4Z3TA

Meningococcal factor h binding protein mutant l130r/g133d
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
249
Chain Sequence
RVAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQIEKINNPDKIDSLINQRSFRVSDLGGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A meningococcal vaccine antigen engineered to increase thermal stability and stabilize protective epitopes.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Factor H binding protein variant A10_001
total genus 66
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4z3tA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z3tA01
3PQUA 2Y7SA 2YPVA 4QQ1A 2LFUA 4O4XA 3KVDD 4O3YA 4AYNA 3UAQA 2W81C 4O49A 3PQSA 2KDYA 3VE1A 5T5FA 5EE2A 4O4UA 2KC0A 3V8UA 4AYMC 3HOEA 4AYDC 2W80C 1YS5A 4U9CA 4AYEC 4Z3TA 4O3WA 3VE2A 4O3XB 4AYID 3HOLA 4O3ZA
chains in the Genus database with same CATH superfamily
1S7SB 3F7VA 5GRUL 5ESAB 2DQIL 2Y0KA 1ZS8A 3D2UD 3CZNA 4XX1G 2NY3C 3NJFA 4BM7A 3JWDH 5E2TH 1YRKA 1IVLA 1VGEL 3BFOA 3K7UA 2AJVL 4PR5A 4ACPA 2BRRH 3FRPG 1OLLA 4Z7UE 3QZBA 3WNNA 1S9VB 4FFVC 4U1KB 4I5BA 5D71L 2BZDA 5A2FA 3UACA 4PRBA 2JI1A 3B7RL 35C8H 4FQLL 5EOCJ 3RPIA 1DQDL 1LDPH 4Q6IA 1MJ8L 2G3MA 4ERSH 4Q9QL 2EVIA 4RJXA 3NCYP 1HL9A 4XVSH 1X5GA 3VG9B 5HHQA 1WTGT 1FVCA 2CALA 3L1OH 4HXBL 4MJ5A 3T8MA 1UWGH 4NZ8A 1IL1B 4D5UA 1E3FA 1KCVH 2L7EA 1B6UA 2C3WA 3ABMB 2BIOA 2HRGA 1W0VB 4PJGE 4UT9A 2HJFB 1RUMH 3V5HB 5DJZA 4PWIA 4LDCA 4M48L 3VH8B 3NCXA 3B9KD 4LVHB 2H2SC 5F1IB 3GSXB 3EH2A 3PP4H 4HGWA 2J8UB 4IHOA 4Z7OE 5GGQH 4HUXA 4C47A 3BVVA 1BF5A 5CR1A 1YNTA 2DTMH 2EJ1A 3HBZA 1G6VK 2KZBA 1U4EA 1T83C 1OD7A 4JRYD 5IY5B 1ZAGA 2K78A 4WI0A 2O6EA 3MLVH 5MEND 3QH3B 2DWYA 2J71A 3ZKMD 4BFEA 4IIZA 2ZONA 2YRPA 2AQSA 4LESA 2DLFL 4X5RA 4GSXA 3FFCA 1R0AL 1QWUA 4TUKL 5B3NA 2I07B 1JZ8A 1LQSR 2VDML 5A7BA 1KLUA 1NFDA 3CN1A 4K9EC 3OPUA 2F68X 2FCBA 2YN5A 3VXSB 1QSEB 2YUWA 2HFEB 2F54B 1L9SA 3MR9A 2VRAA 4TNVK 2A1WL 1OTSD 5EZLB 3ROOB 2LU5A 4HUXB 3ILDA 1XBDA 2EIEA 5JR1H 1G0YR 5B3JE 3FAWA 2R0WH 3WIFA 3FQWB 2ROXA 1AGEA 4Z3FA 2HJFA 4U0RC 5CJXC 4N2DA 4F7EA 3P9LB 4I18B 5CN1A 1UKTA 3GB7A 3GZQA 3ES6A 3UJTH 3B5HA 4FKKA 3SKOB 3WTXA 4K8RC 3RJQB 2XZQH 3ATBA 1BQUA 1MFEH 1B2YA 2BDNH 3LKPA 4OKVB 3SKNA 5LDSA 2CKBB 4QRUA 2LT9A 1CFNB 4WFED 2ZOTA 4TVPH 1LTXA 5IQNA 1TVDA 4P99A 1JGUL 3RILA 5E6RB 5IEHA 2EVFA 5BMFH 5I75C 5FGBC 1FLRL 3LK42 3QEQD 4PI0A 5CLYA 1CDGA 3AROA 3FO2B 1MY7A 2V5SA 5SV4A 3SE8L 2A2QT 2YMOA 3O81A 3VU2A 2L0DA 1NJ9B 1HL5A 3IJHA 1EXUB 1EJ8A 5I1HL 2RQEA 3NEXA 1ZIAA 2GE4A 1MJUL 1ZIBA 1IKNA 4JDEA 3AQDA 4Z7NF 4ZPVB 3T24A 5FHBL 3R0NA 1XCWA 4MCYA 1VDGA 2D2OA 5DRXA 1MCLA 4YLBA 4GAAA 4KPHL 5DQ9B 2NNAA 2R2CA 2OL3L 5KYNA 1TFPA 1L0XA 2W0PA 1W0WA 3DURB 3MJ9A 4D8PA 4JMXA 3TEWA 3ARTA 2CUHA 5I5RA 1Z3GH 2OLDA 1BDYA 3QUXD 3S5LA 3D3VD 2EEXA 3OGCB 5AYUH 2X5PA 8PRNA 3HC3L 1JMZA 5TDPA 4OUUB 3HWBA 2HLAA 3NJXA 3WSQL 1EJOL 2BWDA 5DEGA 3EO1A 3HZYB 2FO4B 4GPVA 4UTCA 2OFQA 3NJTA 2OKMA 1W16A 5T1DH 1XSJA 4H88L 1U8JA 4GQ9L 2UYLB 1KIRB 1UOVA 2OM5A 5HVWA 1FH5L 1AGBB 2R4SL 2QQQA 3C09B 3CSBA 5IFJB 3QG7L 2FRGP 5HGAB 4E41A 3AQXA 4BE5A 5GHWH 3ARQA 5JIIA 1MW3A 4EVNA 4JN2A 4P4RB 2GBTA 1NGXA 2C7UB 1HZLA 2GJJA 2QDWA 1DVSA 4L1LA 3TZVB 3IDIB 1TEFA 4GCSA 3MJ9H 1EZLA 4FG4A 4KTYA 2MOQA 1ZA3A 5IB2B 1WE5A 2VZUA 2OJEA 3CDCA 2CLVB 5F0PB 5DHEA 3EOBA 3KXFA 2XTJE 4UAOB 1KUMA 1OAQH 1GYAA 4HVBA 4KHXL 1XEDA 2VC2B 4EUPG 4FMFA 2HVKB 1E6JH 4NN6C 1Q9GA 4FRWA 4NQED 1C12B 5LGKA 3LKSB 3BZEB 4WUKH 1JVLA 1RLWA 2XUWA 3N06B 3VXPA 4AUYA 3F58H 1RHHA 1BVLA 1TQTA 4L4VE 4ZFZA 4BDVA 4JPIB 1VZGA 3BRYA 3L45A 4NZTL 4BRJA 5T1JA 5TQ0H 1IARB 3SYSA 2KQNA 2UXFA 3HOEA 4XX1E 4YHIB 1IBYA 3P73B 4AEHH 4UMSA 3MLYH 1LHZA 1M1SA 3F3HA 4NB7A 4JPWH 1RP9A 2JH2A 5F88B 1UYWH 1KNOA 3L4CA 4PWFA 3OKNA 3HOLA 2FUQA 1CD8A 1F8TH 3J7HA 4G9DB 4JM2B 1G9NC 2ZE0A 4A6YA 2JLLA 1XDTT 4FADA 5AZ2H 4OUOA 4A7SA 2HYMA 4BKSC 1HNYA 2X4QB 2NNCA 4HKZB 1CDUA 1IM3B 4X6BA 4BWTA 2IH3B 5FO9B 5EFIB 4LGPB 1E9QB 4BQ8A 4AQEB 3IJYB 3N42F 4TQEL 1IE5A 1ORSB 1Z9MA 3LD8B 1KOAA 4V2CB 1WBXB 3PXJA 1EO8L 1WZ1H 3GRBA 3ZYOA 4L4VA 5C3TA 4MBOA 4P23B 2IOIA 2XFXA 4PLOB 4PVNA 3ZE1B 3T65B 1YPZA 4DCQA 1PDKA 2M26A 3DYOA 3QUZC 5AKVA 1L9QA 4FQHB 4DUXA 4AFKA 1Q9KA 2FGWH 3GLZA 3TF4A 4IOFD 3C6LB 4XNZB 2AV1A 2VKXA 4OGYH 4X4XA 2VJ8A 4YHNB 1NDMB 1FZOB 1Z5LA 5DWUL 5BRZB 5EEWA 3QYCA 4FTVE 4MWFA 2FO1A 3VGHA 1XF2A 4ZQKB 5MEPB 3QPQC 4L3EB 5FKAA 1AR1D 2HX9A 4BZ1L 2WQ8A 3H3BC 4HLZH 2AJSH 2GTZA 4P4KD 5C0RH 3BH9B 3QFJA 5DJ2A 3Q6GL 5FYKL 5GS2D 5AFUL 3WY3A 4KDTA 4CILA 4D94A 4L29B 3ARBD 4MHHG 4P0DA 4F15B 2R4NA 3TJEL 4IBQA 4ZNEA 3JTTA 1U3HD 4WUUA 4Z7OF 5ABDE 1NCAL 3FHQA 3JQOB 4IMKA 4UTAL 1CLVA 4G6AD 2O5ZL 4ODTL 2TRYA 3CUPB 4WWID 5CO1A 5C08D 2ZOOA 1BAFH 4DQOL 3D4ZA 2G30A 5EOCL 1SDDB 1AP2B 2E27H 4S1DD 1N7MH 4HDIA 2ZX6A 4OVVA 3C60C 4XCEA 2KXPA 4FYSA 3SCMA 3VGFA 2Q8AL 4B61A 4O02L 3OZ9H 4RBPH 1HU8A 3CSGA 2Z6FA 4HFUH 3OZLA 1IGFL 2XA8H 4OCRL 2EVJA 4XNUH 1EFXD 4RAVB 3LEVL 2EYRA 4OIFA 4AC2A 3SKJL 3TWYA 1ZMYA 2OW7A 4DZBA 1OHZA 3LSOB 4UT6H 2VMDA 4K5OA 2ZYHA 2AI0H 1FVEB 3QIUC 1WFOA 3OWRA 1JXDA 4FZMA 3NZ8B 