HZLA 2HB0A 4DKAA 3U7YH 2DQTL 4Y89A 4M7LT 3SKUD 1ORMA 2D7PA 3MV8A 1Y0LB 3O4OC 3LD8C 5KSAD 5IROD 1Q9OA 5FHAL 3QEQB 1INQB 5E8PB 4G7RB 3T3MF 1WTGT 3C6LC 4LKCA 4ZFQA 4E9SA 3O11B 3EAKA 3GGWA 3VG9C 3QEGH 2BNRE 4G11A 1ZHXA 1A1OA 5MEOB 4LHUD 1GJWA 4IRZA 2R8SL 5GZOD 1WWAX 3VRIA 2IH9A 2NOYA 1B2WL 3CSYB 4UQAA 4N1EA 5CHNB 2QGDA 5D1ZB 5TF1H 1UENA 2OCFD 3DIDA 3A67L 3BH4A 2V17L 4CGTA 4V1DD 2F74B 2VDRH 2OR8A 3DOSB 1Z32X 2H0FA 1INDL 3SOBH 5DMGC 5I8CA 1N7MH 4LVOB 4QLRA 3UBXB 4LAQH 5MP6H 3QI9B 4M48H 1KJMA 4NGHL 3GKWL 1PVHA 3WKNA 4MXQD 2F1TA 5I6PA 1C5DB 2ZOUA 1NFIA 2XQ0A