4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
b'RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Factor H binding protein variant A10_001
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
4O3ZA 3HOLA 2YPVA 4AYNA 4O4XA 4U9CA 3HOEA 4O3WA 2KC0A 3V8UA 2KDYA 2LFUA 3PQUA 2W81C 4O49A 4Z3TA 4O3XB 1YS5A 5T5FA 3UAQA 3VE1A 4AYEC 2W80C 4QQ1A 2Y7SA 3KVDD 4AYDC 4AYID 3PQSA 4O3YA 4AYMC 5EE2A 3VE2A 4O4UA
chains in the Genus database with same CATH superfamily
3HG1A 1MEXL 2F0CA 3S35X 8CGTA 4DKEL 4M4RB 3MV9D 5ANMA 3DXAE 4R5TA 4LK4A 2HLFD 4GB9A 3UZQA 3BW9A 5GIRB 3VGHA 5KS9A 5IBTH 3MPCA 4NRZA 3B6SB 3L3OB 5D1ZD 3V4PH 1JPSL 1BBDH 4J8RB 3EGDA 3ARYA 4MSWA 1A1NA 1JXDA 1NUGA 2CNZA 2ZX8A 4JQIA 1X5JA 4GT0A 1IC7H 2YN5A 5SWSE 2B9AA 3ZGHA 3OKNA 4DW2L 3PWUB 4JM2C 3VRLF 2ZKXA 3G5ZB 4RIRA 3QNZA 1MNNA 4NO3B 3B3BA 4ODHH 5DFWH 1RZKC 1U58A 5AENA 5I1AB 3VTTA 3GC3A 4R4NC 4YXLH 3MRRA 1N4XL 3P77A 4NWUL 1JD9A 3PIQA 4IOFD 3X3GL 3TBSB 4FRWA 1J9CT 5A1AA 4TOYL 2B7DT 2QGEA 4FXKA 2EUXA 3D85B 3QIUA 4B96A 4JRFA 3RHWK 3X14B 3R7RA 3QPXH 2Q7YB 4BSWA 3QA3A 1NDGB 2N3JA 4D0CA 2Y06H 4ACPA 4BFOA 1V8HA 4GAGH 4EZJA 1KC5L 1RUKL 3FQWA 2K6YA 4X80H 4MJIB 5ESVA 3QZWG 4LSPH 4ZTPL 4APQC 4F8LA 1VFAB 5F6IB 3WFCH 5F1IA 1MCKA 5C6TL 2OMBA 5C0DA 3QR2A 4YFLI 2CMRL 3HKFA 4HFWA 2IF7A 3HZVA 4NPYA 3ECWA 3BEWA 4AE1A 4XMLH 4L8CA 1UOVA 2J88L 4FHJA 4BQ6A 3QIWD 3WLBB 4PJ7E 3DIFB 5D7IE 1NIBA 2WLLB 2FHFA 1CUOA 2OR7A 2JCCB 4HX1A 4XAWH 5KEZA 4PG9B 4I2XA 5ES4B 1NFIA 1D9KB 4YHML 3HNTH 1SVBA 5E6SB 4XPBH 4XCYA 3S5LA 2QGCA 5BVPH 1JE6A 3FFCE 4JFYB 2H1LM 3GNML 3QNFA 2TRHA 4JFXB 2A9NH 1MPFA 2WWNA 1KN2H 4XMKL 1UENA 2J5LC 4C4BA 1CR9L 5B8CC 2BSED 4KK8C 4OFVA 2B4CH 4OLYH 3G6AB 4UBDC 4RMTA 1TETL 1NGPH 3QUZB 1KDIA 3F62A 3N50A 1PX8A 4G8EA 4NOFA 3U25A 1QEWA 1I1AC 3VNZA 4WEUD 1BBJB 3V0EA 3LS5L 3T1WA 4FFWC 4CJ1A 4ZS7H 1J05B 3VFRB 5AW0B 2BRRH 5DD1H 3WIHL 3P4MB 1VZHA 2FK9A 3JCUO 4K7PX 5AL0A 1M1XA 1FUNA 3HEIB 4GSRA 1BH3A 2QVKA 5T3ZE 1FNEB 2VQUA 3EJSA 1BOGB 3WY4A 4E5XG 4F8OA 2C9SA 5HDQL 5FX3A 2BSDA 4H8VA 1GS8A 3ETSA 4JQVA 2BOLA 4X8GA 5I9QC 4HIJB 5L8KB 1QSFE 4DP7X 1OE3A 3C5ZC 5DMKA 3RY4A 3NJJA 3EYSH 4I18A 2GIYA 1UD4A 4ZTOL 1H19A 5DJDB 1Z3GH 2J43A 5DRXB 3TIEA 4X4XB 3TBWB 1A4JB 4OZIB 5C0BA 4DK3A 3M7FB 2WN3A 1T04A 4EI5B 4FNRA 5D5MF 1A9EA 1E6JH 4NT6B 4PV1C 5JHDA 1IAKA 1LEGB 4Z7OE 2NSQA 3HG2A 3QYNA 3KWWA 3HRZC 4F27A 1WA0X 3FB8B 1XGUA 1T80A 2EP6A 4N0FB 4XCCL 4YGVB 1HEZB 4A7SA 1ZV5A 3ME0A 4ADIA 4LNRA 1OTUD 1U8QA 1I85A 1KB5H 4YPJA 4XPFL 3PJSA 1QFWH 1T2QL 1DQLH 3LY6A 3ULVC 1TTAA 3VY9X 4UV7L 3SJVD 2J1ZA 2JI1A 3EYOA 3BAJA 4FNUA 4AM0Q 4WY7L 4JPVL 3LOWA 2A9CA 1SMDA 4IBWA 2R9HD 3FAXA 4X98A 1OAZH 5B38B 5IM7B 5DRZA 1LO4L 3NZ8A 4LIQH 3BX7C 2WYHA 3GSXA 1WBYA 2P5WE 3MLSL 3VD1A 3A5VA 3FFDB 5FYJE 2XZZA 4RJXA 1KFAL 4JQIH 5EOQH 5F7AA 1WDAA 4NJ9L 1ZSDA 4ELMB 1UM4L 3AXIA 1QTPA 4PWHA 2NUTB 2W0KA 4FQXD 5I6PA 5K9OA 1AQ8A 3KYOA 3FSWA 4UM9A 1GOGA 3INOA 4WO4A 1OARH 2X3CA 1Y07A 3IU4L 4PFEA 5M94B 3ZKND 4W4OA 2A6JA 1BFVH 3WMQA 2ED8A 4ZMOA 1WV7T 3CBJB 4L29A 4U1NA 2CGZA 4JFFD 3GSNL 2D7TH 2M07A 1OLLA 4TSAH 2X4TA 2CO6B 1DE4A 2IQAA 2VWEC 2W65A 3F7VB 4DUVA 1GS7A 1OF2A 3F2LA 1P69B 5E1HB 3ZX1A 5E99L 3GTVA 3D0LA 3PUUA 3RWJA 3WFHA 2Z9TA 2WXHA 4PB9H 4JRYE 1I3GL 1VENA 2AQ1A 1B6UA 2JE8A 3FTGB 4LGPB 4YPGA 4ZUWA 2XSKA 5KSBB 1XTLA 1KLUB 3JTTB 3SDXE 3MGOA 1X7QA 3HZMA 3NIGF 3FOMA 5G39A 5BRZA 1MJJB 3RY6C 2D3LA 2YARA 3KGSA 4KROC 3MCLL 1MSPA 5E51A 3BGFB 3N1PC 4HALA 4HWNA 2LQRA 3AREC 3TV8A 2HFEA 1GGTA 3FQ2A 3IAQA 3BP7A 4NPKA 1R1CA 3HBZA 4XVJH 1T21B 3FFOA 2CO4A 1O7SA 3Q8CA 4QRRE 2CO1A 2HG5B 3TO4B 1OP4A 4O4UA 4LLWB 2A3TA 3FUKA 4PD4K 4UINH 3JXAA 5FC9A 1QUNB 1CICB 3HS0B 4G80A 3OAYH 5GTIO 5IW1B 5E2UH 1OL0A 2UZYB 2HWZH 2D9CA 2ZSWA 3WY3A 1T16A 5KSAA 1VPOH 2R8AA 1KTRL 3CE1A 2R29A 3JWNE 1HHGB 1GA2A 2GIMA 4UOQA 5DEGB 2KS0A 1QI4A 2X53A 4OCSL 3ZL4L 3U9UA 4CNIA 2P26A 1KJ2L 1C5CH 2A1WL 3OB8A 4X6BB 3WN5B 5IGXH 4GG6F 2R8SL 3B3IB 1BGXH 3CG8A 1QBBA 1ZGLA 4MNHA 2IGLA 3UBFA 3STZB 2WJRA 1QPXA 5EE2A 4OLXH 2G9HB 3VRIA 3BCDA 2XG5B 2ZSVA 2BDNL 3X12A 3PPSA 5I5IA 2IOMA 1R6VA 2B0SH 3GXMA 1XF3A 2OYLA 4OTXL 3NSJA 1G7PA 4X6DA 2PXYD 1MG2C 3BAWA 5E00B 1P1ZB 4ZUTA 1JDAA 3SBWA 4NFDA 1ZSHA 4JFPA 2NY7L 1WZLA 3UYPB 1NFKA 5EZIH 4JPWH 3S37X 1ACYL 3Q2VA 5AFUL 1TQWA 3QC6X 5GJSH 5T1LD 4W6YB 3DC0A 1A7NH 5LDSA 3OR6B 2Z91A 1RZ8B 1QI5A 2BIOA 4JO8A 4PUBH 3K0YA 5FB8B 1FSKB 4GKSB 4BWWA 4JGMA 4KJWD 2FX7H 4B3EA 3U7YH 2OW7A 5AVXB 3VXMA 2JKXA 2E46A 3FN3A 4FLOA 3OKYA 3AVEA 5MHSE 3ABGA 1NGYA 1IM3A 1D3CA 2FATL 1WZKA 5ISZB 4AGQA 4NO5A 4UNVA 5EU4B 4LLUB 4PJHA 5EU6D 3S88L 5KTEH 2F54B 1GW0A 3TNMB 4EF3A 1YAZA 3PDOA 4J27A 1D6EA 3K7UA 1G7HA 1L9RA 3QPQD 3DO7B 1NMBH 3H9YA 4JRXB 2X9KA 3BLKA 4WDIB 5DJCA 4DP4X 1AGFB 3UJJL 4Q6KA 4DK5A 3G08A 1IM9D 3SGKA 1E54A 1X6LA 1WCBA 5AWNH 3C5SB 3FT9A 1A4KA 4DK6A 3L7EA 5HGDA 3SBQA 3IYLW 1SNRA 3B2UD 2ADGB 4YQXL 3N0PB 2YAEA 3LQZB 3D06A 4QRAA 2KMWA 3D6GA 4X6FB 4F58L 5LNEA 4QY8B 4MJ4A 4CGTA 1NINA 3GIVA 2J8UE 2ZUYA 1TEGA 5D2NE 7FABL 1XV8A 3E9UA 4PJAE 1U33A 1UKTA 2XE2A 