2WXFA 4F7PB 4HZAA 2ICCA 1SF5A 1U58A 2F5AL 4YHKH 4JGNA 2NY2B 4CVWA 5K59E 1UVQB 1Z5HA 1EHXA 4EDWH 4XP9H 2AFNA 1QA9B 4JX0A 3DMMD 4B0MB 4HX1B 5JW3H 2J25A 2VW7A 4UCFA 2OMTB 4YOKA 1WICA 2QPUA 1QSED 3FULA 5I8EB 1AGDB 3D4GA 3BRDA 3OR7A 3VXSD 1G1CA 2G3NA 4XMLH 2ZX7A 4GSUA 4MJIE 4MJ6B 1IB5A 4FL4C 6FABL 1T1WB 1CI3M 4GIPD 5J89A 4ZQKA 4TSAL 4WY7L 4M7JL 4Z7VE 1XSIA 5D1QC 3T6VA 2P5EA 5KJ4A 5BRZD 4QYOA 3MROB 1ZPUA 3ZMRA 3Q8BA 5MENB 2EXWD 2WLLB 1AACA 4F37K 3O11A 4M5YH 3T9WA 3B9EA 3VXMD 2WD0A 1ECZA 4JRYB 1B0WA 2DBLH 1CQKA 3GSQA 4UT9H 3WN5C 1BD2E 5I28A 4EXPX 3IMSA 5I1CL 1RULH 4OCXL 2EILB 2ZG3A 4QKXB 3T8XA 1YYMH 4NLAA 1MFMA 4R7DA 5AYUL 3GBNH 1FVEA 3F7QA 1NMAL 1XXDC 3IAQA 1CDIA 3EF4A 4QRSB 3LS4L 1DQJB 3QE5A 2FEEI 2Y24A 1C7TA 4M9PA 4JM2D 3PY9A 4ENZA 4XAKD 3ARPA 1TZ8A 3ARBA 1KGJA 3G7GA 3KH3A 1N4XL 3TWCH 2RR3A 4PH8A 5AW2B 1KBWA 3ZHFA 1MELA 1HDMA 4XH2A 1ZXKA 3O4LA 2PWEA 7PCYA 5C09A 1W72B 1ETA1 5DFTA 4OH2A 3VYNA 2P48B 1ZLVK 1V5JA 1WO2A 1V10A 4ELDA 1UA6L 2QGDA 3D2UB 5D5MF 5E94A 4U3HA 4YLCA 5AAMC 2Q6WB 3P69A 5DEZA 4ZI8A 4AW4A 5F7BA 3CZUB 4YDIL 1HHJA 2E86A 4F3FA 5JPNC 3C5SA 4ZFOB 5I8CA 1OSZA 2ZUSA 2XY1A 3KHQA 2N1KA 4LSUH 4UB8O 4OZGF 1B3JA 4MQXC 3QNYA 4PM1A 3VDBA 2X09A 1T6VN 3UC0H 1RU9L 4MXWH 4RX4D 4P9HH 2X4QA 4FDWA 1MUJB 5IW6A 5L4JA 3ZJAA 4RGOH 3ESMA 1BEXA 2NW3A 1A1NB 2EE3A 2JKLA 5KN5A 3OPZH 2EIBA 3K8KA 2AITA 2H32B 2NW2B 4G71B 1JYNA 3QEGL 1WFTA 1MQ8A 3BYYA 4PG2C 3T3MF 1G9EA 4B0MM 4GG8B 4UDUA 2YEQA 5IYUA 2XQBH 4F37F 5BOZG 4NPYA 4LCVA 5GGUA 4ODHL 2VRQA 4BE6A 1BM7A 3QARA 4LDOB 1GYVA 2X4PB 1LE9B 4NO3B 5GZOA 1JHKH 3TA3C 5KSAA 2HH0H 4M9OA 3GTTA 4X6EB 2YD0A 3HKZA 2QFPA 2WZPA 2NNXA 4PJ8C 3OAUH 5IHBA 2WO3B 4CVZB 3ZW3A 4HHAB 3I02B 3V95A 1MZYA 1OT1A 3GXIA 4ONOA 1SXSA 4RAUA 5HI3D 3WKPA 3D18A 4O9HH 1A1OA 4NAQA 5E23A 4JHAL 3CNKA 5T5FH 2K6ZA 3CDZB 2BWQA 4JFVA 4QJ5B 1Z32X 3SYBA 4FYRA 4B60A 4MDRA 5E1QA 3LRSB 2Q7NA 1P7KB 2D3LA 4Z8FL 2EVGA 5AAWA 3RWEA 3JXAA 4KUCD 5AB1A 1INDH 3PWUB 1EWHA 4BK5C 3UJJL 4K7PH 5DI8B 4TUJB 4UQAA 3OKLA 1U2CA 3MMEA 4KKPA 4CC4C 1BXXA 1F4WH 2YAHA 4YHOL 1OB1B 1PLBA 2GTQA 1FZMB 3AWEA 1CF8H 3K6DA 4UIKL 3EZJB 1BM3H 1NCCL 1KCLA 4MNGE 2H1PH 5E8DL 3TJEH 3VWJD 2N56A 2WTRB 2HA1A 4RNRA 3NVQA 3SDCA 4DW2L 4J8RB 2WVSA 1MHCA 4QHPA 3EJYD 2X38A 2YPVH 3EXJA 4BZ2A 3FOMB 2GJZB 4YFLF 1HOCA 2FR4A 2E6JA 5CZXD 3K1KC 2V3DA 3ZDZB 1UM4L 4EN3C 1N12A 3K46A 1T5KA 3C75A 1MFUA 3GSUA 5F1KC 5HDQL 2BVPB 1NBVL 5BPPA 3NESA 2D0FA 4JKLA 2H6PB 3AAAA 1BJMA 2J8UF 5F9JA 4OZIE 2XA8L 4OCSH 1XIWA 4JG9A 5GGTA 3W39B 5DEGB 1D6EB 2VDOH 1BFVH 3DUHA 1SOQA 2A77L 2APXA 3C6SA 4UU9A 3MJWA 5TDPB 4ZUUB 5E08L 2OI9B 1TQWA 2QVTA 3LMJL 5A2CA 1IGTB 2DLEA 2ZXEB 3ULVL 4NI3A 3K6NA 3BAIA 4YBQC 2LTQC 4Y5VC 3KL5A 1GH7A 1XEUA 2ZUYA 2XTJC 3ZYIA 4Y19B 4QRRE 3GSNA 3SO3B 3B4NA 3FQ4A 3O2WH 3QDGD 2YD9A 2VXVH 1ECYA 4JMNA 4GRWE 4M03A 4N58A 2APFA 3KYNA 4JPVH 2APBA 4KMTH 4MLIA 4JRYA 4FZNA 1ZVSB 2XWBA 2BJML 5AEAA 1QFPA 3SYPA 4WWKC 1Y6NR 2VC2H 4F57L 5LQBH 3JYCA 4Y5XA 5F7DA 3MV8A 1ZWIA 1PJ9A 3D87B 5EBLA 4LLAA 3BKCH 3BSZH 5HP5A 2WXQA 1WZKA 4KVCH 3DX8A 4LPWA 5F3FA 3GK8H 2ZP9A 2XQYG 3QFDA 4Z7NB 4FE9A 2DQCL 3BH4A 2EUXA 1T4KB 1USZA 4Y16C 3KAAA 2XN2A 3A6BH 5J13C 1DEDA 2MQGA 3MRFB 3O8XC 4FA8A 4MDJA 2PLTA 5I1CH 2I7OA 4QRAA 1AHWA 5H94B 2NY4C 3Q9PA 1BF2A 4UYPA 3SOBL 3MPCA 4KQ0A 1SVCP 3W3BA 3QXTA 1NDGA 5KW9L 1MFCH 2O6CA 1B4JL 4HK0B 4NRZA 3P11L 5FM5O 4DGYH 5C2BL 3MLXH 3OKMB 1BMGA 1PY9A 3QRBA 3HPJB 3V0VB 2B3IA 1IZNB 2D8KA 1HH6B 3L3IA 1CLOL 3BVNB 2ZKMX 1CGSL 3POQA 4E41D 2DH2A 3E1ZA 2XWJA 1S7XB 3GJEA 1LP9F 3D39D 3RP1A 4GNKB 1D5IL 1IEAA 1WBYB 4BEIA 1ZGLA 1I1AC 4GT7A 4J1UB 1SEQL 4TNVF 2HT4C 3MRLA 5L4MA 1X5HA 2O93L 3H9SB 1ADWA 4POUB 3MDJA 5KVEH 5EF3A 3S35X 5IBUG 3APNA 3MODL 1U8CA 4MA1C 4N24A 2MEJB 4BCXA 3IS0X 2FT6A 4KO6A 4N3UA 5I82A 2ENQA 4BK4A 5KTEL 3GKZA 2ZKHL 4Y7OC 5IW3A 4HK0A 1DJHA 1F56A 3PWPA 1THCA 2PR9A 4PVLA 1YSOA 1F58H 3PQUA 4ZS7H 2VJXA 2CHNA 2PW1A 4ATWA 2ITFA 2XYBA 4JANA 2BSTB 4NXSA 4U1LA 3T4AC 3KYNB 1RFDH 4Z7VF 4EIBA 1UA3A 3A23A 3C2SA 2WUBH 5EN2A 4RFEB 4WJG3 4G70B 4X5XB 1RJCA 2FT8A 3DJSA 5F7EH 5L6YH 4WV1B 3HUJE 2J21A 2R0KH 2WXPA 1QZNA 2WKGA 3WNIA 3FJTA 1HHGA 1R5VB 2J56A 2EUZA 1TO4A 5TQ2H 1M7IB 3NRQA 1LEIA 2BHUA 2MQ3A 1O75A 2I69A 2X53A 3MBXL 3PWPE 5DS2A 4NN5C 5I1DB 5IB3B 1UXSA 4JBSA 1DSFH 1S78D 1PEWA 1YEFH 2UYLA 2UVEA 3UERA 3ILEA 4Q9CA 3D07A 4N9GA 4OD3H 1RMFH 3T2OA 4DQAA 5A16B 4GSDL 5FB8A 1T3FA 3BUYB 2CBOA 2XKNA 1IKOP 3LK3B 3ETBF 1ZT1A 5IMOB 1KLGA 3FXIC 5JW5A 1N5YL 1JTOA 3G6DL 1BX2B 4LCIL 2FHCA 4FFWC 3QHTC 4PGCB 1HAWA 3GUTB 1PX8A 3WUZA 5EF0A 1ET5A 4O3XB 1U8NB 3DGCR 1F90L 4ANVA 1XTLA 2P24A 1NLDL 4CSTA 2JSFA 1DE4A 5HYEA 1DO6A 1OGPA 3P77B 2QZQA 1EJFA 4QRRB 5HDBE 3ULUC 3PF1A 4XOCA 4HUWB 3TV8A 4AIZB 3FN0H 4EZMA 2JCWA 2A74C 5FC9A 3X14A 3PQSA 3FNKA 5DEJA 4A2DA 3UYRL 4NQCD 3ZUCA 5JO5B 3RWJB 3ZQXA 1RUKL 4WNQB 2ITCA 3VXRD 4EQ3A 5CCJA 4MBRA 3VXUA 4WO4C 3BUDA 4ENED 3UTPD 2PORA 1P5UC 4IS6A 4AKRA 3SPJA 1AG6A 4LCYB 3V6FA 1I7RB 4AZLA 1KTDA 2NMSA 3KVPA 3V4VB 4R4NC 1EHLL 3RQ3A 3OKDB 1CXKA 3H7BB 4ZX6A 1R33A 2GY7B 4LU5H 4LSDA 3ZDZE 5TF0A 2R0WL 3K4AA 3CZSA 1IC0A 1XAKA 