8PRNA

E1m, k50a, r52a, d97a, e99a mutant of rh. blastica porin
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAALAMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYASAMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
total genus 74
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 8prnA00
4FMSA 2J1NA 4FSPA 2Y0LA 3POUA 5PRNA 4AUIA 2FGRA 4LSHA 3SY9A 3VY8X 3VZWX 7PRNA 2Y2XA 4GCQA 3POQA 4BUMX 1BT9A 4C69X 4KR4A 2XG6A 2XE5A 3T0SA 3VY9X 4LSEA 2XE2A 5DL8A 4D5UA 1GFQA 4D64A 3EMNX 1MPFA 1GFNA 1HXTA 1GFOA 4FT6A 2XE1A 3FYXA 3UU2A 2XE3A 4FOZA 1GFPA 3T20A 3UPGA 3SZDA 8PRNA 4RJXA 2PRNA 3O0EA 3POXA 4GCSA 4FSOA 3SYSA 4JFBA 3HW9A 3WI5A 4LSIA 4RJWA 2OMFA 4FRXA 1PHOA 3HWBA 1E54A 1OPFA 6PRNA 3VZTX 1OSMA 4FRTA 4KR8A 4D65A 4KRAA 3PORA 5JDPA 1BH3A 1H6S1 2ZLDA 2ODJA 4LSFA 2Y0HA 4GCPA 1GFMA 2FGQX 5DL6A 2J4UP 5DL5A 1HXXA 2PORA 2K4TA 3T24A 2QTKA 3JTYA 3A2SX 2ZFGA 3K19A 5FVNA 1PRNA 3SYBA 3SZVA 3VZUX 3PRNA 1HXUA 5DL7A 3SY7A 3WI4A 2Y0KA 3NSGA 2O4VA
chains in the Genus database with same CATH superfamily
2MHLA 4GHBA 4K3CA 4FMSA 2J1NA 1QJ8A 2Y0LA 3POUA 4FSPA 1BXWA 5PRNA 4AUIA 2FGRA 2R4OA 3PGSA 3AAEA 2K0LA 2X27X 4K3BA 4LSHA 5G39A 3SY9A 3VY8X 3VZWX 3LK2A 7PRNA 3PQUA 3DZMA 2Y2XA 1THQA 3QRCA 4GCQA 4GF4A 2R89A 4AKRA 3POQA 3LK3B 2KXPB 1BT9A 5G38A 2XTRA 1T16A 5GTIO 4BUMX 2YPVA 4KR4A 3AA0B 4XNKA 4C69X 2XG6A 2XE5A 4C4VB 3T0SA 3VY9X 4LSEA 5IYUA 2WVPA 2XE2A 1QJ9A 2KC0A 5KAFO 4AYDC 1ZHTA 4FZMA 3DA4A 1GFQA 3PGRA 5DL8A 5E79O 1ZHZA 4AYMC 4D64A 2LFUA 3EMNX 2F1TA 3G7GA 1MPFA 1GFNA 1HXTA 2N2MA 1GFOA 3NSGA 4FT6A 1QJPA 3AA1B 3LK41 2XE1A 3AA6B 3FYXA 3UU2A 4FESA 3AAAA 2KZ7A 2XE3A 4O3ZA 3RBHA 2W80C 4FOZA 2XTQA 2IWVA 4FUVA 4RLCA 1GFPA 4UB8O 4Z3TA 3T20A 2M07A 5D5DA 2WJQA 1MM5A 3UPGA 4N75A 3KVDD 3SZDA 4U9CA 4O3YA 4E1TA 4B61A 4XNLA 8PRNA 2AXTO 3JCUO 4PJ0O 4RJXA 2PRNA 3O0EA 4IL6O 3POXA 5KAIO 4AYEC 3LK42 3AA7B 4FSOA 3LK3A 2KXPA 4GCSA 4RLBA 3SYSA 5GV0A 2GE4A 4JFBA 3V8UA 3AA0A 3HW9A 2X9KA 4UB6O 2M06A 3WI5A 5H2FO 2KDYA 5GTHO 4C4VA 2N2LA 4LSIA 4N59A 4RL9A 4RJWA 4O4UA 2OMFA 4FRXA 4O49A 1PHOA 3HWBA 2F1VA 4D5UA 1T1LA 5B5EO 1E54A 5T5FA 2R8AA 1OPFA 2ERVA 3A0HO 6PRNA 3HOEA 3BRZA 3VZTX 3VE2A 1OSMA 2W81C 3AA1A 