4HGWB 5E8PA 1CDUA 1WD8A 3D87B 4OJFH 4KY1H 2I5YH 3IETA 5A2BA 2ZUUA 4XNMB 4IMKA 2YPVL 4IQHA 1TFPA 1XGYH 2V2WB 3K1DA 3ABZA 1YEJH 2DEXX 3CFMA 4LOUC 4PJ5E 4RGNC 4GQRA 4TQIA 3VXRE 5C0FB 3T4YA 2XUWA 4P2AA 3O9WC 4KDVA 3KPNA 4EI0A 3VH8B 4KI5F 1ZTXH 4PG2C 1XB3A 3SQBB 3NPSB 4PV8A 4IBUA 2PABA 3ILDA 3NDZE 3CNKA 3HR5A 4LBEA 4MVBC 4AZLA 4OF6A 5J89A 5AOMA 1GTFA 3AT8A 2J2ZB 2AK1H 2LVEA 4EUPG 1RV6X 3BJ91 1A3RH 4XC3L 3I2CL 3WHXB 4HA1A 3EUUA 5F44A 1I8KB 1KELH 1U91A 5DO8A 5CBAB 3NIFB 3VXSE 2D3JA 3I02A 2QKIA 3VSVA 2QV4A 3P3UA 5HHNA 3UTZA 2J25A 3GZPA 4GO9A 4X8XA 1DBAL 2QVMA 3MLYH 4ALAC 3TOPA 4HOWA 2ATPA 5EU3B 3UP1A 4YXLL 4PP2B 2KXPB 1G94A 4GRLC 4GW4B 4G8IA 1OAUH 5A16B 3VGGA 4YBLC 3S2CA 5L9DL 3BDYL 4KPHH 1KCSL 1VGEH 2AQ3A 1XVSA 2XX1A 2AJXH 4GW1A 3RZCC 1WEJL 3ARBB 3RWEB 1FZOB 2VXSH 4ELDA 1S5HB 5HYSA 3CMOH 3L3JA 4MJ6A 2Q10A 4ZXBB 1CXKA 4P5RA 5TQ0H 5LAXA 5IQMA 2GSGB 1R5WB 1KSRA 4M7JH 4KZDH 4PIBA 1OT4A 4X80L 1U4FA 4MAYA 5E6IB 1LE9B 2Q86B 2NLJA 3B34A 3CPUA 2DI7A 3VFNB 3T8XA 5EWIH 1YEGH 2V4LA 1CFMA 1TMQA 4NKOB 2DQHL 5I76A 4PWFA 4QRFA 1SY6L 4LVOC 3D3VA 3P02A 4HJJL 2FBJL 1SDYA 4KO7A 4ADGA 3BFWA 3DUSB 3KPMA 5EN3A 3UMTA 1BF2A 1AHKA 4TNVF 4P4KD 4V2CB 1MHCA 3DVGA 2NTSP 2CO7A 3D0VA 3VD5A 3CWGA 5F0MB 4NSKB 2BC4B 4UQDA 2YHGA 5L0QC 6FABL 1DVFB 4YSAA 3HUJB 2KPNA 2RFXA 1EHAA 4GQZA 4ZDHA 3ZQWA 3WL9B 2ZWKA 4YO0A 4FMVA 3BD5A 3ZRCC 2A9NL 3MXWH 1E9OB 4BWUA 4MXWL 2QVIA 4YHPA 3SDAB 2WOYA 4OLYL 2VB5A 3VD4A 3GO1L 1G7IA 1IGCH 2NY0B 1YDPA 3CVIL 3SPVA 1UM6H 4FG6C 1QLEB 1ES0A 1TNNA 1WRFA 3IKCB 4XCNB 5A2AA 3KXFD 3CZKA 1YNLL 4PJIE 1WIOA 3GSOB 3L4TA 2LR4A 4PRDB 4Z0XA 4PP1D 1XSOA 5DD1L 4MA7H 3R06B 4POYA 4ZZFA 2VL4A 3FDWA 5JQHC 1E4WH 3JWOH 5B39G 4ERSL 4YXKL 4LEOB 2JKSA 4Y1AE 2P5ED 5F1KC 4KY2A 1M6OB 5D1QD 5KBDA 4D9QD 3LVTA 3MLPA 5E9DB 3QDJE 3IU3B 1V55B 4TF4A 2BOCB 4AKMA 4GCPA 3K71A 5F96L 2ZP8A 4MAUL 4N5UA 1RK1B 4PGZA 3KNBB 3HKZA 2WSPA 1G9ML 4K7FA 3SYSA 4IEFB 4M5ZL 2R56L 4UQ2B 1OF0A 2Y2XA 2ZJSH 3DRTB 1QFWM 2PP9A 3SY0B 5IKCA 1MG3C 4PRIE 4GO6B 2AEIT 2NNAA 1JZIA 1WAAA 5GGRY 5AAWA 4EXKA 5EEWA 2WUCH 4XPGL 3VMOA 4PJGE 3GBNH 1E4KA 1IAOB 4ZPVA 2KKQA 2X42A 2NYKA 5FLUA 3INUL 5I1EL 4H25B 3RTQA 4XP5H 4AFKA 4OB5L 5K9KA 3VRJB 4HKXB 1KB5L 1KGCD 2K0LA 1WC7A 2WAQA 3K3QA 2FGQX 3MCKB 3AM8A 4HJTA 4WHTB 2AQQA 4FNLH 3BLBA 1I8AA 3N85H 2ZUQB 4MHHG 5FR3A 2GEEA 5CEXA 3G04B 4RMWA 3ZDWA 5FW8A 1WGOA 2VMJA 1RP9A 4AL8C 1M1SA 3CPLA 4M5SA 3N0AA 2YOAA 3L4UA 4PJCF 2YNKA 3NABL 5KAQF 3KCWA 1IKFH 3VI3B 4XMTA 1T4WA 2ZICA 3PFUA 4BK4A 1ETA1 5IIEA 3ESUF 4DPCX 3FB6B 4KRNA 3VXUE 3EOAB 3GPSA 2AJVL 2YC1A 2V3EA 2X6MA 3G5YA 3WS6A 4NI6A 3LZLA 2EILB 4OFPA 3KM2A 4O02L 4FFVD 5K5YA 3PL6D 4LSSH 2VJ0A 1JN6A 1ZMYA 5CBEA 2G3NA 1KENL 4X5RA 2C4FT 3EBIA 4TYUA 4ORZC 3TA3D 5D1XA 2NNRA 1MPAL 3MRNA 4F3FA 1JV5B 5IR1A 3RTLA 1N6QL 4X99A 5GHWL 2R0LH 5KVFL 3A0OA 2MHLA 1I8UA 1KBVA 2K3TA 4HIHA 4CUCA 2QQLH 3ULUF 1UUNA 4ODTH 3ULSA 2AZUA 4HZ1A 1YAIA 3RGVC 3FBKA 4PMFA 4EDWH 3IAPA 3ETBF 3L81A 1XGPA 4GOSA 4O5LH 3ZE2E 1PYWA 1FZKA 2EEAA 1R0AL 3KZ8A 4QRPD 2XZQH 3HCVB 3LKRB 4AQOA 3EDKA 1M53A 1M56B 1R3KB 5L2KE 4QF1A 1OZTG 4NQCE 4RFNC 3B7TA 5FXCH 3KD4A 1MNUL 1PEWA 1CFQA 5DI8A 2O30A 1ZPUA 4Z7NE 4F2MA 2VDPL 1SXZA 2X88A 3P0VL 4W9GC 4YUEL 2ITDB 4FZMA 1X7TA 2IQ9L 3S3CB 3H2QA 2D03L 3I6KA 3MV9A 1IC5H 5J9PA 1S9YB 2EE2A 4DZ8B 4F7EA 2IPTH 4YHZL 3J07A 3MJ9A 4TKWA 4WNQB 1F3JB 5KAQG 2VZTA 1RI8A 4JG1L 2AJYH 2R2BA 3P2BA 2ZQKA 3QZNA 3MLXL 1P7QD 5AVTB 5A40E 2BNRB 2EEDA 3MREB 5EZOL 1O75A 2BSBA 4GIOA 1AD9B 4PJFA 1M2VB 4X5PA 1REIA 1FYTA 2A6IA 2OZNA 3MJ6A 3QJFA 3DHPA 4RL9A 3O2DL 1HOCA 1ZT7B 3AAEB 3QORB 2Z4TA 2C8NA 2ZT9C 3ET9F 2ZYHA 3MRCB 3RIAF 4DGVH 1JIBA 4G7VH 5GIRA 5HHVL 1LEIA 5T1KD 4CU7A 5KANI 1F4WL 3BKYL 2WBJB 2G2PA 2CBQA 1U6AH 3BE1L 4J8RA 2OJZL 1ZJAA 1NOAA 2WXOA 3F6IA 4N2DA 1BVOA 3EYFB 2DBLH 1NGZA 4E2OA 3OLEA 3PWUA 2H1XA 3BHBB 4JPWL 3VWJB 1JZEA 3P2DA 1UH2A 1DFXA 2ESVD 2NY2C 5T3XH 3VRLE 8PAZA 4NO3A 3BT2L 1S7TA 4JHWH 2DKMA 1UACH 4HKZA 4I0PD 2NY6B 3X17A 1O9VA 2CCLA 4G1EA 3OZKA 3WIFA 3TBSA 1W16A 5JPNB 2CBMA 1CXLA 4Z23A 3GXDA 1Q9GA 1LMIA 1UB5B 3D85A 1RL1A 2V2TA 1J8SA 3MRBB 1IGML 2ORBL 3X14A 3TEZA 1IZJA 3FC8A 3T8MA 4JFTA 4HF5L 4PJBF 2CKNA 4KVPA 3OV6A 3VDCA 2AMGA 2YD4A 2WSDA 4MJIA 4BA0A 1T7YA 1BQKA 2Y2TA 1VFAA 1PBYA 1QZNA 4H4NA 3BZFB 3PGFH 5KWYC 3KPOB 4U6XB 3VTMA 1VRSA 1USQA 4GRWH 3JV6B 5EO1B 1MHPH 1TENA 1KBBA 1MFAH 3EZ8A 5H2FO 1GY1A 2YXWA 1B2YA 2EDMA 3DIFA 2WLLA 1D7BA 5J13B 1EEZB 2JCCA 2AJ3B 4EN3B 2O4EA 2UWEA 3LZQA 4N25A 3ARRA 4U6HB 2DJMA 1NMAH 4NI3A 3QZMA 2O93L 1U21A 3ETBJ 3HLAB 43CAB 3POCA 4YHOH 3PUCA 2GCYB 1FYHB 4FG4A 1WFNA 2F1CX 1DJZA 3PU7A 1JPTL 4QHLA 3KVPA 4WW1A 1OQOA 5DFVC 4DO5A 2XXFA 15C8H 3RWGB 3HZ3A 4P2OD 4L18A 2WQ8A 5CINH 4YLBA 3P0YH 3G6AA 2XE3A 3QUZA 1E5UI 4MWFB 2ED7A 1JZ5A 4HUMB 4OJFL 2JB5H 2QPSA 4N8VB 5CUSH 4G72B 3GSVB 5F89A 5I75C 2EO7A 4NUJB 3WCYA 4ZS6D 2EUWA 3ZUNC 1MCRA 3KDMA 3FUIA 2YO3A 2DQGL 3OF6D 4U3XA 2NY4C 4E42A 1J05A 5CMAB 3VAEA 3VFRA 3EDDA 4J28A 4POUB 1XD1A 4QDGA 2EUVA 4JFDB 5CR8A 5CIPH 3VI4F 5EEVA 3ZDZB 3KPRD 4U2ZA 3QI9C 