1H6S1

Asymmetric conductivity of engineered proteins
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
307
structure length
289
Chain Sequence
b'EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Asymmetric Conductivity of Engineered Porins
pubmed doi rcsb
source organism Rhodopseudomonas blastica
molecule tags Membrane protein
total genus 73
structure length 289
sequence length 307
ec nomenclature
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1h6s100
1HXTA 2XE5A 3HW9A 4RJWA 3NSGA 3SY7A 5PRNA 1GFNA 1PHOA 4JFBA 3SYBA 2J4UP 2Y0HA 2QTKA 4FRXA 1OPFA 3UU2A 4FSOA 3O0EA 3UPGA 4FMSA 2ZLDA 3POUA 1OSMA 1BT9A 3SY9A 1E54A 3HWBA 4D5UA 5JDPA 4D64A 4GCSA 1MPFA 2PRNA 3T24A 3FYXA 3A2SX 3POXA 4LSHA 3K19A 2J1NA 1PRNA 2PORA 3SYSA 1HXUA 2FGQX 3VZTX 2ODJA 4FOZA 1HXXA 3SZVA 2Y0KA 4FSPA 4FT6A 2FGRA 3PRNA 3EMNX 2K4TA 3VZUX 2Y0LA 4LSIA 6PRNA 2Y2XA 5FVNA 2XE3A 2O4VA 2XE1A 3PORA 3SZDA 1GFQA 4C69X 4RJXA 3WI5A 2OMFA 4FRTA 5DL5A 1BH3A 1GFOA 4KRAA 5DL8A 3VY8X 7PRNA 4AUIA 4GCPA 3T0SA 3JTYA 4GCQA 3T20A 1GFMA 5DL6A 3VY9X 3WI4A 4LSFA 4BUMX 3POQA 4KR8A 4KR4A 4D65A 2ZFGA 2XG6A 1H6S1 8PRNA 5DL7A 3VZWX 4LSEA 2XE2A 1GFPA
chains in the Genus database with same CATH superfamily
1HXTA 3LK2A 2XE5A 1BXWA 3HW9A 4AZLA 1ZHYA 2LHFA 2MHLA 2MNHA 4RJWA 3NSGA 2IWWA 3SY7A 4PUXA 2R4PA 5PRNA 1T1LA 1GFNA 3LK41 1PHOA 2X27X 2GE4A 3QRAA 4UB6O 5GTIO 5E79O 5IYUA 1G90A 2R4LA 4JFBA 2XTRA 2JQYA 4O3XB 2WJRA 2YPVA 3AA1A 3SYBA 4C4VB 2J4UP 4O4XA 2R4OA 5G26A 1MM5A 2Y0HA 3DA3A 2QTKA 3KZIO 4FRXA 5GV0A 3A0HO 4C4VA 3DA4A 4K3BA 4JCHA 3AA6A 2XTQA 3NJTA 4C00A 1OPFA 2F1TA 3UU2A 4FSOA 3O0EA 3PQSA 2ERVA 4FMSA 3UPGA 1THQA 5KAIO 2ZLDA 5AFUL 3POUA 4AYMC 2WJQA 1OSMA 5ADXL 2AXTO 1BT9A 3V8UA 3SY9A 1E54A 3HWBA 4AYID 2N2LA 4U9CA 4D5UA 4D64A 3AAAB 4AFKA 4N58A 5JDPA 4N75A 4XNKA 1ZHWA 4XNLA 3PGRA 1Q9GA 3AA0B 2XMXA 4GCSA 1MPFA 2PRNA 3T24A 3AAAA 3FYXA 3LK42 3A2SX 3POXA 5D5DA 5B66O 5H2FO 4FUVA 4LSHA 3K19A 3AA0A 2J1NA 3PQUA 1PRNA 2PORA 4FZLA 3SYSA 4O4UA 4UB8O 1HXUA 5AFUK 2FGQX 3VZTX 4AKMA 2M06A 1ZHXA 2ODJA 4FOZA 4K3CA 1HXXA 4O49A 4AKRB 1T16A 2W80C 2WVPA 1Q9FA 2KDYA 3GP6A 3SZVA 3AAEB 4GF4A 2K0LA 4RL9A 2X9KA 2Y0KA 3QRCA 5G38A 1QJ9A 4FSPA 3HOEA 5G3AA 4FT6A 2R89A 2FGRA 