3PF1A 4AYID 3AA6A 4FRTA 4KR8A 2IWWA 4D65A 2YNKA 4KRAA 3PGUA 1ZHYA 2JMMA 2R4LA 4FQEA 4PUXA 4C00A 2Y7SA 3PORA 3TZGA 4CTDA 4FZNA 1IZNB 5JDPA 4JCHA 1BH3A 1ZHWA 5EE2A 3NJTA 4F4BA 2R4PA 1Q9FA 1H6S1 2ZLDA 3PQSA 2ODJA 3AAEB 2Y0HA 4LSFA 3GP6A 4AZLA 4GCPA 2R4NA 3LK2B 1GFMA 4G76A 2FGQX 4AKRB 5DL6A 4QQ1A 2J4UP 1YS5A 3AA7A 3C5OA 5DL5A 1HXXA 2PORA 2K4TA 4N74A 4O3WA 3T24A 2QTKA 5AFUL 3QRAA 3HOLA 3JTYA 2MNHA 3A2SX 5AFUK 2ZFGA 1ORMA 3DWNA 3K19A 3UAQA 3VE1A 5G26A 3BRYA 3A0BO 4FZLA 5FVNA 2R88A 2LHFA 1G90A 1PRNA 5G3AA 1Q9GA 3SYBA 2WJRA 5ADXL 3SZVA 3DA3A 3BS0A 5ADXK 2JQYA 3WU2O 5TISO 1S5LO 3AAAB 3VZUX 2F1CX 2KZ7B 3PRNA 4N58A 4AYNA 4E1SA 1MM4A 5B66O 2XMXA 4AFKA 4O3XB 4AKMA 1HXUA 4G75A 3DWOX 5DL7A 3SY7A 3WI4A 2Y0KA 1IZNA 3KZIO 1ZHXA 4PR7A 4O4XA 1P4TA 2O4VA
chains in the Genus database with same CATH topology
2MHLA 4GHBA 4FMSA 2J1NA 1QJ8A 2Y0LA 3POUA 4FSPA 1BXWA 5PRNA 4AUIA 2FGRA 3AAEA 2K0LA 2X27X 4E1SA 4LSHA 3SY9A 3VY8X 3VZWX 7PRNA 3LK2A 3PQUA 2Y2XA 1THQA 3QRCA 4GCQA 4GF4A 4AKRA 3POQA 3LK3B 2KXPB 1BT9A 4BUMX 2XTRA 4C69X 2YPVA 4KR4A 3AA0B 4XNKA 2XG6A 2XE5A 3T0SA 3VY9X 4LSEA 5IYUA 2XE2A 1QJ9A 2KC0A 4AYDC 1ZHTA 4FZMA 3DA4A 1GFQA 5DL8A 4D5UA 1ZHZA 4D64A 2LFUA 3EMNX 2F1TA 3G7GA 1MPFA 1GFNA 1HXTA 2N2MA 1GFOA 3NSGA 4FT6A 1QJPA 3AA1B 3LK41 2XE1A 3AA6B 3FYXA 3UU2A 4FESA 3AAAA 2KZ7A 2XE3A 4O3ZA 3RBHA 2W80C 4FOZA 2XTQA 4FUVA 4RLCA 1GFPA 3T20A 4Z3TA 2M07A 5D5DA 1MM5A 3UPGA 3SZDA 3KVDD 4U9CA 4O3YA 4E1TA 4B61A 4XNLA 8PRNA 4RJXA 2PRNA 3O0EA 3POXA 4AYEC 3LK42 3AA7B 4FSOA 3LK3A 2KXPA 4GCSA 4RLBA 3SYSA 5GV0A 2GE4A 4JFBA 3V8UA 3AA0A 3HW9A 2M06A 3WI5A 2KDYA 2N2LA 4LSIA 4N59A 4RL9A 4RJWA 4O4UA 2OMFA 4FRXA 4O49A 1PHOA 3HWBA 2F1VA 1E54A 5T5FA 1OPFA 2ERVA 6PRNA 3HOEA 3VZTX 3VE2A 1OSMA 2W81C 3AA1A 4AYID 3AA6A 4FRTA 4KR8A 4D65A 2YNKA 4KRAA 4PUXA 1ZHYA 2JMMA 2Y7SA 3PORA 3TZGA 4FZNA 1IZNB 5JDPA 4JCHA 1BH3A 1ZHWA 5EE2A 4F4BA 1Q9FA 1H6S1 2ZLDA 3PQSA 2ODJA 3AAEB 2Y0HA 4LSFA 3GP6A 4AZLA 4GCPA 3LK2B 1GFMA 4G76A 2FGQX 4AKRB 5DL6A 4QQ1A 2J4UP 1YS5A 3AA7A 3C5OA 5DL5A 1HXXA 2PORA 2K4TA 4O3WA 3T24A 5AFUL 2QTKA 3QRAA 3HOLA 3JTYA 2MNHA 3A2SX 5AFUK 2ZFGA 1ORMA 3K19A 3UAQA 3VE1A 5G26A 4FZLA 5FVNA 1G90A 2LHFA 1PRNA 1Q9GA 