2GUOB 3OWEA 1ZE3H 4G1MA 1K5NA 1BOGA 2X40A 1FNGA 5TE4H 1B0RB 2E9WA 5IHHA 2WZ5A 5T1DL 4WEBH 2OMUA 3M45A 1U8JB 2PWGA 5AW7B 4Z7OB 4JM2B 4IKLA 4E9SA 4Z5RA 2QDVA 3I84A 2OFQA 4HIJA 3VTAA 2RGSA 4A6YB 1HHKB 3NVQA 2VDKB 1CI5A 1UD3A 3UL4A 3EJZD 5DJDA 3D08A 1T0PB 5C0AE 4KDWA 3TBWA 4MQ7A 4ZFOL 3F6JA 4XNYH 3QXAB 4WI3A 1YEHH 1ZEAL 5L4FA 3NN8B 1C5DB 4BKLB 1LK2B 1JPFA 4JHAL 5ID1B 1LEGA 3B7RL 1ZGLM 5LQBH 2CG9X 2NW2B 4MX7B 5GS0H 3K6NA 3MFFB 5AVYB 3CZGA 4BKSC 2XE1A 4XMUA 4N0FA 3MJ8B 1KBWA 2UXVA 2FGZA 4YGVA 1HEZA 1MELA 3QFJD 1DFBL 2R29L 1X9RA 3KPSD 1NKGA 4FQXA 5ALBH 5GGSY 5A7EA 1N0XH 1TITA 4Q4IA 5CKAA 4APQB 3KL5A 3AY4C 2E0PA 2QSQA 1KY6A 4EBQL 3CZJA 2I32A 2K70A 3U82B 3F6LA 5EZLB 2HKFH 4V1DE 2WTPA 3HB3C 4TLKA 1AOZA 2MQGA 1JGVH 3L9EA 5B38A 1WP6A 2X4NB 3DGGA 4R96A 1N5YH 4U0RC 2Y5TB 5TGBB 4BUMX 1GPOL 1WTLA 2JNZA 4GAJL 4FP8L 4L3FA 4A04A 4ELMA 3CD4A 2WYIA 1QA9A 3H9SB 3PG2A 3EOYG 1LP9F 1CGSH 2ZAGA 3C75A 5DZNA 4I3SH 4S10A 3KE0A 1QSEB 2BVPB 2B59B 5AW6B 1HKFA 4PRNB 4ZQTA 4HS3A 5B8CB 3ISWA 2J5LB 4JBSA 4JY4A 4GQQA 4LSUH 4LFHD 5IZ7A 1J8HD 2WQXA 4DVRH 3CZFA 3IE9A 2AS5M 4RAHA 3STBA 4XNKA 4XNZC 1ZGLP 1NCJA 3S48A 3TWCH 1BSIA 4LEEA 1I1AB 1FF5A 3F7VA 4QHKJ 3KYNA 5C0CB 5IW6B 4IBYA 2E7MA 1N3NB 4O9HL 2XFXA 3TZVC 4NC1C 3VXTA 4CSTA 3WY1A 3FTGA 2Q8AL 2A73B 5JIDA 3MDJA 1KLUA 1MIML 4Y2NA 4PQXA 3KLLA 1AS8A 3CUPB 3NIGE 3ZMNA 1BEXA 5GRWA 5EEUA 1JXKA 2ICWJ 5L2KD 2D4DA 2Z7ZA 3KS0J 4GW5B 3FTUA 1PQZA 5D70L 2KLSA 3U1QA 5I9QB 1URLA 1U8MB 3MRHA 1PKQB 3C5ZB 5TK4A 2BVQA 3QAZC 5DL6A 1NBCA 3RWCA 3T65A 4RGOH 3RBSA 1SEBA 4WKZB 1L6XA 2WWOA 3L7FA 5FW7A 4L4TA 1CGYA 1H3VA 4R6UA 2HG5A 2QT6A 2XX0A 4LDEB 3TO4A 1CL7H 1TQBC 3HI5L 3ETTA 1HVXA 2H47C 2E59A 4BZ1A 2GHZA 3IWVA 3HRZB 4K9EC 1KULA 3O81A 3E6HA 4JUTA 4H8QA 5IHLB 1BZ9A 1CICA 4QHPA 2WMPA 3HS0A 5TK2A 1W72A 4BWTA 5BS0E 5HHOD 2UZYA 3U46B 4XOAA 2WJ5A 4H0LC 1FHGA 5KVEL 1YUHB 2P49B 4XP5L 3QJTB 2KBGA 1JI2A 4H8PA 1YEKH 2WQVA 2XA8L 3BP5B 4MGXA 1MCNA 2W0FB 4X6BA 1AR1D 1VEMA 1IEBB 2DRUA 2UZIH 4IDLA 5T1LA 1QEXA 5KVGL 4GG6E 2RH0A 3HVDA 5CGTA 4S0HA 4YWGH 5I17B 2G9HA 4N0YL 3WNOA 2XG5A 4GSQA 4QO1B 4FQJH 4PRPE 3DARA 1NFDA 3MRFA 4YZFF 3IDYC 4TS6A 5DA0B 1P6AB 1IKFL 1UM5L 4WWOA 1L5GB 4AYFA 1KGXA 2YD2A 2YJLA 4GLRH 5EUOA 3UYPA 4YXHH 4DUWA 4LU5L 3RAJL 4XX1G 3LKQB 2QQKH 2IJ0C 3SKJH 4G8AC 2H6OA 4Y4KD 5EU6A 1TG8A 4HMCA 4UT9A 2YS4A 4CW1A 4XC1H 2MNHA 1YMMD 2AMUA 3H56A 3VGBA 1NCTA 4LCVA 4A2GA 4F7PA 3STLA 1INDH 2X6UA 5EA0H 3TZGA 1IM9A 1BM3H 4OM0H 4C55A 3W5MA 2B1HH 2JLLA 3L4VA 2VLRE 2OAAA 2HP4A 2QQLL 4I48B 5CCKH 3C5JA 4N2EA 3BISA 3KLAA 3OQRA 3HS9A 4K5NA 3LNEA 5JO5A 3BZEB 3KYKH 1JNNH 3J27A 1NCCL 3GJEB 4LARL 5EU4A 4LLUA 1EDQA 1N59A 1Z5LB 4MDRA 4KROB 4PGCB 4QJ3B 4U1HB 2F54A 3PP3K 1U42A 1UCTA 4EDXB 1OP9A 1AGCB 1URZA 3CSYA 5HDBB 2DICA 4ZMAT 3AREB 1CDYA 3QUHA 3DO7A 3SPJA 4LMQE 5TFSH 3WS3B 2H3NB 3RBHA 4M62H 2YGNA 1A9BA 4K3HA 1PG7H 1ZKAA 4AM0B 3LMJL 4PJAB 3ZYIA 5J4MA 2XWZA 4K3JL 1OCRB 2GJPA 4XNXH 5CD5D 3BQUC 4MA8L 5D7HA 2HRPL 3PDDA 5DUBB 4MKMA 3F7LA 3UCQA 1CXFA 2HKHH 4HJ0D 3PXLA 4J3TA 2MQ0A 4QY8A 3TT3H 5DZ9A 2DYRB 4WWID 4ES9A 5GRZA 2W94A 1L7TH 2ENPA 3IS1X 4DCQB 4OKVB 5C0JA 6CGTA 3I74A 3DVNA 4RA0C 4HGWA 2HFFB 2HG0A 4PY7B 1UWGH 3N41F 4DQAA 5CEZL 5K39B 1JHKH 4JO1H 4XP6H 4CSPA 1QO3B 1UGNA 4XNMA 4CRPA 2V2WA 1WS7A 2H45A 5C0FA 1NC4D 5F8QC 5GISH 4Z76B 5CLYA 1R19A 4LL9A 3VH8A 1JGIA 2VJ8A 1HWGB 2CAKA 3CGTA 3OXRB 4U6VL 4XNUH 4KI5E 1JZ7A 3OPZH 3NT0A 4H26B 4AYNA 1NBYB 5JXEC 2J2ZA 1U8CB 3T0EE 1AOHA 2OX5B 2X1WL 2A9MH 4GINA 4PREA 3OZ9L 3WHXA 2VKWA 2KHAA 4QRSB 1GC1H 1MJ7L 1I8KA 3GQFA 4OIBA 1KIUA 3B7UX 1ZD6A 2J4WL 3B5GA 2B16A 5CBAA 5TQ2L 4X5XB 2W60B 2EDHA 4P2QE 3MJWA 1EFQA 2G9KA 4LSTL 5E08H 2QV2A 2NYYD 3C08L 1J48A 4ZMYA 2VABA 4PP2A 4BQCA 5JMOC 3EFDH 5E6RB 5C09B 1KTLB 4M6ML 3EDFA 5KVDH 4XCEA 1JNJA 4BSVB 2DM7A 3MBEC 5ACZA 1RPUA 1ZA6A 3FN9A 4WUUE 2W59A 3MX0B 2EDDA 1DBML 2G3MA 3BKCH 1L9QA 3ARBA 3RWEA 1JPST 5CZKA 5JNYB 5FF6A 2X12A 1TZGL 5D4JA 3UZEA 3V5KB 5I2IB 4JW3A 4UOZA 1SOXA 4ZXBA 5T33L 4G9FD 2GSGA 3WJLC 5B3SB 3PAYA 1LE9A 4NKDA 5E6IA 2XETA 3ZMEA 5DQJA 2Q86A 1ODAA 4DNLA 3KWXA 4HHGA 2B2XH 4XVUD 5GGVH 2F58L 3X1BA 3QHFL 3VFNA 4XE5B 1J87A 5BRPA 1I9IH 4NKOA 4KVCH 4AENB 2XG6A 2R1YA 3N91A 4XN7A 3L13A 5CLZA 3G6JB 1QFOA 1MF2L 2HRGA 4HU2A 5DT1H 4Q58C 1CD1B 4JZNB 5LNGA 1J9TA 4HCRA 1DQDH 1HX0A 4MB3A 3WUWG 1K8DB 4TQEH 4NSKA 12E8L 2BC4A 5HI4C 3V6OC 3KLSA 1DVFA 4KMLB 3KR3L 2I60H 4JDVB 4UT9H 1QHQA 4OV6F 2CKBB 3VSUA 1SJVA 4PJIB 3WL9A 4ENED 4HG4K 2MPAH 1F45A 1SDAB 1DSYA 3UTOA 5TF0A 4HVBA 1E9OA 1JWMA 1TQTA 3FTXA 3W0WE 3D39B 3LNGA 5A2IH 4DKAA 2VXVL 4ZW8A 3L9BA 4DHLA 3AMLA 2WHVA 4RGNB 1ZJBA 2IAAC 1MXGA 2HZHA 4DZBB 1DBJL 1HCFX 4XCNA 3IKCA 3O9WB 4NUGH 2OSYA 4FABH 4FX5A 5C0GB 3JVGC 2ZKYA 5EO0A 3GSOA 1IRAY 2WXGA 3IGAB 3RPIB 2A4CA 3RWDB 2XBTA 2BSCA 3FULA 4KNQA 5EU5B 2VR5A 3ARDA 3R06A 5F9OL 1VSCA 5KYXA 1L0QA 5F2FA 2AXFA 2H6UA 3P0GB 1UKSA 4Y19D 1M6OA 3JUZA 4RMQA 1NJ9B 5E9DA 1Q9KA 5HJDA 1EHLL 3IMWA 1Q90A 1LXMA 3A0BO 3Q9PA 5EIIA 3K0WA 1JZ4A 2ICCA 4MYWB 5DVLA 3O2VH 5FDWB 4Z7UA 1E40A 3O8XD 2YSTA 