3BS0A 3PRNA 5GTHO 4IL6O 2F1CX 1IZNB 2M07A 3EMNX 2K4TA 5EE2A 3VZUX 2Y0LA 3DZMA 2KXPB 3BRZA 4G76A 4LSIA 4O3WA 4E1TA 6PRNA 1ORMA 2Y2XA 2KC0A 2R8AA 2XE3A 1IZNA 5FVNA 3LK3B 4PJ0O 2O4VA 2XE1A 4AYEC 2YNKA 4AYDC 3PORA 3SZDA 1GFQA 4C69X 3C5OA 4QQ1A 4RJXA 3WI5A 3PF1A 4O3ZA 3LK3A 4FQEA 2OMFA 1YS5A 4FRTA 3UAQA 3TZGA 3LK2B 5DL5A 1BH3A 1GFOA 5TISO 2N2MA 4FZNA 4KRAA 5DL8A 3VE2A 3VY8X 7PRNA 4AUIA 3AA7B 4GCPA 3T0SA 3WU2O 3JTYA 3PGUA 4GCQA 1P4TA 4G75A 4AKRA 3G7GA 3T20A 1GFMA 3PGSA 5DL6A 1ZHZA 3AA1B 3AAEA 4RLBA 3AA7A 4E1SA 3HOLA 3VY9X 2JMMA 5G39A 2R88A 3WI4A 2KZ7B 4LSFA 3JCUO 4RLCA 4BUMX 4Z3TA 5KAFO 3POQA 2R4NA 3KVDD 2LFUA 4KR8A 4FZMA 4B61A 3AA6B 4CTDA 2W81C 1S5LO 2KZ7A 3A0BO 3DWNA 4GHBA 1MM4A 2KXPA 4KR4A 4PR7A 2ZFGA 3VE1A 4D65A 1ZHTA 2XG6A 4N74A 2IWVA 4FESA 1QJ8A 1H6S1 4F4BA 5B5EO 8PRNA 3DWOX 1QJPA 5DL7A 3VZWX 3RBHA 4AYNA 3BRYA 4LSEA 4N59A 5ADXK 2F1VA 2XE2A 2Y7SA 1GFPA 4O3YA 5T5FA
chains in the Genus database with same CATH topology
1HXTA 3LK2A 2XE5A 1BXWA 3HW9A 4AZLA 1ZHYA 2LHFA 2MHLA 2MNHA 4RJWA 3NSGA 3SY7A 4PUXA 5PRNA 1GFNA 3LK41 1PHOA 2X27X 2GE4A 3QRAA 5IYUA 1G90A 4JFBA 2XTRA 4O3XB 2YPVA 3AA1A 3SYBA 2J4UP 4O4XA 5G26A 1MM5A 2Y0HA 3DA3A 2QTKA 4FRXA 5GV0A 3DA4A 4JCHA 3AA6A 2XTQA 1OPFA 2F1TA 3UU2A 4FSOA 3O0EA 3PQSA 2ERVA 4FMSA 3UPGA 1THQA 5ADXL 2ZLDA 5AFUL 3POUA 4AYMC 1OSMA 1BT9A 3V8UA 3SY9A 1E54A 3HWBA 4AYID 2N2LA 4U9CA 4D5UA 4D64A 3AAAB 4AFKA 4N58A 5JDPA 4XNKA 1ZHWA 4XNLA 1Q9GA 3AA0B 2XMXA 4GCSA 1MPFA 2PRNA 3T24A 3AAAA 3FYXA 3LK42 3A2SX 3POXA 5D5DA 4FUVA 4LSHA 3K19A 3AA0A 2J1NA 3PQUA 1PRNA 2PORA 4FZLA 3SYSA 4O4UA 1HXUA 5AFUK 2FGQX 3VZTX 4AKMA 2M06A 1ZHXA 2ODJA 4FOZA 4AKRB 1HXXA 4O49A 2W80C 1Q9FA 2KDYA 3GP6A 3SZVA 3AAEB 4GF4A 2K0LA 4RL9A 2Y0KA 3QRCA 1QJ9A 4FSPA 3HOEA 4FT6A 2FGRA 3PRNA 1IZNB 2M07A 3EMNX 2K4TA 5EE2A 3VZUX 2Y0LA 2KXPB 4LSIA 4G76A 4E1TA 4O3WA 6PRNA 1ORMA 2Y2XA 2KC0A 5FVNA 2XE3A 1IZNA 4AYEC 3LK3B 4AYDC 2O4VA 2XE1A 2YNKA 3PORA 3SZDA 1GFQA 4C69X 3C5OA 4QQ1A 4RJXA 3WI5A 4O3ZA 3LK3A 2OMFA 1YS5A 4FRTA 3UAQA 3TZGA 3LK2B 5DL5A 1BH3A 1GFOA 2N2MA 4FZNA 4KRAA 5DL8A 3VE2A 3VY8X 7PRNA 4AUIA 3AA7B 4GCPA 3T0SA 3JTYA 4GCQA 1P4TA 4G75A 4AKRA 3G7GA 3T20A 1GFMA 5DL6A 1ZHZA 3AA1B 3AAEA 4RLBA 3AA7A 4E1SA 3HOLA 3VY9X 