3SYBA 5ADXL 3SZVA 3DA3A 5ADXK 3AAAB 3VZUX 2KZ7B 4N58A 3PRNA 4AYNA 1MM4A 2XMXA 4AFKA 4O3XB 4AKMA 1HXUA 4G75A 5DL7A 3SY7A 3WI4A 2Y0KA 1IZNA 1ZHXA 4AYMC 4O4XA 1P4TA 2O4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMS A;  2J1N A;  4FSP A;  2Y0L A;  3POU A;  5PRN A;  4AUI A;  2FGR A;  4LSH A;  3SY9 A;  3VY8 X;  3VZW X;  7PRN A;  2Y2X A;  4GCQ A;  3POQ A;  4BUM X;  1BT9 A;  4C69 X;  4KR4 A;  2XG6 A;  2XE5 A;  3T0S A;  3VY9 X;  4LSE A;  2XE2 A;  5DL8 A;  4D5U A;  1GFQ A;  4D64 A;  3EMN X;  1MPF A;  1GFN A;  1HXT A;  1GFO A;  4FT6 A;  2XE1 A;  3FYX A;  3UU2 A;  2XE3 A;  4FOZ A;  1GFP A;  3T20 A;  3UPG A;  3SZD A;  8PRN A;  4RJX A;  2PRN A;  3O0E A;  3POX A;  4GCS A;  4FSO A;  3SYS A;  4JFB A;  3HW9 A;  3WI5 A;  4LSI A;  4RJW A;  2OMF A;  4FRX A;  1PHO A;  3HWB A;  1E54 A;  1OPF A;  6PRN A;  3VZT X;  1OSM A;  4FRT A;  4KR8 A;  4D65 A;  4KRA A;  3POR A;  5JDP A;  1BH3 A;  1H6S 1;  2ZLD A;  2ODJ A;  4LSF A;  2Y0H A;  4GCP A;  1GFM A;  2FGQ X;  5DL6 A;  2J4U P;  5DL5 A;  1HXX A;  2POR A;  2K4T A;  3T24 A;  2QTK A;  3JTY A;  3A2S X;  2ZFG A;  3K19 A;  5FVN A;  1PRN A;  3SYB A;  3SZV A;  3VZU X;  3PRN A;  1HXU A;  5DL7 A;  3SY7 A;  3WI4 A;  2Y0K A;  3NSG A;  2O4V A; 
#chains in the Genus database with same CATH topology
 2MHL A;  4GHB A;  4K3C A;  4FMS A;  2J1N A;  1QJ8 A;  2Y0L A;  3POU A;  4FSP A;  1BXW A;  5PRN A;  4AUI A;  2FGR A;  2R4O A;  3PGS A;  3AAE A;  2K0L A;  2X27 X;  4K3B A;  4LSH A;  5G39 A;  3SY9 A;  3VY8 X;  3VZW X;  3LK2 A;  7PRN A;  3PQU A;  3DZM A;  2Y2X A;  1THQ A;  3QRC A;  4GCQ A;  4GF4 A;  2R89 A;  4AKR A;  3POQ A;  3LK3 B;  2KXP B;  1BT9 A;  5G38 A;  2XTR A;  1T16 A;  5GTI O;  4BUM X;  2YPV A;  4KR4 A;  3AA0 B;  4XNK A;  4C69 X;  2XG6 A;  2XE5 A;  4C4V B;  3T0S A;  3VY9 X;  4LSE A;  5IYU A;  2WVP A;  2XE2 A;  1QJ9 A;  2KC0 A;  5KAF O;  4AYD C;  1ZHT A;  4FZM A;  3DA4 A;  1GFQ A;  3PGR A;  5DL8 A;  5E79 O;  1ZHZ A;  4AYM C;  4D64 A;  2LFU A;  3EMN X;  2F1T A;  3G7G A;  1MPF A;  1GFN A;  1HXT A;  2N2M A;  1GFO A;  3NSG A;  4FT6 A;  1QJP A;  3AA1 B;  3LK4 1;  2XE1 A;  3AA6 B;  3FYX A;  3UU2 A;  4FES A;  3AAA A;  2KZ7 A;  2XE3 A;  4O3Z A;  3RBH