2NZIA 1RK1A 2V33A 4TVPE 4Y16D 3WU2O 3KNBA 5TE6H 5AYUH 4LEXH 4UQ2A 5E4EC 3DRTA 4GRLB 3K2IA 3WDHA 4OCXL 4YBLB 1F4AA 2BM3A 3GBDA 3PGSA 1PKOA 4G8FA 5KBPA 4YBQC 5AZ2H 4C56E 3MJ9L 2ZOUA 3GUTA 3DJRA 1L0PA 3RZCB 5E0QA 3B8YA 5SX5H 2J3SA 2N2MA 4DGYH 3HC0B 1KJ3H 3MUGB 4PLNC 3LZOA 1SJEB 1MAJA 3BT0A 3JYBA 4H25A 3IGUA 3AAAB 1HWWA 4Z78A 2APFA 4G7YL 3BPOC 4GG8B 3IFNL 2BINA 4NLHA 4JX0A 2TRYA 2X87A 3MCKA 3IMBA 2PR4H 4KKAC 2CE6A 3IKKA 4OZHB 3EH4B 2LU4A 5AVRB 4HPYH 2DLGA 3LKOA 3L1OH 4GHBA 3G04A 3QEQE 2HKFL 1YNTA 4M93C 2CDGA 5ENWB 3MLUL 2C3VB 5AOKA 3I6GB 2C34A 3P73A 4Z7WF 4LVOB 4R5VA 4K2UH 3UEZA 4JM0A 3SODB 4HJSA 2RHEA 3ZRFC 3TA3A 4JZJC 1NPNA 3TL5A 2DTSA 1RK0A 3RL1A 4G6JH 1GMIA 4NO2A 4GI9A 3DYPA 2HT3D 4PWEA 3BKJL 5MEPB 3HA0A 2GTZB 3OMIB 4KTDH 3S4SG 1J0IA 5L0QB 2FT6A 2KL6A 1UVQB 3SKMB 3SYAA 2Y0KA 4FJZA 2WWMC 4S11A 3T0SA 2XPYA 2VXTH 3FU3A 3DETC 2MSPA 2MNWA 5DFTA 5CD3B 1F11B 1CS6A 4LSVH 3S5LG 2DLTA 1MFMA 3V6OE 3S0PA 3SSGA 4N2LA 3DGCR 1HL9A 2BSTB 2XNAA 4KK5D 4KXZI 4L0PB 4K5LA 5L2KB 8FABB 3ULUE 3B5TA 1QW8A 3DHMA 3RNQB 4D7BA 3U0WL 1BF8A 1G6RB 1SF3A 1ORQB 2EINB 4HWEH 2QHRH 3P1VA 5LG1A 1AO7B 2V17H 3BIBX 4B50A 2PTUA 4FKHA 4OBSA 4P23D 3HCVA 3LKRA 1UHVA 2WYZA 4OCWH 1R3KA 5HHMD 2GI7A 3RVVC 3TT1L 2CHNA 5F7LB 1KYOJ 1JGEA 1OAQL 3NAAL 1A3LL 1RSFA 3BUQA 3MA9L 4M02A 1AI1L 2AQ2A 4GO8A 4B7LA 2WAHA 5C71A 2VAAB 4B5EA 1NICA 1JDDA 5IBLD 2GK0A 2GJ6E 3EGSA 1XXDC 4HCRH 1W2KT 3PWNB 1QQDB 3MVSA 3HI1B 2ITDA 1OIOA 4L9LC 4GUCA 5DD0L 3W56A 2HLEB 4IKIA 4P4RB 4NZTH 4DZ8A 1AE6H 2B08A 3ZTJH 4BRJA 1DJSA 4YH6A 4MD0B 4Q56A 4WNQA 1F3JA 2VLLA 4ZFFA 4WU5B 1OP5H 5ICXB 5CJXA 3Q2LA 4N59A 4YSPA 2BNRA 1H15A 3MREA 3MHZA 1T89C 3BOVA 3U0PB 4AUIA 1IQDB 1AD9A 3HG0A 3CHSA 1D9KD 4HGKC 1OM3H 3OL2A 1YEKL 1ZLWK 1QLEH 3S36H 4CC4A 5I23A 3QDGE 1NAKH 1PLGL 3I6LD 2QQNH 3AAEA 1F90H 3JV4B 5AYTA 5EB9A 5EO9A 4MXQC 5HHXH 1R5IB 4F92B 4X4ME 3VWKC 2WBJA 1URIA 4GKZB 3CFBA 5INDB 1GS6X 5K33A 5I1KH 4X9BA 1EO8L 3DX4A 4ZMPA 3FTVA 4FLQA 3MZTA 1Q9WB 2ROXA 1AYOA 1PJ9A 4AX3A 4J4PC 3BHBA 3VWJA 2F68X 4LCUB 2XIDA 1OD7A 1HWHB 5FM4A 3SKJL 3TBYA 2AJUL 4WGWB 1K2DB 2P8MB 4FG0A 2IV8A 4RAVB 5GRJH 3U48A 1Z9PA 1CFVH 4QJ4B 2F74B 4W4NA 3HG4A 5HYIA 1SUJA 3VFGL 4ELKB 3I50H 1NCDH 1ECYA 5JPNA 4KXAA 3OQ3B 4KDTA 1UB5A 5D4QA 2AERT 3G5VA 3MRBA 3EOTH 5EORL 2PUQT 4XBGB 4J3OH 5J12C 1PX3A 3MXVL 1IAII 3DTXB 5EBMB 3RGVB 4D0BB 3QT2A 1W15A 3N44B 1EWHA 3RE0A 1JNNL 4PCTA 2BVYA 3TEXA 4PJBE 1IQWH 1FZMA 2DYPB 3Q8AA 2EXYC 3P3YA 2EABA 4EIBA 4I3RH 2DQEH 1CURA 3DSFH 4CVZB 3ZE1F 3L17A 3LN5A 3WEOA 3L9RA 3KPOA 4RFNB 3IVKB 2XTJE 3SKUD 3TCXA 2Z8WC 2XDHA 3JV6A 5KW9L 4D8PB 2YK1L 5HPOA 3QWRD 3WKML 3BVNB 3QFGA 4P5TD 3HOLA 4JQXA 4LAJH 2NUPA 1OP3H 2X1QA 4AXWA 2AJ3A 4N2IA 4NQEB 4RFOH 4MFHA 4HPHA 3OF6A 4HUKB 4YOKA 7CGTA 2HKHL 4NQVB 4XVTL 2YA0A 3HLAA 4NCC2 2APBA 43CAA 4AC4A 1M7DA 1A7PL 1DO5A 2VLKB 1R3HB 2VR9A 2GCYA 2YA2A 3LKNA 3MV7E 4N4YB 2A77L 5I6NA 5EEXA 4TPRL 4H8WH 2Z8SA 2EEFA 3LNDA 4CDGC 1JPEA 3RWGA 2J6EH 4WEEA 4UYQA 1CDCA 2EYTA 5IQ7H 3T6QC 5IEHA 2HPTA 4NUJA 1QVOB 3PS6A 4GP5B 5DHYA 3W9DA 3M46A 1BVLB 3LRSB 4UM8B 1N8OE 1ED3A 2A99A 3IGLA 1JZ6A 4U4IA 4JFDA 3HMWH 4LQFL 4JB9H 3U0TB 5CJQH 3VI4E 4FFZL 2FECL 4JO4H 2GUOA 4WFHE 2E7LC 4YEFA 3ALXA 1EJOL 4MA3B 1EHKB 4HUXB 4PHZA 5I18H 4M1CD 3QFJA 1U8JA 5JYMA 5FYLE 2F08A 2NY2B 2H9GB 4BHUI 2OZ4A 3DRQB 5JR1H 1KCWA 2OULB 1AVAA 3TBVB 4DP6X 2QADC 2OV0A 4J3WA 4RMBA 4NM8H 4H44C 5F71A 1QWHA 4JPSA 7PCYA 3LPFA 3QXAA 2IFFH 3TTSA 3PQUA 2EDLA 1MCPL 4BZ1L 4JRWA 4BKLA 1LK2A 2A0LD 1FE8H 2YMTA 2BWQA 2NW2A 3QXTA 4GKNB 1EXGA 1W72L 2EIBA 1OLZA 4U3SB 5FGCB 5C92A 4PW3A 3I6SA 3SKNB 3H3PL 5E8DH 3MJ8A 1UT1A 4JHVA 2ZOLB 1LO0L 3DECA 4LOVA 3AW5A 1SMOA 3ZHKA 5AOLA 4APQA 3KLQA 4ZO6A 5I0ZA 1U8KA 1AKPA 3OC8A 2BY0A 3HG5A 1WBXB 1AQKL 3N42F 2DW5A 5EZLA 1MHHA 2BCKB 1KYAA 3DZMA 1SOQA 1XF5B 2R0ZH 2ZCHL 1J1XL 2OR9L 3HHSB 4Y4HC 5LAPA 2WTRB 4KVCL 2RD0A 2Y5TA 5TGBA 3CFEB 5J0BA 2E76C 2CHDA 2PYEE 4PWJA 2OMXA 3DV6B 1AP2B 3QDMB 4L1SA 4JDEA 1CXEA 4ZODA 3HHRB 4BZ2L 1WE5A 1GGCH 2VDOB 3H9SA 3LAFA 4KKCD 2A6KA 1WF5A 5L7XL 3HC2A 1TJMA 2VDLB 3IXAB 4NENB 3WIIL 4BA8A 4NXKA 1LP9E 1QSEA 2X2YA 2X2IA 2XOTA 4WEMB 2BVPA 2B59A 1TXKA 5GXBB 2YFOA 3QFDA 1UXLA 4PRNA 4UT9L 4XN9A 3DK2A 2BWIA 4XTRD 3VFVB 1QFPA 1VB9A 3K2UL 3IMUA 2UY6B 3IDNB 5I8EB 2H32B 2PN5A 3UBXB 1WBZB 5I75B 3FRPA 4OSUH 5IW6A 2HTKC 3N6YA 1XDTT 3PQYB 4PJ0O 3GP6A 1WCQA 2R7EA 3BS0A 5G26A 1FGVL 1PY0A 1QACA 3GF8A 4GY4A 2A73A 1FAIH 5AEAA 5I74C 3FT1A 3IJYB 1W0WB 2DWEB 2XWRA 3UOAB 3FW6A 4AV4A 5J7CC 3DJZA 2HN7A 3QI9B 1S7QB 2QFRA 1IBGH 2G3XA 1A0QH 4FF9A 1OD9A 1CTOA 3F58H 4XX1E 2H0PA 4OGYH 3EGXB 5HHOA 1QRNE 3TF7C 4DO6A 2B4CC 3II1A 3ZVVA 1PKQA 3SEPA 3TVMD 1B0IA 4H0IA 4LRNL 1OB1B 1IFGA 4HKJB 5ERWB 4CC0A 3KAAA 1SYVB 3MA7B 2XKSA 1ASPA 1AXTL 4WKZA 1C08A 3Q6FB 4IGBD 1MI5E 3T9WA 3RVUC 3HJEA 1A4AA 2ZAIA 3NCEB 4J2QA 2I27N 2CUIA 4G2AA 1LVEA 2H0EA 3UG4A 4OZFB 1HC1A 5DWPA 1FI8C 3EADA 2QZQA 5IJBC 1J11A 3HRZA 2FLBT 5CILL 5BZWA 5KOVC 3GGWB 4UU9B 3HR6A 4N74A 3ASNB 1EAPB 5DDHB 1UA6L 5F7UA 4I77L 1PZ2A 1W0YT 1IT9H 3GMNB 5F7DA 