2JMMA 3WI4A 2KZ7B 4LSFA 4RLCA 4BUMX 4Z3TA 3POQA 4B61A 3KVDD 2LFUA 4KR8A 4FZMA 3AA6B 2W81C 2KZ7A 4KR4A 4GHBA 1MM4A 2KXPA 3VE1A 4D65A 2ZFGA 1ZHTA 2XG6A 4FESA 1QJ8A 1H6S1 4F4BA 8PRNA 1QJPA 5DL7A 3VZWX 3RBHA 4AYNA 4LSEA 4N59A 5ADXK 2F1VA 2XE2A 2Y7SA 1GFPA 4O3YA 5T5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXT A;  2XE5 A;  3HW9 A;  4RJW A;  3NSG A;  3SY7 A;  5PRN A;  1GFN A;  1PHO A;  4JFB A;  3SYB A;  2J4U P;  2Y0H A;  2QTK A;  4FRX A;  1OPF A;  3UU2 A;  4FSO A;  3O0E A;  3UPG A;  4FMS A;  2ZLD A;  3POU A;  1OSM A;  1BT9 A;  3SY9 A;  1E54 A;  3HWB A;  4D5U A;  5JDP A;  4D64 A;  4GCS A;  1MPF A;  2PRN A;  3T24 A;  3FYX A;  3A2S X;  3POX A;  4LSH A;  3K19 A;  2J1N A;  1PRN A;  2POR A;  3SYS A;  1HXU A;  2FGQ X;  3VZT X;  2ODJ A;  4FOZ A;  1HXX A;  3SZV A;  2Y0K A;  4FSP A;  4FT6 A;  2FGR A;  3PRN A;  3EMN X;  2K4T A;  3VZU X;  2Y0L A;  4LSI A;  6PRN A;  2Y2X A;  5FVN A;  2XE3 A;  2O4V A;  2XE1 A;  3POR A;  3SZD A;  1GFQ A;  4C69 X;  4RJX A;  3WI5 A;  2OMF A;  4FRT A;  5DL5 A;  1BH3 A;  1GFO A;  4KRA A;  5DL8 A;  3VY8 X;  7PRN A;  4AUI A;  4GCP A;  3T0S A;  3JTY A;  4GCQ A;  3T20 A;  1GFM A;  5DL6 A;  3VY9 X;  3WI4 A;  4LSF A;  4BUM X;  3POQ A;  4KR8 A;  4KR4 A;  4D65 A;  2ZFG A;  2XG6 A;  1H6S 1;  8PRN A;  5DL7 A;  3VZW X;  4LSE A;  2XE2 A;  1GFP A; 
#chains in the Genus database with same CATH topology
 1HXT A;  3LK2 A;  2XE5 A;  1BXW A;  3HW9 A;  4AZL A;  1ZHY A;  2LHF A;  2MHL A;  2MNH A;  4RJW A;  3NSG A;  2IWW A;  3SY7 A;  4PUX A;  2R4P A;  5PRN A;  1T1L A;  1GFN A;  3LK4 1;  1PHO A;  2X27 X;  2GE4 A;  3QRA A;  4UB6 O;  5GTI O;  5E79 O;  5IYU A;  1G90 A;  2R4L A;  4JFB A;  2XTR A;  2JQY A;  4O3X B;  2WJR A;  2YPV A;  3AA1 A;  3SYB A;  4C4V B;  2J4U P;  4O4X A;  2R4O A;  5G26 A;  1MM5 A;  2Y0H A;  3DA3 A;  2QTK A;  3KZI O;  4FRX A;  5GV0 A;  3A0H O;  4C4V A;  3DA4 A;  4K3B A;  4JCH A;  3AA6 A;  2XTQ A;  3NJT A;  4C00 A;  1OPF A;  2F1T A;  3UU2 A;  4FSO A;  3O0E A;  3PQS A;  2ERV A;  4FMS A;  3UPG A;  1THQ A;  5KAI O;  2ZLD A;  5AFU L;  3POU A;  4AYM C;  2WJQ A;  1OSM A;  5ADX L;  2AXT O;  1BT9 A;  3V8U A;  3SY9 A;  1E54 A;  3HWB A;  4AYI D;  2N2L A;  4U9C A;  4D5U A;  4D64 A;  3AAA