A;  2W80 C;  4FOZ A;  2XTQ A;  2IWV A;  4FUV A;  4RLC A;  1GFP A;  4UB8 O;  4Z3T A;  3T20 A;  2M07 A;  5D5D A;  2WJQ A;  1MM5 A;  3UPG A;  4N75 A;  3KVD D;  3SZD A;  4U9C A;  4O3Y A;  4E1T A;  4B61 A;  4XNL A;  8PRN A;  2AXT O;  3JCU O;  4PJ0 O;  4RJX A;  2PRN A;  3O0E A;  4IL6 O;  3POX A;  5KAI O;  4AYE C;  3LK4 2;  3AA7 B;  4FSO A;  3LK3 A;  2KXP A;  4GCS A;  4RLB A;  3SYS A;  5GV0 A;  2GE4 A;  4JFB A;  3V8U A;  3AA0 A;  3HW9 A;  2X9K A;  4UB6 O;  2M06 A;  3WI5 A;  5H2F O;  2KDY A;  5GTH O;  4C4V A;  2N2L A;  4LSI A;  4N59 A;  4RL9 A;  4RJW A;  4O4U A;  2OMF A;  4FRX A;  4O49 A;  1PHO A;  3HWB A;  2F1V A;  4D5U A;  1T1L A;  5B5E O;  1E54 A;  5T5F A;  2R8A A;  1OPF A;  2ERV A;  3A0H O;  6PRN A;  3HOE A;  3BRZ A;  3VZT X;  3VE2 A;  1OSM A;  2W81 C;  3AA1 A;  3PF1 A;  4AYI D;  3AA6 A;  4FRT A;  4KR8 A;  2IWW A;  4D65 A;  2YNK A;  4KRA A;  3PGU A;  1ZHY A;  2JMM A;  2R4L A;  4FQE A;  4PUX A;  4C00 A;  2Y7S A;  3POR A;  3TZG A;  4CTD A;  4FZN A;  1IZN B;  5JDP A;  4JCH A;  1BH3 A;  1ZHW A;  5EE2 A;  3NJT A;  4F4B A;  2R4P A;  1Q9F A;  1H6S 1;  2ZLD A;  3PQS A;  2ODJ A;  3AAE B;  2Y0H A;  4LSF A;  3GP6 A;  4AZL A;  4GCP A;  2R4N A;  3LK2 B;  1GFM A;  4G76 A;  2FGQ X;  4AKR B;  5DL6 A;  4QQ1 A;  2J4U P;  1YS5 A;  3AA7 A;  3C5O A;  5DL5 A;  1HXX A;  2POR A;  2K4T A;  4N74 A;  4O3W A;  3T24 A;  2QTK A;  5AFU L;  3QRA A;  3HOL A;  3JTY A;  2MNH A;  3A2S X;  5AFU K;  2ZFG A;  1ORM A;  3DWN A;  3K19 A;  3UAQ A;  3VE1 A;  5G26 A;  3BRY A;  3A0B O;  4FZL A;  5FVN A;  2R88 A;  2LHF A;  1G90 A;  1PRN A;  5G3A A;  1Q9G A;  3SYB A;  2WJR A;  5ADX L;  3SZV A;  3DA3 A;  3BS0 A;  5ADX K;  2JQY A;  3WU2 O;  5TIS O;  1S5L O;  3AAA B;  3VZU X;  2F1C X;  2KZ7 B;  3PRN A;  4N58 A;  4AYN A;  4E1S A;  1MM4 A;  5B66 O;  2XMX A;  4AFK A;  4O3X B;  4AKM A;  1HXU A;  4G75 A;  3DWO X;  5DL7 A;  3SY7 A;  3WI4 A;  2Y0K A;  1IZN A;  3KZI O;  1ZHX A;  4PR7 A;  4O4X A;  1P4T A;  2O4V A; 
#chains in the Genus database with same CATH homology