1IFRA 4ZFFB 1FFRA 3TO4A 4OKVA 2HT2C 2NY0D 3DARA 3DRTA 5E9DD 1JNLL 2IBBA 4ZUSB 4MNGB 1I7ZA 4HUKB 3MUY1 4R97C 5CP3A 1UT9A 3LQAL 2X6BA 3FTGA 4TUOB 2EVHA 1OP9A 4YL4A 4CDHA 3EO0A 1OSPH 3H2WA 3ILQC 3VRJA 3FT0A 5JHDA 1KTBA 3MRRB 3PJNA 1XD1A 2ITEA 2JKRM 4H1LH 3LIZA 5D1QE 5EN3A 5F72S 1MPFA 5GRUH 5HHOB 4LVHC 2UXGA 2DQIH 3P77A 4U6YA 4QRRA 1WWCA 3W0WA 3LMJH 2E7MA 3BUQA 2YIHA 5EEYA 1E90A 2XVBA 3MV01 2ZWKA 3NJMA 4R90L 2JB6B 3UJIL 1FSKC 4NX0A 4YXHL 1BX2A 3ARGD 4RQQB 5F2FA 2ZYIA 5FHBH 4U1JB 4KMTL 4AEIH 3K72A 2WJ7A 4NO3A 1KF9B 3BUYA 1GS7A 2B14A 1D5BB 5DL7A 4Z5RA 5JXEC 4FQQB 1WA1X 4YO0A 4YHNA 5DZLA 5F7FA 4BHUA 1WEJH 4HS6A 4ZW8A 2BCMA 6PAZA 2WWMC 2WXIA 3CG8A 3D2UA 5E94B 2W81C 2ZCHH 3BSZL 2W92A 5HGGS 2C5DC 1PJWA 1QSZA 2J5WA 3A67H 5KN5B 2XVLA 3MLTB 5I30H 2ZKWA 5GJTL 2Y6SD 1PFOA 4HGWB 2QTKA 1NIAA 5D2NB 1YZZA 4F8LA 2R9HD 1TT6A 1BFTA 3R18A 2JK5A 3SE8H 4JZNA 4G9FB 4XPTH 2A73A 1P6AB 3JT2A 3ZHDA 2VSCA 1FORL 3HG0A 2YRLA 3LZFL 5FUCC 4DP2X 5D4QA 4XWOD 3MLSL 4M7KL 4PRPA 2OMUB 1A4AA 4ZNCD 1PD1A 1EJ6A 4RDQF 4BBWA 1A6UH 3ASWA 3KM2A 4IIQB 2O61B 3GLDA 1R47A 4Q9BA 2RQ8A 1GZPB 3ZDYF 4S1QL 4ZS6C 3CCHB 3D1MC 4ZOAA 5DFAA 3F12A 3ERXA 3UBXB 2W9LA 4GRLC 2Y07L 4UILH 4EXKA 1YY9D 1Q4NX 3VDAA 3RWHA 2XRAL 1U8MA 2XNAA 3BH8B 1A7PL 1NWOA 1QNZH 1C12A 2VLRA 3H9ZA 4ZAKC 2BC4A 5AVZB 1XZ0B 1FZKB 1Z6JT 4L9LB 4ALAL 3O6MH 3UGUA 2OV0A 2XWTA 1QEWB 1T0OA 3MV8D 4A39A 2GSGB 2OJEB 3IN2A 1VF5C 1Q9LA 1MRCL 5AW1B 3I85A 5TPWL 3ZHNA 4FLHA 4OD1H 4OTXH 3BVTA 1AGDA 3ZE0F 3RVTD 1JHLL 4ZRGA 3T2QA 2CA4A 2Q0ZX 2C9AA 1DL7L 1WWAX 3WXWL 2YJLA 1FFOB 3A47A 2PW2A 5IM7B 4DN3L 3IU4H 1O9VA 4N75A 1QWNA 3AA1B 3MTXA 2BVQA 3L9RB 4UV4L 1IT9L 1JNNH 3CQFA 4XMKH 4M7LH 4AK2A 4ZNEE 1KCKA 1AD9A 5JHAA 4KK9C 4G8EB 2UXTA 1F6FB 2DQTL 3Q8EA 5D93B 5E99L 1JTTA 2IXQA 4PAZA 1AO7A 2P80A 3AQZA 3S0PA 1AQ8A 5HJDA 5GS1B 1MHHA 3UTTA 2OTWA 2R7EB 1MXGA 4LOFA 1ITCA 1NUDA 3QEQB 5C0FA 4L4VD 1DVFD 2FEJA 4LKXA 3ZQ9A 4K94C 2AJXH 5T33H 1RIUH 4Z7VB 4F2EA 1UXWB 2FIRT 4D8OA 1J9RA 5B1JC 1R3HA 1CR9H 2ADGA 5AKRA 4LFHG 3L2LA 3FYIB 1OP3H 3SBQA 4FSPA 3QDME 4JZJA 2NTSP 5L4IA 2YKLH 1KYAA 1GFPA 3IGFA 1E4KA 4Y1TA 4U6HA 2NNFA 1SN2A 5D6DC 2DMGA 2AXFA 1RPKA 4JG5A 1QBLH 2H2SD 5FOJA 5C0CE 4FEIA 1ZS8B 3ME0A 4MAYC 4HAGA 1NUNB 1JZ4A 3RFZC 4DFHA 1E27B 3OKEA 4KXCA 3FQXB 5JA9A 1ZD6A 4PJDB 3HG3A 4MMZB 5L8KB 3OVUB 1J8HA 2E9BA 1QHQA 1U8MB 1MLCB 1ZHBA 1JYVA 5FECB 3QIBB 3HNTH 5G39A 2EZ0D 1BOYA 3QULA 5IEHB 3Q0HA 3A3YB 1GZQA 1DFBH 4G7VH 4OKDA 1HL8A 2Z64C 4N1CA 5GGSB 5IVNA 5ILTH 4PS4L 4RJWA 2R1XB 3KS0J 5DXWA 5IWLA 3C8KA 5GISL 1OIOA 4FXTA 3TS8A 3DTUB 1EHNA 3C5OA 4KKLD 4P57A 5CWSA 2R0ZL 4GOSA 3P0VH 4FKEA 5KAQG 3QUXB 1USQA 1V7ML 4XO8A 1BVKA 2NRDA 4MMZC 3DOHA 1F00I 1E2ZA 1JZFA 2IVFC 4HJEA 4AWJC 5AALA 1DN0B 3LQAH 5BXFB 1CFTA 3S8GB 3VXUD 1FN4A 3RUGA 2ZXAA 1TVBA 2BVYA 2J1WA 2EEDA 4L8SB 4QXVA 1JYXA 1N19A 3PDDA 2ESVB 2J1XA 2K45A 1UT2A 4H20H 5ID1B 4XP1L 4ZQTA 1F5WA 5DS8A 3ZKXB 2GQHA 4HPOH 3CFKB 5L2KE 1SJMA 3HPJA 1ZOXA 5AVRB 5HYSB 1FL5B 4B27A 2DIBA 2VL4A 4YHIA 4HS6B 4KKAC 2R83A 4NRZB 3RGBA 1Z9LA 3EFDH 5F9WB 2E7LA 2GAZA 2HFFA 2O6DA 2BNUA 3WENA 3DRQA 1CB4A 3FZUC 3HRPA 3KLAB 4IGBD 2VXSL 4QXGL 2K6WA 3OQ3B 1X7QB 2YAOA 4P3CH 2CHDA 4Q0XL 1BD2D 1UURA 4XN7A 4HKZA 1UWXH 1J0KA 2P47B 3FTZA 3SGJC 2VQ4A 1I3GL 3NIFB 4JREC 2JJSC 4JM2A 3L5HA 2EDHA 4QHKJ 3WUWG 4RESB 3ZKXC 1TJIH 2H3NA 1ZCRA 4WWOA 4HS8H 4IRJC 1KACB 1AGCA 1A14H 3FT3B 3NJIA 4NUGH 1S8DA 2O5XH 5CCGE 4OCLC 5DVMA 4X4XB 4ZTOL 3PGCA 3CN0A 2EDOA 1KXVC 3TONA 3FW6A 4OGXL 1A6WL 1KCSH 4ZMLA 2I25N 2VQUA 1TVBB 1K8DA 5T5NF 4BZ1H 1I85C 4AJVA 4JY5H 1DN0A 2VDPB 3BP7A 4OF3A 4C4KT 2VSKB 4JDVA 5E95B 3RFZA 3KWVA 4I0PD 1A25A 1QSFE 2WWKT 3LN5B 3TVMC 1L9TA 2D4DA 3HHSB 4AVKA 4GG6B 1AXSB 1E9QA 1FNFA 1RIVL 1J9SA 2YOCA 4HZLB 5CLXA 1A6UL 2HWZL 2W0KA 1GMEA 2Z4QB 4E5XG 1IM3A 3QRAA 1V55B 3QWOA 5GRVL 2E9GA 1JUFA 4PJIB 1RZJL 2R1XA 4X8GA 4EIGB 4Z1PA 4FQJH 4A6YB 1U2YA 4X80H 1SOKA 1FIEA 3IGAA 3VZTX 2JTDA 5IVXF 1QBBA 3QEQE 4K15A 4NIYE 3HBQA 1N10A 1D6EA 2C9SA 4GP4B 4PREA 3L4VA 2A9NH 5GPRA 1WZLA 2YRBA 4F4BA 1MAKA 2VZSA 4Y0GA 4NNPL 3VFNB 4BSWA 4U1GC 2AEPH 5E6SB 4AYMC 4JFSA 1KCUL 3PLYA 1G6RL 4U3SA 3VXMA 3OHXB 4ICXA 5E4AA 4JDTH 2CRIA 5EO9A 3HLKA 15C8L 1PQZA 4AIZA 4YIQA 4BXVA 1T66C 1TO5A 2IAMA 3QIUB 1YEEH 4Q6YA 2DQDL 5ECGA 4ZYKA 3CAFA 3GHPA 5E5LA 5AZEL 4JW3A 3ULVC 1FG2B 1OTUD 3D6GA 5KYWA 4PJCF 4ADJA 3HLAA 5L2JB 4JO1L 1RPQA 3NP3A 5C9JB 4NUJB 1JPFB 4S1RL 4CTDA 4P5TC 2B3RA 3OKDA 5J8OA 3WBDA 1MCIA 4HJJL 2BS8A 2GFBB 4WU5A 1S5HA 4AYBA 5GZNC 4NKDA 4LCYA 5E2UH 2XE2A 1BV8A 1QQDB 4FOMA 4LPUA 3WI9A 4IDJH 1A9EA 4JRXD 3TNMA 5LN8A 1TCRB 1GGYA 2WB1A 1AO7B 2LU7A 4QNPE 3DX7B 2XETA 3S3SA 1AQDB 3CVHA 5J12C 2H0EA 3ISRA 4I0PA 5SWSB 4QOKD 3VTMA 4JHZA 1RZ7H 2WXHA 4U7MA 2YGOA 3WELA 3BMWA 1OTTC 4KVPA 3RNKA 3VI4E 2AXTO 4JFFE 4X6DE 4CVXA 3SKMB 1PKQB 4UQ2B 1G7PB 1L7IH 1I31A 2ZOKA 1IE4A 3ZR6A 4G8GE 4PJBF 2M07A 4N86A 3QUGA 1RZ8A 3DWNA 1WWWX 2IMMA 3EDJA 1INDL 3QEUB 3P9WB 4QJ3B 5CMAB 1KLUB 1NFDB 5A7EA 3T3PF 1HI6B 1L6XA 4WRLA 2PCPA 2BVEA 2FJHB 1GCYA 3GB7B 4NQDD 5HGDA 1OD9A 4YLQT 4N2NA 3LJ3A 5E4IA 4XGZB 1ZTXE 4JFZH 1IAMA 5ALCL 