1YCSA 3MLRH 3MQIA 1YEEL 1NKOA 4Z3JA 4N2KA 1MAKA 2E7BA 3VW3L 2XLLA 3AUWB 4LKCB 3FT3B 1TMCB 3HB3B 2W0FA 1K3ZA 3CFNA 3HN3A 1G9MC 1IEBA 1KIQB 1PD0A 4Y4KA 1MXDA 1XH2A 2BIPA 3W57A 2OTWB 3SE4C 2G0KA 4U0RB 5DEFB 5I17A 1YMMA 4PRHE 4R7DA 3MRGB 5LHDA 1ZHKB 3HNVH 4N6RB 4P2RE 2C7UB 4QO1A 2DMGA 4OI9A 4JCMA 3EH2A 3CHPA 1FNFA 3COOA 1SXBA 4G6AD 4YZFE 2XYCA 1UB6A 1WAAF 3PJNA 4ISVB 2XVKA 4GCQA 1A25A 3F84A 4M00A 1RZKH 2VDKH 2ZUWA 3QXWA 4K8RD 5F7MC 2W88A 4UTCA 3PNWB 3LKQA 2VERA 2OMVB 1JFQL 4OI7A 3HC3H 3FQRB 4UIMA 1FVCB 4X0KB 1YQVH 2I9LA 1D5BA 4UMGA 2JTYA 4XNZB 4JL1A 4LKXA 2IANB 3WNPA 1CPUA 1QBLL 2ROYA 4LSVL 2OL3B 3NRQA 1NZRA 4EVNB 4P5MA 1XIWA 3TZVB 2CA3A 3IDJA 1HQRB 43C9B 5AVSB 1JMZA 4GQ9H 2VXQL 2VDML 4I48A 1NL0L 4GRWF 5FA3A 2R39A 5EFIA 1HHHA 4V2BA 1FNSH 2KT6A 3RUGA 3RY6A 2X0WA 4PGCA 1BIHA 4M6NL 2GJJA 2JELH 1AGCA 2E27L 4RMVA 5PRNA 3UDWC 5JZ7D 1K8IB 1J0JA 1ESOA 2DOCA 2EXWC 1ADQA 3RX8A 3QAZB 4OCWL 2C9PA 2FWUA 3O41B 3WS3A 1I7RB 2H3NA 5AKRA 3X11B 4HWBA 5ALCL 4B95C 4FXKC 4AM0A 2QSTA 2CPUA 5CZRA 3FOLB 2V5MA 5FYKH 4YIQB 5CHNB 2HB0A 2ZG3A 4AITA 4ZMLA 2M06A 1TQBB 2VDQB 2W91A 4OT1H 1TSHA 3LNHA 4F24A 1X5HA 4IU2B 2IPUK 4DEUA 5DURB 2YBRB 2YXMA 3GSWB 1I9EA 3M88A 3QIBB 4FTVD 4IW4C 2H2PD 3UIZA 4EZLA 1AE6L 2FHBA 5KJRL 1E90A 1KYFA 4Z95L 5E1AB 2WK2A 2DLEA 3LK41 3SDCB 4DCQA 5D55A 1L0XA 2FEJA 3QUYD 3OM3B 3ECUA 4NP9A 4GAFB 5E4OA 4PY7A 5IFHL 1RURL 5DS2A 5K39A 3VE0A 4QHMB 5BO1H 1ZHLB 5HD8C 2RIKA 2DMHA 2QKSA 3UYRL 4X8JB 4U1SA 4K15A 2R0KH 4ZUUB 4PBDA 1GGBL 4NQDE 3B2MA 4WI8A 1HYSD 2ZTBA 4PGDB 1NPJA 32C2A 4AEIL 3WKPA 4HFUH 3ESPA 4QHKI 5C08B 1TQUA 3IDYB 3QYMA 4XAKE 3TF4A 1ZHBA 5B3JE 4H26A 3Q43A 1NBYA 3L6FA 4ZPTB 1U8CA 1OCWH 5I1KL 2V9RA 1QTYT 2Z64C 5HI5D 2FTAA 1VZGA 1EVTC 2J1YA 1I9JH 2ZXQA 4J7RA 1CZ8H 2X09A 3RVTC 3UX9B 2HH0H 2MNJB 4PJ9C 1XGTA 3CHRA 5I16B 3HBQA 1OE1A 2IO5A 4KFZC 4OI8A 2WTOA 4F33B 2PW1A 1T03L 4HJGA 5IJDC 3D09A 4QRUB 5C0IA 3ARGD 4LOEA 3HW7A 5GRJL 4ODVH 3I75B 3BD4A 4PJFF 1ZHTA 5C09A 4POZD 1TU2A 2CM6A 5F7NC 4UZSA 1X5YA 1M57B 4BXVA 1FGNH 2EDBA 3TN0D 3W2DL 3HG1E 3MX0A 4ONGH 1PVHA 5IB1A 5ANME 3N5AA 1GJIA 3B37A 3ULVH 5BXFA 1SBSH 2XWCA 4G3YL 2EH8H 4G6ML 1F1DA 2F53E 3BUYA 3KWTA 5KS9E 1ZANL 4LIQE 1BV8A 3P9MA 2FJFB 1KXQA 4I18C 4JCHA 5JOFB 1Q4NX 4ZO7A 1IGJB 3OJ2C 4GSUA 3VO0A 3F64A 3TO2B 4PBVC 1TJIH 3GHBH 2H26B 4GMSL 4RVBA 5E4IA 4M5YL 2IMNA 4N20A 3L08A 4U9CA 2WP3T 4JDTL 1I7TB 4AWJC 3QR0A 4W9FC 1XSIA 4XWOD 1E2WA 1T1YB 1FVDB 4FERA 1YSOA 5CZVL 2IWFA 3BQUB 5K9QG 3O6ML 1NWOA 1MCJA 1YEFH 1CU4H 4BUQA 3QC5X 3IDIB 4EKXA 1CD1A 1BG1A 2DWDB 1ACZA 3NTCL 3GRWL 4X7TB 4WCYH 1K8DA 4RFOL 3MLWL 4IBVA 3FL7A 3B4NA 2XV0A 3F00A 3IRCA 4UTBA 2CNYA 5CKGA 3V52H 3IXTB 1HIML 1MJUL 4HT1L 3BZ4B 1GFOA 4JDVA 3OMZA 3MOBL 2CKBA 1FFQA 4OV5B 3LV3A 2YPKA 1L6ZA 2O1AA 5IQLA 3ZDYB 1HSBA 2P47B 3D39A 1AXSB 1C1EL 1H8OA 1L7IL 4L4VD 5EUKB 1P4IL 3CCHB 3KCPA 4OM1H 5L2JB 2A7BA 2D7QA 3O8XA 3SPIA 3O9WA 3PF1A 5C0GA 3TJEL 1NCAL 3QUXC 4ZMVA 2Y0HA 5FO8A 4M48H 3EJYD 2VITB 3IGAA 3RPIA 1JMXA 2XACC 4PJ8D 3C9NA 3C6EA 1BVZA 2QSVA 4LAQH 1CLYL 2AXWA 4RA3A 2JCCF 4OD1L 5SWZD 4YE4H 2B1AL 2WLHA 3IM1A 4UQEA 3V2AR 5CM1A 7PAZA 1MVUB 2Y1YA 4BYHA 2WJQA 4I88A 4PJEA 3VU2A 5GSVB 1KB9J 4KK6D 5FOBA 5GJTH 4LCWB 2Y3AA 5FDWA 2LOEA 2WD0A 3PABA 4LESA 4OUUB 5D2LB 2XRAH 3OAZK 5I1CL 4TNVK 3LIZH 4HETA 4KRPC 1SVZA 4JFED 1I4FA 3D0AA 3QQNA 4UV4L 3GMLB 4GRLA 2X6CA 3A2SX 3BD3A 1CE6A 3MBEB 2YD9A 3KEDA 3BUPA 1BD2D 1XGRB 2AW2A 2W07B 5CJBA 1BZ7A 4U7SA 5D93C 3MUGA 1UFUA 1SJEA 2Y22A 4PSPA 2CPCA 3UROR 3D7PA 1RZFH 5CO1A 1UATA 3VVWA 4KAQH 3CDYA 4XVOA 4MD4B 2YAOA 1V05A 2AI0H 2XWJB 4FQPA 4N5ED 4W93A 2PPEA 2C3GA 3CFDB 5IV2B 3PGRA 3T0XA 1J5CA 4NCDA 3DXAD 1CFNA 3F8UB 3RKPA 2LT9A 2JVUA 2C3VA 4L5FH 4PMEA 4FQHB 4PR5A 1XCWA 3AS3A 4Z7WE 2P46B 3FU5A 3P3RA 1E6OL 4OZIF 2XVGA 4A66A 4DETA 4TNEA 3B1UA 5SWSD 3IFLH 4H88H 5MEPA 4M43H 4BFRA 1FH2A 2VLJB 1YJDL 4Q9QH 2FD6H 1DBBH 1UVQA 3UXFA 1ET7A 2O5ZL 1J5OH 2JTDA 1P0SE 3ABKB 3N1MC 2Z35B 4FDWA 4JN1H 3RVXD 1MRDL 1DLFL 4L1DA 1MJ8L 4PS4L 5CD3A 1F11A 5SX4H 1BLNB 4JFSA 1HI6B 5T5NF 3UZVB 3RWIB 1CCZA 2F8IA 4X2UA 5I82A 4KKRA 4G83A 4H2AA 3TYGH 1E8WA 4OF0A 5GGVY 4M9OA 3SBWC 1UZ6F 4WHDA 2R23A 8FABA 4LDLB 5EU7C 4EAEA 3RNQA 3WNLA 3CIQA 1G6RA 1EVUA 4Y2LA 1IGFL 1ORQA 1PD1A 3HE6D 4ELMF 5G4MA 2ZF9A 1AO7A 2BVOB 1UUSA 1A0QL 1NOLA 2CRYA 3BKML 3NIDB 1WWWX 3HPJA 3PWPB 1RH8A 4PB0H 1IGIH 4K94L 1GXEA 1AJ7H 4HU8A 1NUFA 2NDGA 2DMBA 4JPKH 3U2IA 1I1RA 4B9KC 2VAAA 4C59B 5E4EB 2V8LA 1QQDA 1CIUA 3SQOH 4KKBD 1JNLL 2EIEA 3TYFB 1C12B 4PRAB 4FFYA 3VG0H 2CKBH 1DQML 3FCSB 3FFCD 3D25B 5MEOA 3ZUCA 5KSBF 4ESKA 3UO1H 5E6YA 1NCWH 2QDWA 5ICXA 3BPOB 2Y36L 1IFRA 2R4SL 5JDSB 2JJUA 3U30C 3MRQB 1Z9OA 3O4OB 4BFGA 3VFMB 4EN3D 3H0TB 2P8PB 1ZTXE 3U0PA 5BRZE 5ADPL 4PI0A 1N9PA 1ZV9A 4HPOL 1G9NH 3MV8E 3O3AA 3QZLA 4AKPA 3NA9H 3SOTA 4M93B 5IB5B 2OTUB 3PF2A 3ESVF 2SODB 3QARA 3JV4A 4QTHB 1E4XH 2KPWA 1DVXA 2Y7LA 3E38A 3ISYA 3K80A 2WYTA 1M05B 4JZJB 4F9PA 1R5IA 5IVXB 1DJWA 4NNPL 3C2AH 1USZA 4WNSA 4X9GA 4GKZA 5T3ZD 3KLHC 1RZGA 4RNRA 4G8GE 5B38G 2GY5A 3OG4B 1YYLH 2YXFA 