 2MHL A;  4GHB A;  4FMS A;  2J1N A;  1QJ8 A;  2Y0L A;  3POU A;  4FSP A;  1BXW A;  5PRN A;  4AUI A;  2FGR A;  3AAE A;  2K0L A;  2X27 X;  4E1S A;  4LSH A;  3SY9 A;  3VY8 X;  3VZW X;  7PRN A;  3LK2 A;  3PQU A;  2Y2X A;  1THQ A;  3QRC A;  4GCQ A;  4GF4 A;  4AKR A;  3POQ A;  3LK3 B;  2KXP B;  1BT9 A;  4BUM X;  2XTR A;  4C69 X;  2YPV A;  4KR4 A;  3AA0 B;  4XNK A;  2XG6 A;  2XE5 A;  3T0S A;  3VY9 X;  4LSE A;  5IYU A;  2XE2 A;  1QJ9 A;  2KC0 A;  4AYD C;  1ZHT A;  4FZM A;  3DA4 A;  1GFQ A;  5DL8 A;  4D5U A;  1ZHZ A;  4D64 A;  2LFU A;  3EMN X;  2F1T A;  3G7G A;  1MPF A;  1GFN A;  1HXT A;  2N2M A;  1GFO A;  3NSG A;  4FT6 A;  1QJP A;  3AA1 B;  3LK4 1;  2XE1 A;  3AA6 B;  3FYX A;  3UU2 A;  4FES A;  3AAA A;  2KZ7 A;  2XE3 A;  4O3Z A;  3RBH A;  2W80 C;  4FOZ A;  2XTQ A;  4FUV A;  4RLC A;  1GFP A;  3T20 A;  4Z3T A;  2M07 A;  5D5D A;  1MM5 A;  3UPG A;  3SZD A;  3KVD D;  4U9C A;  4O3Y A;  4E1T A;  4B61 A;  4XNL A;  8PRN A;  4RJX A;  2PRN A;  3O0E A;  3POX A;  4AYE C;  3LK4 2;  3AA7 B;  4FSO A;  3LK3 A;  2KXP A;  4GCS A;  4RLB A;  3SYS A;  5GV0 A;  2GE4 A;  4JFB A;  3V8U A;  3AA0 A;  3HW9 A;  2M06 A;  3WI5 A;  2KDY A;  2N2L A;  4LSI A;  4N59 A;  4RL9 A;  4RJW A;  4O4U A;  2OMF A;  4FRX A;  4O49 A;  1PHO A;  3HWB A;  2F1V A;  1E54 A;  5T5F A;  1OPF A;  2ERV A;  6PRN A;  3HOE A;  3VZT X;  3VE2 A;  1OSM A;  2W81 C;  3AA1 A;  4AYI D;  3AA6 A;  4FRT A;  4KR8 A;  4D65 A;  2YNK A;  4KRA A;  4PUX A;  1ZHY A;  2JMM A;  2Y7S A;  3POR A;  3TZG A;  4FZN A;  1IZN B;  5JDP A;  4JCH A;  1BH3 A;  1ZHW A;  5EE2 A;  4F4B A;  1Q9F A;  1H6S 1;  2ZLD A;  3PQS A;  2ODJ A;  3AAE B;  2Y0H A;  4LSF A;  3GP6 A;  4AZL A;  4GCP A;  3LK2 B;  1GFM A;  4G76 A;  2FGQ X;  4AKR B;  5DL6 A;  4QQ1 A;  2J4U P;  1YS5 A;  3AA7 A;  3C5O A;  5DL5 A;  1HXX A;  2POR A;  2K4T A;  4O3W A;  3T24 A;  5AFU L;  2QTK A;  3QRA A;  3HOL A;  3JTY A;  2MNH A;  3A2S X;  5AFU K;  2ZFG A;  1ORM A;  3K19 A;  3UAQ A;  3VE1 A;  5G26 A;  4FZL A;  5FVN A;  1G90 A;  2LHF A;  1PRN A;  1Q9G A;  3SYB A;  5ADX L;  3SZV A;  3DA3 A;  5ADX K;  3AAA B;  3VZU X;  2KZ7 B;  4N58 A;  3PRN A;  4AYN A;  1MM4 A;  2XMX A;  4AFK A;  4O3X B;  4AKM A;  1HXU A;  4G75 A;  5DL7 A;  3SY7 A;  3WI4 A;  2Y0K A;  1IZN A;  1ZHX A;  4AYM C;  4O4X A;  1P4T A;  2O4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...