4TPRL 4AW7A 4P4KC 1AXTL 4Y4FB 5LNEA 4NQVB 5GGQL 2IOOA 3DGGA 3WIIH 4DK6A 3IRZA 3QZPA 1JK8B 2CMRL 4WV1A 1OGTA 2DICA 3C87A 3LHAA 2ETWA 3ECBA 3P3SA 3PE9A 5T5FL 4PGZA 1SLXA 4AM0B 4LRIC 3IPBA 3Q8CA 2GEEA 4PJXA 5GISH 3L4WA 43C9B 4XNYH 1IIKA 4FEMA 5AAWC 2IOMA 3AACA 3MRGA 4M4PA 3MJGX 3W11C 4Z78B 2L7QA 5IBTH 4LEEA 2YPLB 4G8AC 3WMPA 4EBQL 4X42A 3PGRA 2COVD 2VGLM 1IAOB 3QXAB 3WUWB 4M61A 4GFXA 4TQHA 1AZRA 2C3HA 2A0LC 4P05A 3HG4A 4HT1H 2QPFA 2FTAA 1RY7B 4IRSD 4Z76A 3QCVH 2CM5A 5FGRA 1M7DB 3E1F1 1P1ZB 4FQLH 1A7BA 3WO4B 3D30A 4Q2ZA 5KUKA 4NO2B 3ROLA 2WCPA 5G38A 1PIGA 3MLZH 4UIMB 4LOUD 2C3GA 1UQSA 1NTDA 3SGJA 4TTDC 3VWJB 1XQ4A 2PCXA 4G7YH 5HHQB 5KSBE 3D0LA 2HUEA 3MRKA 1U93B 2V5MA 2CDFA 3DRQB 1UH4A 4QAWA 3U0WH 5C0BB 2IV9A 4NZFA 5F7HA 1OARL 3O9WD 2APVA 4G1EB 3NCJH 5CJXA 2IBZX 5I2IB 3WFCH 5DA0B 3VCLA 5AAPA 3WTSA 1MCRA 3VI3F 2OP4L 4ODWA 1BXUA 5HHXL 1NGYB 2VDRB 3J07A 4MVBD 4O9HL 4E1SA 4WGWB 2HFGL 5FWRA 3KLHC 5INCA 2AXWA 5D72L 5DRNA 4U6YB 3V9CA 3PHQB 3HVNA 4MCMA 3T1WA 4JNXA 1R3LB 3GLAA 4WTZG 3DX8B 3ZN6A 5C8JA 5CIPB 4FJZA 5EZJB 3E38A 4HIXL 4ONGH 2FHFA 4FHJA 1A1MA 4HIEB 1AIFB 4L2YA 2XE5A 3M45A 1U6AH 1XMEB 5EOTB 3UCQA 4DETA 3OLEA 1FVCB 1KV3A 4HPYH 2R8AA 4GI6A 2JJTA 2HVKA 3BEVA 4TOYL 1N59A 4ZFFA 1CF8L 1ZANH 1MCSA 5IK3A 5K9QI 1WIOA 2DEYX 2QL1A 1U91B 4ZOBA 2CUAA 3ARED 3U6XA 5F70A 2OSYA 4OLEA 1MG2C 1DVYA 1GKOA 4OGZA 5CLWA 1YA5A 3N44B 1U92A 4X80L 2C7UA 5SWZD 1A6AA 2BX5A 4HC1L 1BZOA 4PRAB 4XBMA 4AL8C 1JAEA 32C2B 4XO3A 5ENWA 5CCHE 2H8PB 5TGBB 5ITBH 2AEPL 3O4LD 3S6CA 4R97B 4G8GB 4NQSA 3VRIB 3BWAB 2OZ4A 4PP2A 5L7XL 3LRSA 4E1TA 4W9KC 1UWEL 1YDPA 2LHFA 3CPUA 1P5VA 5DQJB 1F0LA 1JGUH 4QEGA 1BBDH 3UCRA 4LNRA 2ICEB 3D18B 2PUQT 2X0VA 5E8OB 3QEHA 1MH5B 4B3EA 1ACXA 4PU2A 3T1FB 4ABQA 1D5IH 2YHGA 3QJRB 1ACYH 3TPUB 1QYGH 2APWA 3EFOA 3H4HA 1DQQB 4QR7A 1ND0A 2ED6A 3NCWA 2VR3A 2B2XL 2WMPB 5GSRB 1AZZC 1DVFB 1PS3A 1WAPA 3QRFM 1YEFL 3H9YA 1SEBB 1SOXA 3LK3A 4QAMB 4YE0A 1T2XA 1S7RB 2VCOA 3WFHB 2IDTA 5IJDC 5A16A 2B15A 3QRGH 2YEZB 1THAA 2E4TA 3MMEB 1HWGB 1TTAA 3MUJA 5DJCB 4Z77B 1B4LA 4KKBC 3WKNA 3FT4B 1OK8A 5D2NA 1N0XH 2ICWB 5AYTA 1FL5A 3WOVA 1I8KA 3QJFA 5A43C 2DI7A 5K33A 1NBZB 2VDNB 4IU3B 5FUOH 3GMRA 2QSTA 1QAWA 1VFAB 3TA3D 2ZXGA 5J0BA 1SN0A 5BMFL 4RFEA 5GZOD 3NEEA 2JIXA 1MM4A 1GZHC 1I1RA 2VERA 3U25A 1CFTB 2UZIL 3GRWA 5C0JB 1RUAH 2D7TL 1L0YA 4Z23A 3CVDA 4UB0H 2CKBA 1FH5H 3I9IA 4NDMA 4FXKA 1U0QA 1QSFB 4JY4B 2ITDB 3L7EB 3OX8A 4MX7A 2H2PC 3VFUB 4IOIA 1QACA 4ZAKA 1J7VR 1XCTB 5JUEH 2IPUK 4JKKA 4PS8A 2Q86B 1HILA 2JELH 2EUVA 2KZ7B 1N5YH 3CQQA 5HYJB 1YY8B 2B5IC 4Y16A 1ILUA 2IGFH 1F4HA 1QASA 3RWFB 5JTWA 1FJ1B 1VEOA 3U9PH 1JK8A 4YS4A 4BQ9A 1F90H 3OJDB 5DO2C 4HIPA 4QLWA 4P59L 3ASOB 3CMOL 4QF1B 3AY4C 3V4PA 4DT2A 4ZUSA 1ERNA 1NFDF 4BKLB 1DUYB 1PSKH 1C5CH 4LP8A 3T09A 3POXA 3D48R 3EJYC 2WSKA 1BFOB 2WANA 4G8IA 4XE5B 4GO6B 2DQHL 3OKMA 1BQHG 5E4EC 3MXWL 2J8OA 3WEAA 3KLAA 4K8RL 4JZJC 4ZS7L 1INQB 5JHDD 4G9FD 3NDYE 2WY3B 2XV0A 3D06A 3MLYL 3U2SA 4XMZA 4O49A 3Q5TA 1OGAB 3V4UL 2YUVA 4P4KA 4IRJB 4GAJH 4H8WH 5EDXA 1ORQB 5IGXH 5AZ2L 1AS6A 1Q94B 3HZVB 2ICWA 43CAB 7FABL 3RWCB 3T0SA 3MROA 1A2YA 2PN5A 3V5HA 4YBQD 3CK0L 4UI2A 1U3HB 4J3WA 4AMXA 4UT6L 4IMLA 3U36A 1TCRA 1JDDA 3S3JA 4PJGF 1FFQA 5E6ID 2UX7A 1TR7A 1CQYA 5CBAB 5FYJE 1OARH 2F5AH 3T0DA 3B6SB 1MCPL 1AR1B 4WU5B 2PWGA 1NGPL 3LEXA 5I30L 1QA9A 2X89A 1MCQA 3BPNC 5ADOH 5BRQA 4O2FA 5GGSA 3ZL4H 2RCSH 3DHPA 3PHSA 1TQCC 2Y0HA 2DY2A 4YHPA 1UYWL 2FJSA 5TDNA 1P6WA 1SLWA 5HHXH 3D25B 1UKQA 2XXCB 2FZ3B 3ARWA 4K55A 5KSVA 4KX7A 4TLUA 1ZHBB 3QJTB 1JHTB 1HINL 2Z93B 4H1LB 4CC4A 3GKWH 4ZSOA 4WFEE 1PEZA 3NCFB 3WTTA 2WBXA 3HAEB 4GEIA 4WHCA 2C1PB 2KPWA 4PVBA 1E9PA 1YCSA 3DMMA 2YD2A 1F45A 1K3IA 1TIUA 1XL4A 4YSSA 3VQ1C 3U30B 5TK2A 2BZ7A 3VWKB 4ODTH 1KBGH 4IYKA 5HHPA 2CPCA 4XI5D 3UTZB 1MW1A 1H8LA 1R3IL 2NXZC 4EAEA 4N2IA 5I6KA 1LO3L 1OE3A 4ZDHB 4NQEA 5HDOA 1Q94A 43CAA 1RZKC 2BNRE 2XCMC 3WKMH 3FFOA 2XRAH 2GIMA 3Q2WA 1PYWA 3INOA 4MD5A 3SKOA 4IRJA 4RZCB 1QKZL 4IIQA 4PJDE 4F2MB 2E56A 2UZYA 4PJ8A 2XZAH 3BSGA 2A5UA 4LSEA 3FCTB 3O0RL 4PJAB 1RZFL 2W95A 4HC1H 1OSMA 5KSAC 5C0CB 2GTZB 2A9BA 4OZHF 4MKTA 4AMKH 5JHLH 3DUSA 1JZ3A 4Y2DB 4Y5YB 4G8EA 1QATA 5JDSA 3LK2B 3EOYG 4OZFH 1K8DB 2FQGA 5KAIO 4GAYB 1GGTA 5BRZA 1E28B 5JHBA 1BLNB 4HKBB 1S7VB 4KX8A 4N0FB 5DURD 3EYFB 3HS0C 4ANKA 2W94A 3UZEC 3F65A 4U1SA 3RUGF 4XXWA 3WTYA 3BPCB 3QFJD 2BFVL 4TXVB 4HQQL 3OAZH 5FHAH 5LBSA 3VMPA 4C83A 1MHPL 1DZBA 2VYRE 2WQSA 5E99H 2D7PA 4PW4A 3BXNB 2K7PA 1X5IA 2BOBB 2LV4A 4WI0B 2CHXA 5DHYA 1DQML 5E00A 5EUKB 5ICYB 5JPNA 5HYJD 1MIEL 5AVXB 2LLGA 5CIPH 3CFCH 5IB1B 3JVGC 3NT0A 5K9OA 4Q2ZB 3F7YA 3CIQA 1C9SA 1J8HD 4GUPB 4NYLB 4P06A 1QJPA 4HAKA 1JS4A 3OR6B 4OD1L 1TJMA 4OTXL 5C0NC 3C12A 1SJEA 1T5XB 1Y0LA 4KZEL 1ZRUA 3T0EB 3GRWH 5IWLC 1VB9A 5BQ7A 3RURA 3BKML 3SN6N 2AEQL 4JM2F 5K9QG 1XV8A 3PFUA 4M5ZH 5IT2L 1PX4A 2AJZA 2C26A 1R34A 5B7FA 5BVJA 2CGYA 2PPDA 4BFNA 5HPMB 4AV0A 4PRIB 4FZ8L 1F3RB 2HN7A 3HUJF 3TA3B 1XTMA 4OW6A 4Y1AD 3WJMA 4PRPB 4P5RA 2Z8VC 2OZ4H 5GTHO 2CIKA 2KMWA 3MLRH 3FMGH 5IQLA 3TEZA 2ZX8A 4PJXE 3WEXA 4MZ2A 4LDLB 1YEGH 3MNMA 2OJZL 