5HP5A 3NSDA 2WPGA 1TYEB 2PP8A 3M17A 1QSFD 4B9FA 2MFNA 4K71C 5B7EA 4UQ9A 1Q9WA 1WSST 3ROOB 2WKLA 2IWWA 2OZ4L 3FO0H 2EEXA 4TTDC 2EH7L 4LCUA 1T20A 3GKWL 1TR7A 3C60D 2OKMA 4YDJB 1T5XA 1BYNA 4KUZH 1K2DA 2EO1A 3IE4A 4ZOEA 1UURA 3EFFB 1E8XA 1KWGA 3SCMD 2Y7NA 5CGMA 5E8NB 3BRZA 4JR9L 2OYKA 1BAWA 2XN9B 3MNVB 3V7AG 4ELKA 1OAYH 2FX9H 3LXAA 2VDRL 4QHNA 5TH2A 1U8HB 3MODL 5B4MC 2OSLB 1DANU 2O5YL 1AD0B 1VFBB 4ZK8A 3BO8B 3ECVA 3J8F7 3BXNB 3ZHLA 4Y4FB 5AZEH 4CGUB 4FSPA 1EHXA 5CJ5A 2GE4A 2VTFA 1QR4A 3OGOE 2Y9RT 3DTXA 5EBMA 1OGAB 1KTJA 3RGVA 4D0BA 4N0UB 4YSCA 3M07A 3QNXB 2QKIC 2DYPA 2QPEB 3SE9L 3O4LE 1IBZA 2MOGA 4WW2C 5E2TL 5F6HI 5BZXA 3RU8H 1FCCA 4CVZA 3EXJA 1PTZA 4Y2OB 3GSNB 3TFBA 1LO3H 4L9DA 4Y5YA 4RWHA 3IVKA 1M9WA 2P5WD 3RIAK 3ZE1E 1MCHA 2R1WB 3MCG1 1RERA 5FYJD 4A2LA 4R8WH 1G5GA 2QLVB 4D8PA 4S2SB 5CGYC 3T0DA 2CLZA 5HVGB 3OHMB 3BVNA 1HXMB 1BFOB 3E3QE 4L9LB 2LAGB 3RFZA 2OCJA 2XICA 1GYAA 1QFWI 1A6WH 3FPYA 4RAUB 2FEDD 4WI9A 1H0DB 2D8KA 2IGFL 4E41E 2APTA 2MH4A 4WZ9A 4MAYC 1JV2B 4NQVA 3L2NA 4K3DH 2VLKA 2DD8H 1R3HA 3L3DB 2PO6C 4YFEA 3FTSA 2R1XB 2YXVA 4LLQB 1MRFH 2F19H 4RISL 3K6OA 2K9FB 1ERNA 3U1SL 1F00I 4H5SB 2N7AA 4JRYD 5DHEA 4U1IB 1B6DA 3S5YA 1G6RH 1JWUB 2CCVA 3LRSA 1EIBA 3QXDB 2KH2B 4E9LA 3VWKB 3QCTH 3RDTD 5KJ4A 1HCVA 2WXFA 2YLKA 4TULL 3U0TA 5TD4A 5HGHB 5DMGC 4OGZA 1GIGL 4C57C 5D72H 5HI3D 5A3IC 3T2NL 2QR0B 3NSFA 4HUXA 2DIAA 2VQ1B 4B27A 4TLSA 4TSBL 4FNQA 2FO8A 1BAFL 4AK1A 2H9GA 5HJ3A 1MM4A 4MBRA 3DRQA 2MQCA 1QFUL 3WI4A 4QRRD 3FZUC 3U7WL 1CLOL 5JW3L 3F7KA 2K4TA 4FFYH 3VDAA 3SN6N 3FKUS 1LD9B 5E94B 3C5ZD 5FV1L 5JXAL 4NO0D 3HTLX 3RL2A 4U3SA 5J1AB 4WJKB 3ES6B 1FA4A 1CVSC 3SKNA 5J12B 1F4YH 4YDZA 3U6XS 3V0AC 3B9KD 1SBSL 3EMNX 5JLZA 4EZMA 3TM6A 4YVUA 5MENE 4PRBB 4HIPA 4DUXA 2CLRB 2XVLA 1MCOH 4IKJA 4HZLB 1Q9LB 3V4UH 4LRIA 3U1PA 4FMSA 5FVNA 3HFFA 1E43A 5HYJB 2N2LA 4AL8H 4A2EA 3EXLA 2BCKA 1XF5A 4K3BA 3HHSA 4O51B 3VJ6A 1G0YR 2F9BT 2C9VA 2WTRA 5I66B 1KLFA 2CGRH 1U8NB 5AAWC 1KBPA 3RP1A 3HIZA 2HVKA 9PCYA 1FAKT 4WLCA 3DV6A 1AP2A 3QDMA 4JHUA 2VN3A 2WY3B 4M7ZB 3VYOA 1YPZA 2YQBA 2AJSH 4AG4H 1BECA 2NRDA 1KCUH 3AM8C 4AUUA 3IXAA 3CHOA 4Z77B 2CM5A 5LXGH 1S9XB 3CDGB 4K07A 3V52L 3BGMB 2LU7A 2I26N 3N9GH 1RU9L 1AZCA 1Y0LB 1OPGL 4TSCL 2V2XB 1UJ3C 1ZLUH 4FZNA 2BZDA 3IDNA 1A14L 5HHPA 2XG4B 4UQ3A 2H32A 3UTTB 1KT2B 1WBZA 3AABA 3WU1A 3TVMA 1JFHA 3DBXA 4L4JA 1X5LA 3CQPA 3PQYA 1AIFB 4PJDA 4NBXB 5MHSD 2V7HB 4L37B 4JK0D 4FULA 4IGBA 1TVHA 5KAIO 4KMQA 3C8HA 2W5PA 5GS3A 2BVTA 3UERA 3D3VE 2QELA 3WS6C 4DKFL 1BZEA 2YD7A 3QI9A 4TQPA 3AG1B 2WXIA 5G4OA 3AA7B 3O6KL 4DVBB 3QQ3B 5C0RH 1A7OL 5I73B 5JOPE 1KCRL 3VH8G 2BW5A 4C4VB 5E8EB 1YY9C 1COBA 3WEAA 1ADQL 2XZCH 3WSQH 3E8UL 3SYQA 3PHQA 4FLHA 5GPRA 5D1XC 3HUJF 4HWBL 1ID2A 2GFBB 4MJ5B 1JZ8A 4GXVH 4NN5C 3IDUA 1KCBA 1OB1A 1BQHA 4MZ3A 2QADB 1AZZC 3MA7A 2HAZA 3SDDD 5CCHE 3Q6FA 2NXZC 5I8CB 5DO2C 3GI8H 5I15L 3ARED 3KWUA 3WN6A 1Y6KR 1M7XA 3CFCH 3QQXA 4OZFA 3MTRA 4NBZB 4MNGB 4NQXB 2F15A 4LPYA 1TJHL 5EZJA 3GGWA 4UU9A 4XVSL 4JE4B 3VM5A 1MHEB 1ZE3C 5DUJA 1MAML 4PJXA 2O26U 4U1JB 5CSZB 3WNKA 3OKKB 5DDHA 1GFPA 4RLCA 1JAEA 1JHLH 1PSKL 2KZKA 2MOQA 3AY4A 1PFOA 5DMJB 3WFBL 3ZJAA 5DWUH 1MQ8A 1A8JH 4O00A 4A63A 4PJ5D 3VXRD 4HXAH 3ZXAC 1WZ1H 2ZFGA 4TVUA 1A6UH 2RBLA 3EO0B 1ZS2A 1S7XB 1KIQA 4Y4HB 1KEML 3S34L 2VR6A 4ONFH 2OTWA 3DGDA 4Q2ZB 1XR9B 2HLFC 5DEFA 5J57B 5F97E 4HK0B 3GJFK 4MDIB 3MRGA 1TFHA 4XB8A 3DOIA 3GXNA 4N6RA 2C7UA 2K45A 5D1ZC 4Z0BL 5EPMB 1JUFB 3ML9A 5GS0C 5GZOD 2C9AA 3U2JA 3UTSE 5T3XE 3RQ3A 1EMTL 1OSZB 5ID0B 4RFEA 1I8MB 3NACH 4OCRL 4ISVA 2EYSB 2RCSH 4XXWA 1CBVH 3Q1SL 3VXSD 1WAAE 4HHWA 4X5QA 3OJMB 4ZUSB 3OMAB 3GM0A 2OMVA 3MNWB 4J3OF 1E0OB 2JJWA 2KDYA 4IOFC 3ZTJG 3A22A 1QBML 2OL3A 3VE1A 5DVPA 4EVNA 4BJLA 4DGIH 1UXWB 3TZVA 3QBTB 4WK2B 1EJ8A 1HQRA 2J71A 2JQAA 2ZOTA 3ARFD 5E2VH 43C9A 3LB6D 4IOIB 4QPEA 3A6OA 4E0RB 4KTEL 4LHUB 5I74B 3LRLA 3HBGA 5E4AA 4AQ1A 4GRWE 3VI3F 3LCYA 1OAXL 4ZG1A 5LNDA 2Y07L 2FB4L 2ADFH 3D9AL 2E6JA 2ENJA 3HHMA 3N43B 5JOEA 3O3EB 2LAAA 1UYWL 4LPTA 1J8KA 2WWKO 3T20A 2QQQA 3LS4H 3QUYA 1ZVYA 3O41A 1OK0A 1I7RA 1NM9A 1YEDB 2BWDA 4F7MB 2VR3A 1EZVY 3QIWC 4Q8BA 4TUKL 3FOLA 3CK0H 3OSVA 1W6WA 3S3PA 5CHNA 2B20A 2VDNH 4W6XB 5HGAA 4DOHB 1UEMA 3WD5L 2DV6A 4F57L 4IU2A 3MACL 3GT6A 5DS1A 3GSWA 4UTBL 3QIBA 1SXSA 1S8DB 3X1FA 4IRSD 5TDPB 1HXYB 1SJMA 1AANA 3VCLB 2I7SA 1KTKE 4ZSOB 5E1AA 3SDCA 1CFSA 1INEL 1ML0A 1N0LA 3WE6B 5BOPA 1R5VA 5L6YH 3Q13A 2H32H 5AG8A 4X7EC 2APWA 3NZHH 4XBPB 1TSRA 5HYQB 2KZBA 5E1IA 4QHMA 4I1RA 1NSNL 3OKOB 3QWOB 4X8JA 1UWEL 4G70B 1G9NL 5DJXB 3N55A 4ZUUA 4J3OG 1BQUA 3H42H 3QEUA 2DLHA 2Y7QB 2BFVL 3V0DA 4HOZA 3TTYA 3ATAA 4PGDA 3DX6B 4DP2X 3QCVH 1RULH 1HL4A 1BMWA 2BNQB 4YLQT 1FG2B 4N2BA 4IBTA 2Z34A 1SN5A 3T0WA 1DDTA 2OYMA 4XP9H 2UX6A 5DR5H 5C08A 3CLFL 5DMYA 4ZPTA 4Y1AD 3ZKQD 3TN0A 2C7FA 3WENA 1MRCL 3MUZ1 3QDJD 1H6S1 1AQDB 1KB5B 5BMFH 5D7LB 4GUPA 3D4ZA 3OJVC 5LWYL 2AEPL 3CLEH 5E95B 2FWOB 3FO0L 5IROD 4YSQA 1JVOA 4F33A 2EIKB 3BVVA 3UZQB 5KS9B 3WTWA 1QOKA 4UNIA 3I75A 4NRZB 4OZFH 4PRID 3VACA 4E1TA 3VFPA 1BX2A 