B;  4AFK A;  4N58 A;  5JDP A;  4N75 A;  4XNK A;  1ZHW A;  4XNL A;  3PGR A;  1Q9G A;  3AA0 B;  2XMX A;  4GCS A;  1MPF A;  2PRN A;  3T24 A;  3AAA A;  3FYX A;  3LK4 2;  3A2S X;  3POX A;  5D5D A;  5B66 O;  5H2F O;  4FUV A;  4LSH A;  3K19 A;  3AA0 A;  2J1N A;  3PQU A;  1PRN A;  2POR A;  4FZL A;  3SYS A;  4O4U A;  4UB8 O;  1HXU A;  5AFU K;  2FGQ X;  3VZT X;  4AKM A;  2M06 A;  1ZHX A;  2ODJ A;  4FOZ A;  4K3C A;  1HXX A;  4O49 A;  4AKR B;  1T16 A;  2W80 C;  2WVP A;  1Q9F A;  2KDY A;  3GP6 A;  3SZV A;  3AAE B;  4GF4 A;  2K0L A;  4RL9 A;  2X9K A;  2Y0K A;  3QRC A;  5G38 A;  1QJ9 A;  4FSP A;  3HOE A;  5G3A A;  4FT6 A;  2R89 A;  2FGR A;  3BS0 A;  3PRN A;  5GTH O;  4IL6 O;  2F1C X;  1IZN B;  2M07 A;  3EMN X;  2K4T A;  5EE2 A;  3VZU X;  2Y0L A;  3DZM A;  2KXP B;  3BRZ A;  4G76 A;  4LSI A;  4O3W A;  4E1T A;  6PRN A;  1ORM A;  2Y2X A;  2KC0 A;  2R8A A;  2XE3 A;  1IZN A;  5FVN A;  3LK3 B;  4PJ0 O;  2O4V A;  2XE1 A;  4AYE C;  2YNK A;  4AYD C;  3POR A;  3SZD A;  1GFQ A;  4C69 X;  3C5O A;  4QQ1 A;  4RJX A;  3WI5 A;  3PF1 A;  4O3Z A;  3LK3 A;  4FQE A;  2OMF A;  1YS5 A;  4FRT A;  3UAQ A;  3TZG A;  3LK2 B;  5DL5 A;  1BH3 A;  1GFO A;  5TIS O;  2N2M A;  4FZN A;  4KRA A;  5DL8 A;  3VE2 A;  3VY8 X;  7PRN A;  4AUI A;  3AA7 B;  4GCP A;  3T0S A;  3WU2 O;  3JTY A;  3PGU A;  4GCQ A;  1P4T A;  4G75 A;  4AKR A;  3G7G A;  3T20 A;  1GFM A;  3PGS A;  5DL6 A;  1ZHZ A;  3AA1 B;  3AAE A;  4RLB A;  3AA7 A;  4E1S A;  3HOL A;  3VY9 X;  2JMM A;  5G39 A;  2R88 A;  3WI4 A;  2KZ7 B;  4LSF A;  3JCU O;  4RLC A;  4BUM X;  4Z3T A;  5KAF O;  3POQ A;  2R4N A;  3KVD D;  2LFU A;  4KR8 A;  4FZM A;  4B61 A;  3AA6 B;  4CTD A;  2W81 C;  1S5L O;  2KZ7 A;  3A0B O;  3DWN A;  4GHB A;  1MM4 A;  2KXP A;  4KR4 A;  4PR7 A;  2ZFG A;  3VE1 A;  4D65 A;  1ZHT A;  2XG6 A;  4N74 A;  2IWV A;  4FES A;  1QJ8 A;  1H6S 1;  4F4B A;  5B5E O;  8PRN A;  3DWO X;  1QJP A;  5DL7 A;  3VZW X;  3RBH A;  4AYN A;  3BRY A;  4LSE A;  4N59 A;  5ADX K;  2F1V A;  2XE2 A;  2Y7S A;  1GFP A;  4O3Y A;  5T5F A; 
#chains in the Genus database with same CATH homology