1RIUL 2OX5B 4OLWL 5TDOA 4HV8B 4FUVA 1RSYA 3LK41 3BT2L 2EDKA 3MRQA 4YQXL 4PD4J 4LLYB 3OJMB 4ZOEA 3TF7C 3OKNB 5I73C 4I87A 5DCCA 3ATEA 4H25A 3NA4A 4YDLC 1B6DA 1EMTL 3HAEH 3W39A 4ORGB 3WYRA 4RGMB 1Q1JH 4O2EA 4LSQL 3CBJB 3WN6A 1LNUA 1DEEA 2M8XA 2N7BA 3HC0A 3KZ8A 1IC4H 1GAFL 4LO9A 4X9FA 3DIFA 4P2RD 2BSBA 3OKYA 2Y06L 2VLKB 4LVOC 2LU3A 5HSFA 2KYIA 3LDBC 3GSNH 5TGBA 3BOVA 5TFSH 1OP5H 2P46B 3F05A 4PRAA 1NFAA 2PCFB 2DJMA 2PPFA 5CNHA 3RZCD 3SYOA 4PY8J 4F9PA 1Q90A 1WS8A 4OGQC 2LQRA 4XNZC 2V5TA 3ILQD 1FAIH 4XNKA 1NCGA 3ARFC 1KLGB 4JY6B 5EBLB 5I6NA 1P7QA 2WBKA 4PGJA 3DX7A 4YDKL 1J5OL 2BP5M 3VB8A 1IT9H 1DLHA 3KWXA 3MRBB 3QIWA 1C5BH 5HHOE 2EDQA 2YUZA 5JOEA 4IS6B 1QFUH 5D1QB 2XWBB 4GXUM 5IFJA 2V2TB 1SF3A 4RMVA 3PL6C 4ONHA 2BSDA 1EXUA 3QUMB 1L7TL 1FC1A 1M9WA 1BEYL 3HC4H 5T3XL 3PWNB 3M46A 4Y7MA 4L8SC 4NO0A 1GGUA 2BIMA 1NCHA 3NCYS 3BKYH 2UV3A 4IRZA 3US0A 3HCVA 1NIEA 2DQ6A 4BGLA 5SWQA 5A2AA 5TE6L 4B7LA 2XYCA 1I9EA 5EDSA 3ARDD 4J7RA 2RCSL 3V0WH 4JPVL 5HGBB 3PJSA 4XN4A 2DEWX 4JE4B 4LVNB 1NLBL 3EKCA 5H37H 3UJJH 4PGBA 4AV4A 3RZCB 5JXAL 2DKMA 4GRWH 1K3ZA 1AYRA 5ANHA 4DZBB 1JD9A 4MD0A 3DX2A 4Y2DC 1U8CB 3LCYA 2H1PL 4HD5A 1UXLA 4R96B 3MOBH 3ZSTA 2Q7YB 1K9TA 4WK4B 4Y4FC 3CC5A 5CZKA 2BHZA 4HCFA 3DWOX 3CPLB 4XNBA 5GJSL 3SYAA 1YLBB 4G6MH 4PBVC 3SDXB 4XBGA 3ZMEA 3DPBA 3SIKA 3GBEA 1HL4A 2EKSB 1TJGL 3LN5A 1JWMB 1MCBA 5BS0D 1W72L 2X3AA 3LQZA 4MNQA 4XXDB 1IZNA 3HC0B 2O5NA 3HG5A 3TFKC 3W2DH 4N74A 2QGCA 3V5KA 2QT6A 3D09A 3L5XH 1WUNT 4FFYA 4W4OA 1SXNA 1JVKA 3RWEB 3T2NL 2FE0A 4PP1D 2DQEL 1CLOH 1YY9C 3LZOA 2OMBA 1J9TA 4O5LL 4ACTA 5JXEA 4DF9A 4XZUA 2YC1B 3EYUL 1TTRA 4KRNA 1DO5A 4P5MA 3VFTA 3BYTA 3L3GA 3MNZB 1MVUB 3DECA 5C0EB 5AVQB 1NFIA 5C0DA 4L8BA 3OLIA 4EEEA 2QMKA 4JJOA 5IB1A 5ERWA 3JTBA 2BFVH 5DD6A 3RVTC 4AT6A 2B4CL 5FHAL 1N68A 5IQ9A 1CE1H 2GW5A 2WQRA 1D5XB 3IF1A 1JPGB 1DVTA 4FNLH 3RDTC 5C3IA 5D1XE 5FXCH 2P5WD 4TVPL 2ED8A 2CBQA 3HTLX 1BFVL 1XF3B 4FFYL 5I6XB 3WD5L 4PQXA 2WUBL 4CU7A 5FIEA 7CGTA 4V1DE 5ITFA 2VLRE 2DLTA 1A64A 3B3IB 4PRHA 1J8KA 1G7PA 2F1AA 4XPGH 5EO0B 3VFWA 4LHJB 1AS7A 4A55A 4K9EH 3UBXG 4J3SA 2P42B 4XRCA 3BKMH 1MFAH 4WW2A 2AQ2A 3K71A 2AEQH 3WJJC 1N3NA 1MF2H 4BQCA 2ZWSA 3P4OA 4HJJH 2GPZA 3CWGA 4NN5B 2HLFD 2DI9A 1ET8A 2Y5EA 4ODVL 4PB9L 4KAQH 5DVOA 4EN3A 1FGVH 3V0VA 1JZGA 2QELA 5D70L 4C58B 1KTCA 2CBTA 2APSA 3MRCA 2BSSB 4L9DA 2DMBA 2WLMA 4JJ5B 5DVLA 1SUJA 4JKMA 4LCIH 2FH6A 1UVQA 3CE1A 4AY0A 5AUMA 4JRXB 4KVCL 2HRPL 4AYID 3S2AA 1IQDB 5C0CD 2PTTA 1SHXA 4IBUA 1GGIH 3KYKL 5L88H 4P3DA 1RZJH 2K4WA 4LSIA 1DANT 3OAYK 3RVUD 1CN4A 4N2CA 3H6JA 3RX7A 2EZ0C 1H19A 1L7IL 2A4EA 3TO2B 5AENA 3FSAA 4H88H 2HB0A 1U2HA 4ZD3L 3SEPA 2F53B 4HG4J 4R5XA 1J0YA 1F3JA 1GY1A 5AOIA 2ENPA 3EDFA 3MRIA 1YEKL 3Q2NA 2AK1L 1JHTA 5CP7B 2PABA 3MLPA 1WWBX 3SCMB 3GHEH 2YO3A 5IOPA 1MCCA 3AB0C 4C00A 1KBPA 3MFGB 1ROWA 2DQDH 2ZUQC 4A2FA 2Q76B 1HYRC 1GGCL 3S96B 4E9WA 4G1MA 3WTUA 4RVBA 3QR0A 4LDEB 1A02N 5IUCA 4K3EL 4L4JA 3NPSB 4YSTA 1FNSL 3QDMD 2VXTH 1ULVA 5G26A 5AL0A 1HXMA 4MA3B 3OG6B 4DP5X 5I24A 4TQ8A 1S7UB 3C8HA 3O3BA 5KVFE 4J3UA 2M83A 4L3CA 3PWVA 1OZUA 1RMFL 3D08A 1RERA 3HB3C 1OKEA 5DI8A 5JHDE 4NI6A 2NY6D 2RAMA 2H26B 1LGVA 2MCPH 4FD0A 4JFDD 3ARVA 3PCYA 3LPGA 5CSBA 1IQDA 3R7RA 4DPBX 1DBAL 1BEYH 3U2IA 1B2WH 2R8SH 2J12B 1VFOA 2BWIA 5CF3A 3VXSE 5HDBF 3QUYA 2E46A 4FQ2L 4YXHH 3EYSH 2VKWA 3FT1A 2VXQA 3JWNE 5DYOB 1K5NB 2YNKA 5TJWK 1JXGA 3GXFA 4PLJD 5E1HB 3GXNA 1OSZB 2JVUA 1K2DA 4GKNA 1F11A 3B43A 3PRZA 4IRJD 4BFBD 3BAJA 5FO7B 1WZ1L 1SVZA 2WYHA 3KEDA 3D12B 2IWEA 1DSFL 4AKOA 3A22A 3W81A 5CP3H 3D0VA 5IROC 3U0WL 2E9WA 3MACH 1HX0A 1ROCA 4F7EB 4AGMA 4NM4H 4ZMXA 1NCIA 1TQBB 3AXLB 3PV7A 5CLZA 1EHLH 1ZJAA 2HVBA 1F3DH 1ZHNB 3EYQD 4OZGA 2NZ9D 5DRZA 4NPKA 2Z35B 4IGBB 4GBXD 3WJLA 3HOGA 4N3TA 1ZSDA 4PJGB 1YECH 5KAFO 5SX5H 3IAGC 5GS0C 3VD0A 2P7TA 2PYEA 3STLB 3FU7B 2XTQA 5AOKA 1UT1A 4E9SA 4DOHE 4X4MA 1IBGL 1GMIA 4Z7UF 2O6PA 1DVQA 4ORZC 4BH8B 5E1IA 4U1MA 2E7CA 3OLGA 4X6EA 1G7JA 2VL5B 3AT8A 3W9EA 3RDTB 1IKFL 5I19H 1F1GA 1OY3B 2BOBA 1GFQA 3RVWD 3KYAA 1NCAH 4E68A 2X41A 4HJ0C 3TX4A 3E6FB 4YSQA 4EDXA 3MYJB 5FFOA 1P4TA 1XSKA 4W9DC 2G4GA 1ACYL 1HOEA 1JJUA 2DMHA 1QLEH 3NSCA 5JQIB 3Q06A 1SXBA 1PZSA 2ZG1A 3QI9D 4PBDA 3RJOA 3W9DB 3T0VA 4B95C 2V5RA 3OZ9L 3L1GA 3M1BB 2X1PA 4H0LC 4F8PA 2O6FA 1PG7W 3FU6A 4Z77A 1U8JB 5ES4B 2PTUA 4MXQD 4APXA 1A0QH 3QZNA 4K3DH 5AW8B 3N1MC 1YHPA 1IEBA 2PXYD 2HLAB 1VERA 2B7DT 3WY2A 4IJ3C 3N50A 2EKJA 3C5SB 4ZFOA 5I8CB 2YEVB 5ITBL 3QUHA 1JNHA 5AL8A 4A7QA 4PJDA 3AA0A 2ZWNA 2R23A 1OPFA 5I8OL 2F53E 3LPPA 4NHUA 4UAHA 3U30C 5IHHA 2WGNB 4Z9KB 3ABLB 3TZGA 5MI0C 3GMRB 1TLKA 4P2QD 1A7NL 2X42A 1OF2B 2DW5A 1AVAA 1CUOA 4PJGA 2XN1A 4PRBB 4K94H 1WAAF 4DN3H 1XB6A 3WIHA 2L04A 4EJ1C 1XF5B 4BRVA 5ID0A 3WS6A 1VACA 3GXTA 1RIHL 3QYMA 1QBAA 2E47A 2ZZUT 5CILH 2QSCH 3QULB 5FM5M 4WEUD 3QHFH 4CSPA 3O41B 3E2HB 3I6GB 1OTTD 3OXRA 3OM3B 5CBEA 1AOHA 5C0FB 3FQXA 1G1OA 3BDBA 3SY7A 4JR9L 2ZAGA 2X2JA 4W9ZA 1L9OA 3AAAB 3EXLA 3ME0B 1KB3A 4RWYH 1WC7B 4FQ1H 1DR9A 2ID5A 3T0XA 2WV3A 4QRTA 3WS6C 3OBAA 3TVMB 1HXXA 2FJGB 3QDAA 4MJ6A 4U6HB 4KI5D 3FC8A 2WXGA 3TNNA 5JHMA 