3HW9A 5E56A 2DLFL 4PJFE 1BHGA 5ITBL 1FYTE 3WXVL 1A1NB 4FRTA 1GCYA 3RKDD 3WEXB 2Z92B 5EBLA 1HK6A 3MRPB 2VZOA 5AZEL 1WWBX 3OKNB 1V3JA 1OTUC 3VD9A 4HCGA 2LVCA 4RIRB 1H9VA 1U58B 4O58H 2FJFA 3HI6L 5FYKU 5I8KL 2DDQH 3WTYA 3MRRB 4O02B 3NFSH 2XQBH 3P77B 2CJTA 2CR3A 4ZUVA 2WVPA 3PIQB 3TO2A 5DK2A 1VEPA 2R9HC 5C7XL 3FSAA 4FI8A 5BNXD 1MW3A 4GFTB 5I8OH 2EYRB 4FXKB 3GTNA 4HWZA 2IAMD 4TLUA 4X4ZA 2ZG1A 4L4VA 1FVDA 3FSZA 4JMXA 4QRTB 4BSWB 3QA3B 4HJEA 2PPAA 4ODXB 1ASOA 3IDIA 2XFGB 4FQXC 3AT9A 3RI5F 4X7TA 3U36A 4NZJA 1CD9B 2NSXA 3VXUD 4P57B 4I4WB 4P04A 4OFYA 4OGQC 1IZKA 4ZNEE 3EBGA 3IXTA 1UOLA 4HFWB 3BZ4A 2QGDA 4PJ8A 5F7FA 4EJ1C 2E9IA 3HG3A 4AKRB 1MH5A 4NPYB 3E80A 2WIMA 4KWUA 3BEWB 3D2UD 1DVQA 3EDEA 1T3FB 4L8CB 4LSRL 1TNMA 2OL3H 1AZRA 3O6FD 1AXSA 3AWEA 3ECQA 3NFPA 4MJIE 5CCGE 1T0NB 1AZBA 1RIUL 5FKPB 4YC2C 3SIKA 5L2JA 4Y2DB 2VDPB 1XF2B 5GS2H 1NLDL 5TTRA 4HX1B 3UO8B 2HXAA 3GIZH 4I2XB 3L3IA 3FO1B 3TA4D 3EYQD 3DKHA 1J0ZA 5DFAA 4ADJA 4JO2H 4XOBA 3ZY7A 1BD2A 2ID5A 1BT9A 4HC1L 1LE5B 3EH5B 1IJ9A 1RUMH 1OGSA 2DKUA 2M26A 1MVUA 2JCCE 1P4BH 2RQ8A 4KBPA 4QTIH 4NQCD 5DJ8B 1JBJA 1VA9A 1RJYA 1QEWB 3LNFA 1YA5A 4PJ9B 5H4YA 4YDKH 1QJ9A 3ZT6A 2WKOA 3LEVL 4JLRA 1VCAA 2ED6A 1ZHYA 4XP1L 4NYLB 4YK4C 3EO9L 4OCYL 2VDQH 3M1BB 2MCPH 2VIRB 1JGUH 2DLIA 1IUZA 1LO5A 3DXAA 3WBDA 1M1XB 3RB7A 1KYUA 4M8RA 2AQSA 3TX4A 1CGXA 1XGRA 1SOSA 3AQXA 4FQIL 4IHBA 2KLRA 3DPBB 5HBBA 4PYHA 1YEIH 2CIIB 3QULB 2JQZA 3PP4H 3TH3T 3FN0H 3P3SA 2YQ3A 5DMKB 1D5IH 5SWSA 5C07B 4I18B 1GC1C 1EGJA 2AKRB 1D5MA 4MD4A 4F37F 2HFGH 2XWJA 4M8QA 3OMNB 35C8H 4L48A 3GXFA 5C0BB 1WICA 5IV2A 1T04B 3B1TA 4PN6A 4Z7OF 4JM2F 5AUMA 5JHDB 1GAFH 4FKEA 4OW6A 4NAQA 2AXTO 3WKQA 3VZTX 3AA1A 5DJ6A 1D5XB 4PGEB 3T6VA 4A68A 3G5WA 3KWWB 2CGRL 2ODHA 5F1NB 1PCXA 4Y5VB 1L3NA 4WF7A 3NJTA 3C6LD 4FNTA 3LEYH 4F93B 1WO2A 1U8QB 1B88A 2AGJL 2PXYC 4OZIE 3PJSB 4MB5A 2YUVA 1NANI 1CLZH 1S7UB 1NOFA 1PCSA 2FRGP 3OAYK 4HYTB 4Y0GA 3FSOA 4KOBA 1BWMA 5DRZB 3NZ8B 3TV3L 3GSXB 1EX0A 2D7NA 2BOBA 3U7AA 4UIKL 2Z31D 5BV7L 4GSDL 1HI6A 1LHZA 3T24A 4AEHH 3FH7A 4KJWC 4KZEH 4YX2H 4KKPA 4UM9B 3QUXB 4S1QH 4P59L 5E9NA 3KEHA 4MDJA 2F5BH 4BH7B 1UZ6E 2C3HA 3OGCB 3QG7L 3AGWA 4EKJA 3GLDA 3LZNA 5IJVB 4G76A 3KLKA 3L1FA 5F3BB 1MFVA 1MCWW 5H2BA 3EDJA 4ICWA 3VB8A 2BVOA 1LWRA 4U1NB 4PR7A 3UAJD 1G43A 4ELME 4F5CE 3O0RL 4K3EL 3QPQC 5K1VA 3PWPA 2X4TB 2LTQC 1XL6A 2IVFC 1OF2B 3LNIA 4OGXL 1KN4H 5E5LA 1XGZA 3D0LB 3V7AE 3RWJB 5K9OB 3BAKA 2X2UA 3P4NB 4ZUWB 4PV9B 5JW4Q 4OLVH 3B2UC 5DRNA 1S7RA 1ZIBA 3HZMB 3B83A 2NXYD 3FOMB 5DD5L 3TYFA 1C12A 2G3ZA 2X4RB 3HS8A 3R19A 3V5HB 5D93B 5JUEH 3HAEB 3AXLB 1JRHL 1CQKA 1V10A 1IFHL 2M1KA 1FBIH 2PKDA 4LSHA 3NK3A 3T77B 4IBZA 3WJJC 1MIEL 1UZ8B 2OLDA 2HFEB 4W9JC 5KSBE 4HIEB 3LK3A 3HZYB 1OAJA 4IDJL 3BP7B 3VFMA 3H0TA 1FNHA 3OKLB 4NWTH 1ZS8A 3TASA 4APXA 4XPAH 3B2DC 1CF8H 5ECJE 1GTNA 2PW2A 3F05A 4E9XA 3GI9H 4JN2A 3C60A 4ZFOB 4QXUL 2OTUA 2WN2A 4DTGH 2PCFB 1ZHXA 4OCNC 3F7YB 1KG0B 4QTHA 5CSZA 4BGLA 4XPHL 1AQHA 4JZJA 4W9ZA 1RFDH 1YEWA 5D5MB 2HX7A 1FV1A 3QRGL 4WFFE 5I1GH 3BIKB 3B9EA 2P28B 3WXWH 4L4TE 3NJFA 4S0TD 3RFRA 1BYPA 2NPLX 1BEYH 2ZP9A 3U9UB 4G7SB 4L1LA 3V6FB 1CBVL 1MEXH 5KVDE 4DKEH 1NGXB 1ZGLB 5IFAL 4MNHB 2E74C 5D4HA 3V10A 4YDJA 1VFOA 4LSFA 4P48A 5C0AD 3VRIB 3BJLA 3ULVF 4N58A 2UX7A 2V5TA 3EFFA 3O6LL 1GYCA 4FQLL 5ABAA 4UQBA 1F8TH 1JPSH 2XN9A 3L5HA 2P5WA 4X6DB 1IJNA 4ZUTB 4GPVA 5K9QI 3QWNA 3BO8A 2D31B 3BXNA 3OTTA 4JFPB 3V9CA 4Y4FA 5G38A 4RSVA 2VZUA 1TTBA 1XCQA 4DW2H 4UT7L 3RJQB 1OGAA 5HGGS 1ZHNA 4N0UA 3ABMB 4PYGA 3SGEH 3ROLA 2PCXA 4HOXA 3OAUL 4ILDA 1N4XH 4RZKA 4AYGA 4V1DD 2XTRA 2Z91B 4NWUH 1U8OB 4N1CA 3X3GH 5IG7A 4BFEA 3RIFF 4TOYH 5F9WC 1Y18B 2AK4A 4RDBA 4UTAL 1FN4B 2R1WA 3DWNA 3H8NA 1OTTD 4N68A 3VXMB 1GVIA 3AG2B 4MNQB 1F3DH 5IJCC 1NGYB 1IM3B 4UDUB 2KQMA 1BXWA 5DXWA 1KC5H 1BFOA 1RUKH 2FJSA 1ZHWA 3K8MA 2WLMA 3UZEC 4PJHB 2ZKHL 4ZTPH 1MCQA 3MLTB 3MNDA 1H0DA 2P48B 2FLRT 3RLSA 4BFIB 2WP3O 4A55A 1KGJA 5C6TH 4ACTA 1CBJA 1JV2A 3PDOB 3RDTA 2CMRH 1G7HB 2DI9A 4Q0XL 3U30B 5IP4A 3H3KA 5ISZE 2R1XA 3IBEA 3FJTA 4MS8C 1WCBB 1A4KB 1XXFC 3V0VB 3L7EB 1RJLA 1B2WL 2HVJA 2I69A 2F54E 5HDBF 4WWPA 1GZPB 3VMNA 4OUOA 1CGTA 3ML8A 3UJTL 1UH4A 2CALA 2GEQA 3H42L 3X13A 4JRXE 2GITB 1E4JA 1XH1A 1P7HL 2P5PA 1JWUA 4YHMH 2LHFA 1WVZA 4PJAF 3VWKA 3ARZA 5EOCL 3GNMH 4X5WB 3IFPB 1QG3A 5DR5L 1XF4B 1LWHA 4XMKH 1CR9H 4NP4L 5E8PB 1NLBL 3W1ZA 4DN3L 4QOKB 1TETH 5DVOA 4KOCA 5D1QC 5F7EL 4K71B 2QR0A 2NY4D 5BRQA 1TDQA 2VQ1A 2FAUA 3B9KA 4J4PA 1M7IA 1U8PB 2RALA 4QD2E 4Q7DA 2EDTA 3VM7A 5IESL 1KJ2A 3LS5H 4Q6IC 2UZPA 2NQDA 2QVFB 3T4YB 2K0RA 2W92A 2I85A 1IGTB 2VNCA 3KPNB 3VXQB 4LSQL 3GMMA 2P24A 4PV8B 5DJAB 3SE3C 3WIHH 1GYWA 3HR5B 3NOIA 1XHHA 3QHTC 4LBEB 1ANUA 3NSXA 1NC2A 1LD9A 4I9WE 5E94A 1E5YA 2WJ7A 3ARDC 5IJKC 3S35L 5F88A 4GYBA 5BS0D 5J1AA 1E7VA 3ES6A 3ARSA 2C3XA 2JXMA 4UQAA 3AROA 4XBMA 4FA8A 2X7LB 1CXIA 2G4GA 4GBXD 1CD8A 1XO8A 2QKIB 3BP6B 3I02B 4ZTOH 3UTZB 2CLRA 4K8RL 1QWNA 1FJ1B 1IILE 2ATPB 3Q6GH 1Q9LA 2JH2A 2P42B 4HEPG 4HZLA 4LHJB 4WW2B 4Z7QB 4HMEA 5HYJA 1WA2X 2NY5L 2X6BA 4DEPC 