 1HXT A;  3LK2 A;  2XE5 A;  1BXW A;  3HW9 A;  4AZL A;  1ZHY A;  2LHF A;  2MHL A;  2MNH A;  4RJW A;  3NSG A;  3SY7 A;  4PUX A;  5PRN A;  1GFN A;  3LK4 1;  1PHO A;  2X27 X;  2GE4 A;  3QRA A;  5IYU A;  1G90 A;  4JFB A;  2XTR A;  4O3X B;  2YPV A;  3AA1 A;  3SYB A;  2J4U P;  4O4X A;  5G26 A;  1MM5 A;  2Y0H A;  3DA3 A;  2QTK A;  4FRX A;  5GV0 A;  3DA4 A;  4JCH A;  3AA6 A;  2XTQ A;  1OPF A;  2F1T A;  3UU2 A;  4FSO A;  3O0E A;  3PQS A;  2ERV A;  4FMS A;  3UPG A;  1THQ A;  5ADX L;  2ZLD A;  5AFU L;  3POU A;  4AYM C;  1OSM A;  1BT9 A;  3V8U A;  3SY9 A;  1E54 A;  3HWB A;  4AYI D;  2N2L A;  4U9C A;  4D5U A;  4D64 A;  3AAA B;  4AFK A;  4N58 A;  5JDP A;  4XNK A;  1ZHW A;  4XNL A;  1Q9G A;  3AA0 B;  2XMX A;  4GCS A;  1MPF A;  2PRN A;  3T24 A;  3AAA A;  3FYX A;  3LK4 2;  3A2S X;  3POX A;  5D5D A;  4FUV A;  4LSH A;  3K19 A;  3AA0 A;  2J1N A;  3PQU A;  1PRN A;  2POR A;  4FZL A;  3SYS A;  4O4U A;  1HXU A;  5AFU K;  2FGQ X;  3VZT X;  4AKM A;  2M06 A;  1ZHX A;  2ODJ A;  4FOZ A;  4AKR B;  1HXX A;  4O49 A;  2W80 C;  1Q9F A;  2KDY A;  3GP6 A;  3SZV A;  3AAE B;  4GF4 A;  2K0L A;  4RL9 A;  2Y0K A;  3QRC A;  1QJ9 A;  4FSP A;  3HOE A;  4FT6 A;  2FGR A;  3PRN A;  1IZN B;  2M07 A;  3EMN X;  2K4T A;  5EE2 A;  3VZU X;  2Y0L A;  2KXP B;  4LSI A;  4G76 A;  4E1T A;  4O3W A;  6PRN A;  1ORM A;  2Y2X A;  2KC0 A;  5FVN A;  2XE3 A;  1IZN A;  4AYE C;  3LK3 B;  4AYD C;  2O4V A;  2XE1 A;  2YNK A;  3POR A;  3SZD A;  1GFQ A;  4C69 X;  3C5O A;  4QQ1 A;  4RJX A;  3WI5 A;  4O3Z A;  3LK3 A;  2OMF A;  1YS5 A;  4FRT A;  3UAQ A;  3TZG A;  3LK2 B;  5DL5 A;  1BH3 A;  1GFO A;  2N2M A;  4FZN A;  4KRA A;  5DL8 A;  3VE2 A;  3VY8 X;  7PRN A;  4AUI A;  3AA7 B;  4GCP A;  3T0S A;  3JTY A;  4GCQ A;  1P4T A;  4G75 A;  4AKR A;  3G7G A;  3T20 A;  1GFM A;  5DL6 A;  1ZHZ A;  3AA1 B;  3AAE A;  4RLB A;  3AA7 A;  4E1S A;  3HOL A;  3VY9 X;  2JMM A;  3WI4 A;  2KZ7 B;  4LSF A;  4RLC A;  4BUM X;  4Z3T A;  3POQ A;  4B61 A;  3KVD D;  2LFU A;  4KR8 A;  4FZM A;  3AA6 B;  2W81 C;  2KZ7 A;  4KR4 A;  4GHB A;  1MM4 A;  2KXP A;  3VE1 A;  4D65 A;  2ZFG A;  1ZHT A;  2XG6 A;  4FES A;  1QJ8 A;  1H6S 1;  4F4B A;  8PRN A;  1QJP A;  5DL7 A;  3VZW X;  3RBH A;  4AYN A;  4LSE A;  4N59 A;  5ADX K;  2F1V A;  2XE2 A;  2Y7S A;  1GFP A;  4O3Y A;  5T5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...