5DLMH 4NT6A 1I8LC 1S7TA 1II4E 2E0PA 2WCSA 3O3AB 3WKYA 3PWNA 1T20B 1KYFA 2CRMA 1U8IA 2G5BB 4WGVB 3UPGA 4I3RH 4DGIH 1CBJA 2FK9A 4KKCD 4F1SA 1ZHWA 4V1DB 4ZTPH 2PPCA 3QS3A 5C6PB 3E6HA 4XPTL 2ISDA 5M7QA 1OB1A 1JGLL 5KVGE 4Z3HA 3T20A 4OIIH 4O4YH 4KVNL 3MLSH 1SPDA 5EOQL 1YEKH 3FN3A 2NX5B 3V6OE 2VDOB 4N85A 2JI3A 3BZDA 4A04A 2MIZA 1CT8B 3LXBA 2VLRB 4K7PY 2MJWA 2DWTA 1AYOA 4FT6A 4TVPD 4H8UA 4Y1SA 4JRYE 3U4EB 3PABA 5E2WH 1WPCA 3BZ4A 4HKXA 4G1MB 3JV6A 3AGWA 4S1SH 1J18A 3AA6B 1EEUA 5KBPA 3DDGA 4KMLB 4B9FA 3CHOA 2CDEA 5I6OA 1RK0B 4OLUL 4Z7NE 5EZJA 5J1SC 2CJTA 1IAII 4F2ME 4MJIB 1YUHB 4XO9A 4IOSD 4AQEA 4M7ZC 4IJ3B 4E0RA 2IG2L 2WWKO 3HNSL 3N5AA 2VLMD 2BNQB 1NGPH 1CICC 2P28B 4TTDD 4DN4H 4ZMQA 1DJXA 1NEPA 3O41A 5ITFB 1KWKA 2NQCA 3SDAB 3GJFH 4OF8A 3BZ5A 3UBGA 3MV9A 5IW1A 3ECVA 3BRGC 2HRLA 1R75A 5AFUK 1TSHA 1XF3A 2NSMA 3QT2A 5DJ0B 2WZ6A 4OBRA 5DUBB 1AFVL 4PJEF 4NC2B 3OG4B 3RTQA 1WT5A 1XH3B 1ICTA 3BN3B 4AITA 1H6S1 1DP0A 4Z0BH 2A7BA 2XIBA 1CL7L 4GS7C 3BGAA 3VD4A 4LCWB 3JVGA 3GXPA 3WHXB 2FDBP 4NP4H 1LL1A 3AS3A 5JZ7D 3NIFE 5DD6B 4AT6B 3IFPA 4ZOCA 4JQXC 5DUJA 1UFGA 5C0DB 1NBCA 3P4OB 5K1JA 1N6QL 3EH4B 1J0HA 5KYYA 2PP7A 2GUYA 4QHMA 4DFIA 2ESVE 3L3GB 3MNZA 4U1JA 3MNVA 4H13C 2OI9C 4JG1H 4KROD 1S7WB 2NY2C 1KC5H 1I8MA 5EO0A 1IEAB 1WBYA 3VFWB 4Q7DA 1KXTA 2DWSA 2DQJL 1HHKA 1IJNA 1TLMA 5ECJE 3UO1L 3VI4F 1UEYA 2KQMA 2ZF9A 4P2AA 1JZ2A 3GIZH 1YQ2A 2DWEA 1E4XL 3P0VL 1LD9B 2CU9A 1NICA 2V7HA 4EDXB 1AGBA 2X2UA 2A6IB 1EGJL 5HVGB 2IADB 1MJ7L 4PJCA 2WOBA 2RH0A 1G7LB 3X11A 3O6KL 4MXVF 5JOPE 1AMXA 4LCUA 1G9MC 1Z5YD 3AA6A 1DQJA 2CXKA 3RDTA 4G43B 5K9JL 3GC3A 5D5MA 1J48A 4U1SB 1N2RA 3MJ7A 5T3XD 2FX7H 5A2KH 5IVZB 3U4EA 5KJ7E 4LQFH 1GR7A 1CVSC 1OVZA 1P7BA 1J8RA 2IH1A 3L9YA 5EPMB 1AMYA 3T8XB 1ZS2A 4PJ9C 4KJYB 1LO3H 3FT9A 4OJDH 4RIRA 1I9IL 4S0TD 5JQHC 4GAJL 4LNVA 5DD1H 3UMTA 4KKRA 3MNDA 3B9KB 1YYLH 3ZU8A 4Y9BA 3JTSB 1HCFX 3HRZA 3TC9A 5HDLA 4FHBD 5I9QB 5HI4C 5IHUH 2VSDA 1GYWA 3PFQA 2QZ5A 1A0QL 4H7VA 1CJYA 4K3DL 3D50A 2F58H 5DGRA 4TNWK 1KENH 5FOBB 1S5HB 2A77H 1ODAA 4ZMNA 4R4FL 1U8HA 1Y07A 4YXLL 2V4LA 1J5HA 4TNEA 1URLA 3QIBC 2OMXB 2IWVA 5CGYC 5EU6A 3THMH 5FYJU 3ESOA 3LNFA 3ULVF 4JO2H 4WO0A 5CCKH 3OXSA 4K07A 4XHQA 3SE6A 3D51A 1G7IB 4G72B 5KS9E 2UX6A 2WXKA 1OZTG 3UBHA 2VLKE 2X0UA 2LW3A 1BPLB 3V4VA 2EXYC 3TNMB 4BCZA 1KYUA 5JW4M 4JN1L 2ZJSL 4WFFE 5J5EA 4PV8A 2KHAA 5EU4B 3PWJB 2QQLH 4I85A 2Z8SA 5BJTB 2Z93A 4H1LA 1MW0A 3NSGA 1H3PL 1FPTH 3RWGB 4XAWL 4QXGH 2V9UA 2VM9A 3FMGL 3K74B 3ZHKA 4AH2B 4K7PX 1MAMH 3BX7C 2Q10A 1Z9SA 2X4UA 3MGOB 4K5LA 3ZL2A 4R2GC 3VD2A 1IFHH 3O4OC 3SDAC 3GMPB 4XZ4A 5F7KC 3KJ4B 4XCEB 2CGRH 4TULH 2E6QA 1TJIL 5JYLA 2XICA 2WINA 3L9BA 3L3OA 3R8BB 4D9RE 1H6TA 4M6OH 5JPMB 1AHKA 5EIQA 3B8YA 4NNPH 2IALB 2P5WB 4P2CG 5LCVL 2ARJB 4NP9A 3PGUA 3WSQH 1SXCA 4BSVB 4NN6B 4WWNA 3X1BA 2NUTA 1JZIA 5CLTA 4PJHA 1FNGA 4RFNB 1OGSA 4KKNA 5C09D 1KBKA 2BMKB 3VTTA 2CQVA 4QRBA 2ZYSA 3U4BH 5IFHH 3FU3A 1S8DB 1KPRA 4OM0H 1P5UB 2F8OA 2WQUA 5ERWB 3UTOA 3VB9A 5DJAB 4QHNA 1YEGL 2IH8A 2Z4QA 4J3OC 4JHWL 3W38A 2P5WE 1A9BA 2KLTA 4I89A 4HHAA 5IBUB 5C07D 1BZ9A 1EXGA 4APQD 3KR3L 2W07B 4FCAA 4WNSA 3HEIB 1W0VA 4ES9A 5AUMB 1I3UA 4WEBL 1A6PA 2QEJA 3D8MA 5I9QC 2AAAA 1JF1A 3C5JA 2FWSA 2OJ1A 3KGTA 3OGOE 4PUBL 3DV4B 2PW1B 2RMNA 5KOVC 4OM1H 1L4IA 3KLDA 4BHUI 3AITA 1RFDL 1L9RA 5CINH 5LXVA 5T3XH 2BH0A 5A3ID 1UZ8A 3ZO0A 3PAUA 4IGBA 3HC2A 3LKRA 4XPBH 4YR6B 3LEYH 3EYFA 2PO6D 3QUZB 2RJMA 4GHBA 5I8KL 3KYMA 2YSTA 1JGIA 4I0CC 3T6ZA 2Q7YA 4AM0Q 3OJVC 1CFSA 3IDGA 4Y2DA 5ELIA 3BEWA 1F2QA 4AEFA 3RVVC 3VXSA 2JKSA 5D7LD 2NYYC 3VNYA 4PRDB 3D0AA 4PJAE 1HHJB 2IMNA 2IQ9H 5JYMA 3RBSA 1FAKT 3I6SA 5B8CB 2ESVD 4FNRA 5DO8A 4GP5B 4JVPA 3SGDI 1DDTA 1AJ7L 5J6GB 2F1CX 1IAKA 2R69H 5J12B 1OAJA 1DJIA 4JFFA 4X6DA 3WLBA 3KVDD 2NXYB 4PRNA 2OZNA 3WIIL 1S7VA 4FULA 4N0FA 5K39B 1HYSC 4N5EC 3J27A 4XP5L 1QSEE 1CIUA 1WGVA 3P3YA 1JFHA 5J6HA 2X9KA 5FO8B 1HDMB 1O5DT 4NFCA 4PTTA 4F33B 1UADC 2XWXA 4GRLB 4IRZL 4X6CF 3SDDB 2ODIA 5HPOA 5J6SA 5KSBB 4MNQD 1IGTA 5T5NG 1EMTH 3V0WL 2NXZD 1BMWA 3QC6X 1QHOA 4FNUA 4N25A 4ODXA 2DKUA 1HXUA 1J05B 2ARWA 3V6BR 1E4XH 4K73A 4L23A 1SEBA 4OZ4A 4XO4A 4BK5A 1U6AL 1WTLA 2YD8A 2I9LA 1MCHA 4TLKA 2Y72A 2JXMA 3U7WH 1YO4A 3MRPA 4OSUH 2FX8L 2OSLB 5T3ZH 1T2JA 2FO4A 3HMXL 5DJ8A 4Z0XB 1QUNB 2JNZA 3CC1A 1H3GA 4NT6B 5E5RB 3UTTD 3FB8B 3HRZC 5B39G 3B7YA 5FEBA 3EFFA 2JKXA 3BUIA 5I17A 1MVYA 3OGCA 4I5BB 1SZNA 3WE1A 1GOHA 5FCUH 3O2DA 4G6JH 1FDLL 2I27N 4N28A 1T89C 3BWAA 4NBZB 4AUUA 1QRKA 5KYUB 3VFOA 1RUQL 5B5EO 1NC2D 2Z8RA 3D05A 5CKAA 3H42H 4ECNA 1YG9A 3C5ZA 3DJZA 1KJ2B 1MWAA 4BYHA 4XNDA 1QFUL 4U1IA 2B20A 4TUJA 5H4ZA 5BZWA 1MOEA 4KZDH 1ZHKB 4FZLA 3EGXA 3VI3E 1SXAA 2VUYA 4AQAB 4Z7IA 3FSOA 4RZCA 2K6YA 4Z7UB 1AAJA 3L7FA 1VEPA 1I4FA 1T21A 1ID2A 4A37A 4BFRA 5JQ6H 3OF6A 1XIWD 4YDJA 3IXTB 3O3AA 1E40A 3IDNA 4HT1L 4OFIA 4Q52A 2Y0SA 4X6DF 4HUVA 2FEDC 2BCKA 4MNHA 4RBPK 3UTZA 2G75A 5GS1A 5HYJE 1E4WL 2WBJB 1U41A 2CDGA 3O3EB 4EN3B 4GINA 3QISA 1HQ4B 1AD9B 3SOTA 1IKNC 3OKLB 4JK0D 3BO8A 2BNQE 3D85D 4ICWA 4M6AA 4HK3J 1MEXL 1N0XL 5I5JA 4TSAH 4WY7H 1DQIA 2CK0H 1XGRA 3GIVB 4M3KB 5MERA 