5KUMA 2GQHA 1XSJA 3N1QC 3V95A 1SZNA 5I66A 3RVWD 3EJQA 1U8NA 1T7WA 2GK2A 3NIFE 4HD5A 4PRPD 4D9RE 3ZTNL 3MRDB 4HJ1A 3ZO0A 5AW5B 1DCLA 5HYSB 3HFML 3O45B 4AK2A 3L3JB 4MJ6B 5M7QA 2R83A 4MTMA 4OCMC 4XPFH 4XXCC 1RZJL 5DJZB 4PCSA 4UV7H 4BFFA 3I3EA 4MAYB 3FO2B 4ABVA 1BQ5A 3FQ4A 2NLJB 4WY7H 4JPVH 4WSJA 1YLBB 3T8XB 3DYMA 2PO6B 1S9XA 3CDGA 5FAAA 2XWTB 3B8SA 3BGMA 2OYPA 1IU1A 3TPUB 1LO4H 4L3EB 3PL6C 3MLSH 2V2XA 1LDPL 3KPMB 3TA3C 4NJ9H 1KT2A 5J3HD 1UM4H 5IQ9B 2VLRD 3UIYA 3VFTB 5FUCE 4AEEA 2R4LA 3FXIC 3D0VB 5FK9B 1PG7X 1VADB 2V7HA 3BPCB 4L37A 3GWJA 4GLRI 1YC7A 2GB2A 4ANWA 5CSGA 5AKVA 4G82A 4O49A 3G6JF 4DVBA 1YMHB 4WI0B 4QRQB 1NCBL 3AA7A 3MBXL 3QQ3A 1WS8A 5ADXK 1ETJA 5D7JD 2E7LA 2NQCA 3GSNH 3NA4A 4YHPB 4YDMA 5E8EA 5DD3H 2BSSA 4N87A 1OB0A 1JNHA 4FQQB 3N1FC 2BNUA 1YO4A 5E99H 4NQUA 4PY8J 5FHAL 3HUJE 4PJIF 2YPVA 5AB9A 1I3GH 4WRLA 4U33A 2XYBA 3IJSB 3VXRA 3UTPE 4YHIB 4Z0XB 1HDMB 4N0CD 5I8CA 2B77A 2MCPL 5BW7A 3IS0X 2Q20A 3V6ZB 2F1TA 4RLDA 3MCLH 2VXUL 4N2AA 3OLIA 4MNGA 4ZMWA 4FT6A 3FUFA 2N59A 1J7VR 1JG9A 1KGYE 1JWSB 4U1JA 3B9DA 4K7PL 5EZPA 4GAYA 3OKKA 4N8CL 3FCGA 1A47A 4XBEL 5BO0D 5JIHA 4N2NA 3GLEA 2E9BA 4D0DB 3VXSA 3GMQB 4K7FB 4JG0L 5DQ9A 35C8L 2ZWNA 5DLML 1BQLL 1PY9A 3EO0A 1S7XA 4N1EA 1BZDA 4Y4HA 2F7IA 1FFRA 1W6LA 5E9DE 1A1MB 2NNAB 4Q2ZA 2MKLC 5DL8A 1XR9A 3TJHD 4F9LC 2OSWA 4Q9CA 4KI5D 4RX4A 4MDIA 1KXTB 1KXVA 3ULAB 3F7QA 4ZPVB 5AB1A 1MZZA 1RUAL 1VAHA 3LZFL 3T0ED 2CHWA 4JJ5A 4QUOA 1FH5L 3MMEB 5CS7A 1FLRL 2CUAA 4MAZA 3GHEL 1D5ZA 1WC7B 2NX5B 5GRUL 2C26A 1JRHI 2YAFA 1RAMA 1FDLH 2X9XA 4OCSH 3ZL4H 2Q5BA 3KJ4C 4JZOB 2OM5A 4N9GA 1KJ2H 3P9WB 2R8SH 1OOWA 1TPXB 4P2QD 1ZTMA 4ZUSA 5CEXB 3QO0B 1F13A 1UEYA 1SLUA 3FMGL 4O2FA 1S78D 2Y0SA 3C5XA 3WJMA 1UJ3B 2DQUL 1Z9MA 2BDNH 3ALPA 1DQKA 2YWZA 5GGQL 4I0PC 1V7NL 3CPLB 2GTQA 1DL7L 4OZHF 3W82A 1ZHZA 1Z5YD 4OTXH 5EMYA 3US1A 4WUUD 3V0GA 5DYOA 4RBPK 3ZTDC 5FHBL 2NY7H 3H7LA 3UABA 1ACYH 1KPVA 5I19L 4BFBD 2WINB 1P1VA 4E0RA 2YPLB 4U1MB 2VUOA 1MQKL 3G5YB 1N8ZA 3UAAA 2VN6A 5IK3A 4I87A 2EQDA 4D9LL 3VI3E 2BP3A 3D07A 1K72A 1VESA 4FE9A 2JIXB 5CBEB 4XGZA 3DA0A 5D1XB 5F3HA 5C86A 1T7ZA 3UAQA 2DH3A 1EDHA 1OEZW 5IR1B 4NN5B 4X99B 3T2QA 3JV5A 2AJZA 1RVFL 4KDTC 1QLFB 4DJMA 4F7MA 2FATH 1HHJA 2NXZB 1I53A 5F9JA 5EHFA 2EZ0D 4XB3A 2K7QA 1F4HA 3BSHA 4W9EC 4L3CB 1B0GA 4U3CA 4PS7A 3S88H 3POHA 4O4YL 1PYWB 4EOWH 1UWFA 3HE7D 4IS6B 3L5WA 1S8DA 5TDPA 4JRLA 4QGTA 1KFGA 1TJGL 2F5AL 4A1RA 3UJJH 1F6LL 2O5NA 4Y1AA 3WE6A 1DVSA 1ITCA 3W0WD 1UWXH 4P2OC 4AYID 5FO2A 2DWTA 1FPTL 3GZOA 1CFQB 2FYVA 4XBPA 3ZE0B 4R90H 2AC0A 4K94C 4AYBA 1XGQB 4JFBA 4AQEA 4F2MB 5I1HH 4NWTL 4IU3A 4YQXH 3OKOA 3APMA 1SLVA 3L4YA 5IROA 5B1JC 4CA4A 3MV9B 4F4BA 5J9PB 4F58H 4XMWA 4F7EB 4YAQA 3DX6A 4ZW3A 4B0MM 3OX8A 2BNQA 5E23A 4PRIA 7FABH 1WK0A 5D1ZB 2R4NA 3JBG7 3UJIL 4J3SA 2P80D 4QAMB 4PJGA 4N9OB 4A2FA 4P3WA 1CE1L 4JFHE 1DVTA 5FUZL 1JGLL 1AQDA 4IOSD 1FYTB 2YPVH 3QJFB 4Z8FH 1CTMA 2FWOA 2EE0A 4TVPD 1HOCB 4M1DH 3PGCB 3NH7L 3EJZC 4OIAA 3CN0A 1QABA 1DCEA 2ZOWA 4YSUA 1LEIB 3VFOB 2BNRE 3B2VL 4C56D 4X4KA 4N8PA 1F8TL 3A4FA 3PXHA 3SPCA 4OLZL 4BELD 5I1JL 2Y0LA 3A4AA 1Q94B 4XC3H 4IHOA 4JAMB 3I2CH 3N40P 3MOAL 2JMRA 3WEXA 2Z92A 1QSVA 1PLCA 3K4ZA 2BZCA 3MRPA 4P07A 1NGZB 4J3UA 2VZSA 4UNUA 3VQMA 1EGJL 4QT5A 1MCWM 1MDAA 4DN4L 1TZOA 1KB9K 1Q9OB 1DBAH 1S7TB 1Z0MA 2X70A 3QJRB 4QKXB 4HJIA 4HKZB 4O02A 3QEQD 1SJHA 3GDBA 3UDWA 1J1PL 3S37L 4G1EB 3WIFB 5L9DH 3BDYH 1KCSH 1WEJH 2EYRA 2JWYA 3NRPA 2V2TB 1A7QL 3QIWB 3VXOB 4QRTA 3O3UN 1CVRA 4IRJD 4HW6A 4P06A 1WG3A 4ODXA 1N7ML 1TZAA 2JKIS 3RZWA 1GZQA 2WQRA 3BAEL 5DVMA 2A4EA 5L8LB 4QAWA 1D6VL 1Y7VA 5IVZA 5I30L 4P57A 4I4WA 4DP0X 1Q0XL 2W9DL 1N6UA 4TNWF 4GI6A 2K9UA 2DQHH 5SWQA 2D2OA 3NCMA 4AKRA 3N44F 1SY6H 2X2HA 5MI0C 2FCBA 4HJJH 2FBJH 1N2RB 1T3FA 4JO5A 2VZVA 2Q0ZX 1O7DE 1GOHA 2CBTA 5DMIL 1T0NA 1BQSA 5FKPA 1OAKL 3P4LA 4Y2DA 1XF2A 3E2HC 5AW8B 1ADWA 3ULUD 2UWEB 2OPCA 3SBRA 3FO1A 6FABH 2DM4A 3CC1A 5FFGA 3N04A 2MIZA 4L3AA 2N01B 3T4AA 2HFTA 5KYUB 2WXLA 3DWOX 2PPDA 4WW1B 1VACB 4QHLB 1I3VA 1LE5A 1FHNA 5DZVA 4MXWH 3QZWA 2BY3A 3GO1H 5DJ8A 3EAKA 3WNMA 2JK5B 3CVIH 1DEEA 1ZDQA 4K23H 4PJ9A 5F89B 5JDJA 3D33A 2VMEA 2XJLA 1NGWB 2Y2YA 4PS3A 2J5WA 1J0YA 1HHIA 4N2OA 2GJ6D 3KDMB 3O2DA 1YNLH 4GMTL 5J1SC 4NYLA 1S9WB 4J2XA 4XMPL 1TYRA 4E42B 2H4EA 4F8PA 3M1BA 4WU7B 2VIRA 3EFOB 3S36X 4KO9A 2XT1B 3BSZL 4ERSH 2WZ6A 1T22A 4YXKH 3SZVA 3EHBD 4G1MB 3VY8X 1K5NB 1FNGB 3DPBA 2VW6A 3GYRA 5T3ZL 5ANHA 2MQ3A 3U4BL 2OMUB 2CIIA 3B9AA 3QULA 3APFA 2H6PA 4Z5RB 5F3FA 5K9JL 2C9XA 1TUPA 3UP6A 4QXGL 5F96H 1F4XL 5C07A 4MAUH 3POUA 1OHZA 3FB7A 4JFDE 3F5WB 3SJVB 3M6DA 2AKRA 3ZDZE 1G9MH 4OF8A 6PRNA 1F18A 2R56H 3QDGD 4M5ZH 5HPMB 3LPPA 2G5BA 1S7VA 4MQ7B 3Q6GL 1AR1C 3KVQA 3CX2A 1JPFB 1E2VA 1NCUA 4RSYA 1D5XA 4PGEA 3CBKB 5KSUB 4XPGH 3WLWD 1QATA 5F1NA 1V5JA 4OFKA 4Y5VA 5K93A 1MCCA 3INUH 3QW9A 4J6IA 5I1EH 5C0EB 4A6YL 4OB5H 2PTTB 3UTQA 2PWFA 2O6PA 4DAGL 4FQXB 1ZT4A 2HRHA 2XA3A 1NCOA 1KNOA 2WBXA 2EKSA 4JKLA 3BP4A 2XN2A 4LPWA 2DQIL 4NKMA 1BPVA 1JVLA 2BP8B 1S7UA 1EH9A 4DF9A 4Y4KC 4FQ1L 1ZT1B 3VNYA <