3BP5B 3S4SA 2WIIA 4LHUG 4HFWB 2K8QA 3AAZA 3MYJA 4K71C 1NCNA 4Y9CA 3WD5H 4FQXD 3V0FA 5IMLA 4S0SD 5DJ6A 3EF7A 3VCLB 4G8FB 2GSIA 1HQRB 4JQVA 4P49A 3KPOA 4PD4K 3UMNA 1CLYH 3BIKB 2V3FA 2WNWA 3OMNB 4KXZI 5IJCC 4JRXE 2VDNH 1JGDA 3KWWB 4JFHE 3IKCA 2J1ZA 4N1EA 1JE6A 5K9OB 2A9DA 2QKIB 3UAAA 2OMUA 3HA0A 1DUYA 1J1PH 3KL0A 1JYWA 3TH3T 2I26N 5FDYA 1TZHA 3TM6A 3TL5A 4X7SL 5D70H 5GS1C 3VI4A 3U6RA 1G90A 4KITB 3K5SA 1AOZA 2ODJA 4JCWA 2IPTL 5B22A 4YDZA 5HYJA 3HZVA 3AC0A 2ZUXA 3TYGL 3AG4B 4L1BA 1NFKA 2VN3A 4HJTA 4FN0A 4P04A 4QXWA 3HI6L 3WN5A 1PZ3A 4M8RA 3RG1C 3LVEA 3WCYA 3WFZA 3LKNB 2WLYA 4MNQE 4YGVB 4KJPD 3QSKB 4HWEL 1P4UA 4XOAA 3ULSB 5KUMA 1F42A 2HMID 5AW5B 3H7LA 2SODB 3QDHA 3KR3H 4Q89A 5IJVB 1C1EH 1YEIL 1DVZA 2NY1D 4N0CD 4GF4A 3SJVA 4JFOA 2CDGB 5KYYB 1IM9D 1K5NA 3O6FC 4M43L 1IEHA 1BVKB 3FQYA 3KBPA 3QZWG 3ARFD 3N1FC 3HFML 4F3FB 4HUVB 3IDUA 4DWHA 5LKNA 4BKTC 3QUYB 5DJXB 1WUZA 3EJZD 2NXYC 2VERN 1KJMB 3BW9B 3CC5B 5E9DE 5DR5H 1FI8C 1SMAA 4MMXB 4Q4IA 3AS2A 5IGXL 1WFNA 4N0UA 4ONFL 5CN2A 5HD8C 3DHJA 2F74A 5EZOL 1FO0A 1BW8A 3ECQA 5DQJA 5KBLA 4NNXB 4JZOA 3VRJB 2J1KA 2WIIB 1GTNA 1NEUA 2DQUH 4E42A 1YC7A 3FTGB 1OL0A 4TSBL 1NCWH 4YH6A 1HXKA 1S7UA 1ADQL 1NCOA 3FHEA 3QAQA 3SD2A 1EZVY 3N40F 2F8XC 4ODHH 1J1OL 4W4OC 3VFGL 1MCOL 3GBDA 2QKIA 4PB9H 3UEZA 3O6FA 5D2LF 1FVDA 2IQAA 4R5VA 4FRXA 3F5WB 1FYTA 1T1WA 3POCA 4NSKA 1E0OB 3D25A 1YEJH 3ZGIA 4HS3A 3KXFE 3D4YA 1T7VA 3DV6B 3TZVA 5HHOA 2ZG2A 2UY6B 1JWSB 5MHSE 1CL7I 2NUPA 2YJQA 2P5ED 4N5UA 4W9HC 4U1HA 5GRZA 1M7XA 2J73A 4J28A 5TH2B 2DIJA 3FUDA 5FDWA 3VA2C 5SX4I 2NSXA 2UZIH 3FT4A 1ZVHA 2A6DB 4DO4A 1CDCA 4DUVA 3F01A 4GCQA 3MXWH 4KK5C 2X89D 4QTFA 2IAMC 4Z8FH 3QZOA 2EE2A 3QJOA 1P4IH 1NGQH 2QSQA 5L2KB 2MTPA 3MRNB 4AQZA 3UL4A 2OMWB 2AGJH 4K7PL 4GBXB 1JV5A 4JEGB 4HH9B 2FJFA 5E5UB 1I53A 4NUJA 3HMXH 4HWZA 2BY0A 3ZDXB 4PJ7B 4H8WL 2OMTA 4NM4L 1UXMA 2WLZA 4W68A 4QRPA 4PP1C 4LEXH 5GS0L 3NZSA 1PYWB 5F93C 4KK6D 4D2NA 4ZYKB 4PS7A 4Y4HA 4UOW1 3MN8A 5G4OA 4KGJA 4YIQB 2GC7C 2VR5A 1KLFB 2B59B 1ETZB 2B9BA 2GBVA 4NBYB 5EUOB 1R9FA 3ZUNC 3NJLA 5C8JB 4NSKB 4J3OH 2HJKA 4WI6A 3CHSA 1IBGH 1UM5H 4MSWB 3VA6A 4OI8A 5C08B 3HR5A 2CO7B 4EF3A 1K4CA 4ANUA 4XNXH 3DA0A 4DVBB 1XZ0A 4OCSL 3Q2VA 4CC0A 4P46B 4P5TA 1BQHB 1F1AA 1UASA 2P24B 4F9LC 3KZIO 3LQAC 3I6GA 1A7NH 5L9DL 3SD5A 5HI5D 3BP6A 1D7FA 3U1SH 3MI6A 3V4PL 2AQQA 1I8MB 3JWNH 3VD3A 2NYZA 2AJVH 4GAFB 3L5WA 4MA8H 4NNXA 4A1RA 1SDAB 4EUPA 3LY6A 4LSRH 5TDNB 4D0DB 3UO8B 1OO2A 4HQQH 1NDMA 1Z5LB 1ZKAA 3CCHA 3ABKB 1SM3L 2K3HA 3S3CB 2YPLE 4DZ8B 5BO0D 1QD0A 4TSCL 1XH2A 3LKPB 3SKNB 1HS6A 3WJMB 4XWGL 2P4AB 3KW7A 4DCQB 2K70A 4QT5B 4X99B 4U2ZA 3NEOA 2PTVA 1UJ3C 4JR9H 3CK0H 4NWTL 1CDYA 1OTSC 3K2UL 5E4EB 3V6OC 1EANA 4UDTA 3HZMB 5B1BB 4X6FB 3QDMB 2EYSB 3POUA 2X4NB 3GJFK 3BESR 4R26H 1PTZA 1U3HA 2CK0L 4JFDA 1HJBC 1JZ5A 1AH1A 1SRDA 1EEZA 1R24A 3D85B 3AU1A 5BCAA 1KPRB 1BAWA 2JQZA 3QJHA 4NQVA 4YC2B 3ZL1A 1LK2B 1EAOA 4WSKA 3OV6A 4K94L 5JMRA 4JFFB 4X6DB 1N26A 4B41A 3IU3A 3O8XB 4LL1A 4IBWA 1UZ8B 3NH7L 4GCPA 3S5LG 5CILL 2CKBH 5SWSE 3DO3A 3PS6A 1MCNA 2WTOA 1SQ2N 3DUUB 9PCYA 1NFDE 4PJXB 5F3BB 3WMQA 1D5BA 4Z5RB 3TBSB 3DV4A 1XB3A 1T1ZA 3QQ9C 3K80A 1AQKH 3FUFA 1MCEA 1M53A 3JV6B 4X7SH 3SDCD 3HI1A 4R8WH 1VGKB 2MNWA 4U1MB 3I75A 3KYMB 2Z31B 3H9HB 4HIHB 1M7DA 4FS0A 4N8VB 2BM3A 2AK4D 3RIFF 2CLVA 3EG9A 5C71A 2GB2A 4PJFE 2G9HB 5DJZB 3SYQA 1NAML 1AO7E 2FVNA 4Y5YA 1LK3H 3T0EE 4Q14A 3QORB 4Y4KC 3N2JA 3MLWH 3V4VL 2KZ7A 5EU6E 1QOKA 3SGKC 4JPIA 1NANI 3PWJA 4UBDD 2CRZA 2K9FB 1C1EL 5DGQA 1GAFH 2WLIB 3OHXC 3E6HB 1P4LA 4PJAA 1RHHB 1BZ7A 1OPOA 3QO0A 4H4NA 1R46A 4CW1B 3FB5A 2FBJL 3HNSH 3BQUD 3C2AH 3IB4A 1XMWA 4J39A 4ZO7A 4OV5B 3V0HA 5TFSL 3HCVB 2ZX5A 5CD5D 4WHTA 2FGZA 6PCYA 4XCFH 5C9JA 2EECA 3IRPX 1M7UA 1MFBH 3SQOL 1H3UA 1TTFA 2Y7OA 4A6YH 1AANA 5IR1B 1J5OH 3TT1H 1RPUA 7PRNA 3T77B 4AYNA 5J56B 2YLKA 1NAMA 5D7LA 4JB9H 1QQDA 2H3KA 2JCCA 4GS7B 4I88A 4OVUA 1ZVSA 3FSWA 4OF0A 4TQEH 2XIDA 3DO4A 5F9JB 1X5KA 3D3VB 3G5WA 3LV3A 1ADQA 3FPYA 4GW4B 3EH1A 3V8CA 1TCMA 1HNGA 3BE1L 1J1OH 4R7XA 3VFGH 5D1XB 4HETA 3G5YA 2NY3B 3GO1H 3CGTA 4HWBH 1IGIH 4QHKI 1RZ7L 4PLJC 3WS3B 1CICB 2ADIB 2CJ3A 3IDMA 3AWFA 3T6XA 3KEHA 2JKNA 1KJ3H 5JLZA 1IBDA 2VMJA 3UEQA 3WNPA 2WTRA 1X6LA 1ND0B 5DC9B 3ZDWA 4ODWB 4GG6E 5J13B 4JKWA 4HH8A 5CBAA 3D2TA 4DK3A 3GXUB 3T1FA 1NMBL 2Q1EA 2HVJB 4GBXA 4I3RL 3VTAA 1JL8A 1OQOA 2BO0A 5J1AA 5C0RL 2IADA 4PJCB 1SYVA 5T3XE 2EYTA 1IBZA 4E9VA 2DJSA 3FB5B 4NKOA 5E8PB 1K4DB 3FQTA 5MEOB 4G7QB 4R4BB 4MCYB 2C1OB 1TZOA 3D7PA 4HIJA 5BS0B 5H2BA 2GYSA 1PY4A 2L7JA 2QDVA 4NQSB 5CU5A 3VRIA 4DK5A 4KVNH 3O9WA 5HJBA 3BJ91 4X7TA 5ENWB 1GPOH 3T2PA 5B39B 1S5IL 2Y5QA 3O2DL 1Q0YL 1O0VA 3IJSB 3PU7A 4GRMB 5KVDL 1A6AB 4R3SA 4HZLA 1TETL 1I9RH 3SPCA 1CXEA 4NZRH 1T04B 2H5UA 3FPXA 4KDVA 5IKCB 5IHUL 2NCMA 2JKIS 3ULUF 4HW6A 1TVHA 3L5XL 5HGHA 2GVYA 1MRDH 3QPKA 4PV9A 3ZX1A 3CN4A 4OFPA 3IFLL 4Z3GA 1A66A 1E6JL 4TQIA 4YDMA 2MPAH 4OV6F 1OAUL 3PGCB 1SVBA 1SYSB 4NNYA 4OZHB 1WD8A 1MW2A 2BHYA 1PZDA 1PRNA 2HKAA 4BIKA 4X5QA 2JCCB 5CHNA 2H45A 4RETB 2D7QA 3ELQA 3IT8D 2V8MA 3QPQD 2Y0LA 2NXZB 2QHRH 3ZZSA 5JW3L 1IGJB 3BGFC 5D9SB 2QHLA 2VXQH 3QWOB 4PJHF 1BAFL 1ZGLB 1JPEA 2XXFA 4IOIB 4OLZL 2J5LB 2XN0A 3MA9L 4LCWE 2BRQA 4Z0BL 1D3CA 4G3YL 3ZE0E 1H3PH 5EIVA 2BZCA 4YHLL 4K5MA 2X3BA 2FH8A 3KGRA 4UNIA 3BIBX 3CFDA 4O2CA 3Q3GB 4YWGH 3FBKA 4EQ2A 3PIQB 2FEEL 1S9WA 1CYGA 2ZAIA 3A4DA 2FQEA 3QH3A 1I85A 4D0BA 1KN2L 3P2DA 4GMSL 3VWJA 1XH3A 2OP4H 1E5UI 3OC5A 4WTQA 1P4BH 2WOYA 3LNDA 2YK1L 3VE2A 2ICEC 4P9MH 4JQIA 4W6XB 2V9RA 4HCIA 2A38A 2DS4A 3NQIA 4WFHE 3PREA 4LLWA 1QFWI 3DA3A 1NMAH 4MCZA 3GGWA 3SDDC 3HIZA 3R4RA 3TN0D 1T0PB 2OXHA 4KI5C 3I75B 2G2RB 1GJWA 1HSBA 3MRJB 4NZJA 4PBWD 2Z31D 1O6TA 4X5WA 2DWDB 3HG1E 3DSFL 3MKKA 4QY8B 2Y7MA 3QUXC 3B3BA 4N2FA 5DHYB 5EUKA 5ICYA 3MCKB 3X12B 4JL2A 4YK4C 1JMXA 3TN0B 4I48B 4LL4A 1ONQB 5JIPA 3DBXA 3FB7B 2YD5A 1PFCA 2XX0A 1IBFA 2BSED 4HEPG 4UZUA 1AI1L 4BUQA 1CU4H 3WMSA 3L6FB 5E6IA 2Y7QA 3MV9B 3FCSB 1GGIL 3CFKA 5C6TL 5EZIH 3QQNA 4YSOA 3GMNA 5CM1A 1KCRH 1S9VA 3CSYB 4CNIB 1HT6A 2ESVA 4DQOH 5F8RC 3NAAH 1PU0A 2VISB 2AQNA 3KPLA 4M6OL 5IOPB 1PD0A 4OIBA 2EXWC 5CEZH 3FFDA 5DUML 1F3JB 4XCCL 2GIYA 2AK1H 2E8ZA 4WIQA 1DQKA 3NFPB 4GO9A 4PJEE 1H8NA 1QJ8A 2CO6A 5CINL 1TNNA 4JCHA 4FQEA 5A6LA 4QRPD 2FT7A 2O1AA 1PPIA 4ALAH 4DGVH 3O6ML 4AEEA 5DMKA 5FGCE 4Z7QF 4UM8A 3SYCA 5DMYA 5EEZA 4N8VG 2NLJB 4PRIE 3N9GL 2L3BA 2RTTA 4Y19A 4JM4H 3A0BO 1MPAH 2X9ZA 4XPGL 5CCKL 1D2OA 5DDHB 1GSMA 3KPSD 4NHCL 3NACH 3SQOH 4LASH 2QQNH 3W37A 3R7QA 1QTPA 1EBPA 3SPHA 3U36B 1Z3RA 3NIGF 2I9TB 4K23H 4W9EC 3QPXH 5G55A 1V8HA 4YXKL 3DMMB 3ECWA 4Z7WA 3F7LA 3NIDE 3NFPA 2MHAB 3NZHH 5E70A 6FABH 5EU6D 4DVBA 4TUUA 1DYZA 2BY2A 2WUCL 4QCIB 2JF1A 2KXPB 5KSVB 1SY6L 1XR9A 2CSPA 1D5ZA 5IESH 3GMQA 4HUMB 2VH5H 3GZPA 1TZIA 3CFEB 4PUXA 2D7OA 3ENEA 3TIDB 4L1SA 4O2FB 2MNHA 4XMTA 5C86A 1P69B 3N1QC 3L3KB 4JRLA 2XKUA 1ONQA 3DSNB 4YGAB 5BQDA 2OYLA 3ISYA 4DAGH 5ISZD 4H44C 1F3DJ 2G0KA 2V5YA 3MCKA 3X12A 5LHDA 5ADXL 2EC8A 4QRQB 2P8PB 1N9PA 1IGCH 3CHQA 1ASPA 3OSVA 1OCOB 1P84K 1HHGB 1R5VA 3MSPA 4YFDB 1Y18B 2F6AA 1T80A 1J5DA 4KMQA 4B5ZA 2N2MA 1AZVA 1AR1C 3GM0A 5LWYH 2VLME 2X28A 1CMOA 3MLTA 5D96C 5LVEA 4HCGA 3WNMA 1OF2A 1S5IH 3O2DH 4MJID 4PREB 1M2VA 2X7LB 4LLUB 1CE6B 4CBPA 3VFUA 3WFDL 1BQLL 2F18A 2WXLA 1RUQH 2NY3D 4XCYB 2C4XA 4YPGB 4ZO6A 4HS3B 4KXBA 2ATKA 4HBCL 5HDQH 5FO2A 4KI1A 4NC0B 1U3YA 3GZOA 4DOHB 3L8QA 3C6LD 1IEBB 1T0MA 1CBVL 3ZTCC 1WAAA 3O6FB 3QUXA 1JWMA 1OP4A 1R5IA 2E59A 5C08E 2V7NA 2HN7B 3CZEA 2FQFA 4KXAA 2KS0A 5HI4D 5JIKA 4ABWA 4NENA 4LEOB 5D96B 3JVFC 2W60A 3GMPA 3H3PL 4XPHH 2ORBL 2JWYA 4D3CH 3O2VH 5IREA 3H0TA 2LFEA 3M1CA 4J12A 2VM3A 2XG5B 4D0CB 3DROA 2VXQL 5DD3H 3QIBD 1KYOK 4ZUTA 3V52H 4MD0B 2C9PA 5I76B 4OZIA 1S6NA 2CJUL 4F9LA 3BQUB 4GUPA 4NYLA 1IU1A 1CC3A 1ZLWK 2WMPA 3V7MA 3K6SB 3DMMC 1RZ8B 2XZQL 5CMAA 4P2OB 4U9CA 1JK9B 5KOMC 3VZUX 2VDLB 3IKCB 3NCEB 5KWYC 5HYFA 4GUOA 3EFOB 5GGRB 3WL9B 1D5RA 5AVYB 3BIKA 1MH5A 4HOXA 2JCCF 3ZKMC 2NTFB 2Z35A 1HQRA 5FUCE 3ZZ1A 4XP6L 1ZHZA 3PWPD 4ES8A 3ILPB 2YXMA 3FUMA 3SJVD 4CBZA 2AP2A 3ULAB 3SBRA 5JHDB 5LN4A 1XR8B 4JKPL 4NQUA 1BZEA 2W59A 3GS0A 5F7DB 4FRTA 2CJSA 2B1OA 2EH8L 1BH3A 4IBVA 1CXFA 5HVFB 5JW4Q 3H54A 3GXMA 5F8QC 4Z7VA 1J1PL 3VSQA 2QGBA 4XPFL 3SDAD 1A6WH 2E7BA 4W70A 2IPKA 1IKFH 4MDIB 1G7MB 5I19L 3JCUO 1MHHB 2E9IA 4ZODA 1MCWW 3PV6B 1M42A 3RL1A 1S7RA 3JTSA 3RLSA 2F08A 4FQ1L 1CGSH 3U0PB 4FAAB 5JORB 2Y2TA 1B9ZA 2PP9A 2ZOLB 1OP5K 1JZ6A 1I8AA 5I8EA 5AB0A 3BAKA 3DXAA 3NSJA 4LLMB 1TJHL 4GXVH 3EHBC 3ESPA 3RIAF 5CU9A 3PF2A 2LLLA 3IDMB 3UH8A 4PRHE 3IBEA 4WWKD 1VZIA 1GC1C 1JZEA 4PWKA 5DMKB 4WWKA 1S7QB 1QVOB 3G5YB 4FG6D 5MEQB 3Q8AA 2X6VA 4FJYA 3N04A 1JGLH 4O58L 3MRPB 3R1GH 4DKDC 5IMMB 2N0MA 5BUPA 4ELKB 4FQXA 4AE1A 3CFBA 3VQLA 1DANU 1LLAA 4Y16D 4JDTL 5I8OH 1R0AH 1EUTA 5GZNA 2K4AA 4DP4X 2YMXL 4PMEA 3V4LA 3PGFH 1JD7A 3FOMA 3B34A 1FNLA 4FQCH 2NY4D 2DM3A 4UANA 4PSPA 3GD1C 1E7VA 5CUSL 3Q13A 4J8RA 4Z3IA 5AVUB 5D7IB 3WGVB 5L4FA 2VM4A 4K2UL 2PTTB 3ZTDC 2JLPA 4EN2A 1DBMH 4OLVH 1U3JA 4H26B 4EZLA 4G1EA 2QSCL 4KK8D 3MGTB 3II2A 5I1HH 1QNIA 3QR1A 1J11A 4D9RD 2AANA 5SX4H 4RGMC 3GSRB 4P46D 4Z95H 4ZPVA 1J12A 1C7SA 3PWUA 2KUTA 5AKTA 1A6TB 1KIUB 1HZHL 3P9LA 4YXKH 4GSDH 2F15A 1S9YA 1WAEA 1SMDA 4OFDA 5DJ2B 3VJ6B 1ZGLP 2AXGA 5CIPA 4NZTH 3RI5F 3WIFB 1WCBB 1MKFA 3RVVD 1HCVA 4OGAD 1EAJA 1IBBA 1WYJA 2BDNL 4U2YA 3K1DA 2A74A 2CO3A 4JZNB 1DE4B 1A2YB 4MWFB 4KZEH 5DS1A 1PCSA 5FLVA 1HFUA 5MENE 4KZCA 4A7GA 3RWCA 1FHGA 5EPMA 3RIAK 2UWEA 2J57A 3MO1B 3B9VA 3A4FA 3A6BL 4FQHA 1X44A 2H6OA 1HIMH 4PJIE 3NIGB 4RFOL 3ETBJ 5KS9F 3W1ZA 2NZIA 1BOGA 3PGDA 3GNML 1CFQB 4FQIL 2PPEA 2DM4A 4FCHA 3QHFL 4PVMA 3V5KB 1NGQL 5EE2A 2JI2A 1BBJA 2OCFD 2VW6A 1NCWL 4OLXH 3HG2A 4EI5A 5IEKB 4AYDC 1FGNL 4N0UE 5C2BH 1OWRM 5EIIA 1SHMA 1X9UA 3CPLA 5FYKD 3CX2A 2EIJB 3MUGB 1FFPB 4LLQB 1NFIB 1L9PA 1R17A 2YZ1A 4DO5A 3G6JE 4GYBA 4L8SA 4HLJA 5FPIA 1KB5L 5IHZA 5AVTB 1NGZB 1QWHA 2UVFA 5DUPL 2ADFH 5AB2A 4YUEL 1XH0A 4Y5XB 1IAOA 3T2LA 4NRXB 4UOZA 3MRRA 2WXJA 2GTWA 3TH2T 1BVLB 4FI7A 3X1FA 3DIDA 3VI3B 5J9PA 5H94A 3QQ3B 1A6VL 4AIEA 1Q72L 3SDXE 1FL3A 2BK8A 2UZXA 2VT0A 3DOSA 1XL6A 2R4SH 3LDBB 4JFXB 5IBTL 3HE7D 2AJ3A 2MPVA 4PRDA 1OAKL 2FIKA 2B1HH 3BPNB 3M07A 2DOCA 2UXVA