1H6S1

Asymmetric conductivity of engineered proteins
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
307
structure length
289
Chain Sequence
EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PORIN
publication title Asymmetric Conductivity of Engineered Porins
pubmed doi rcsb
source organism Rhodopseudomonas blastica
total genus 73
structure length 289
sequence length 307
ec nomenclature
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1h6s100
8PRNA 3POXA 5DL8A 1BH3A 3T24A 2XE3A 1BT9A 4GCQA 4KR8A 4GCSA 3SZVA 4C69X 3VY9X 4LSEA 3FYXA 3HW9A 5DL6A 4BUMX 4AUIA 1OPFA 2PRNA 1PHOA 7PRNA 4RJXA 3O0EA 2XE2A 3JTYA 1MPFA 3PRNA 4FSPA 3SY9A 3SY7A 4KRAA 2ODJA 2PORA 3SYSA 3K19A 3VZUX 2ZLDA 3VZTX 3HWBA 4FOZA 3WI5A 1GFMA 4FMSA 1H6S1 4RJWA 3VY8X 2K4TA 1HXUA 2ZFGA 3EMNX 3T20A 2FGQX 3SZDA 5PRNA 3POUA 4LSFA 3T0SA 4FSOA 2OMFA 3SYBA 3UU2A 1HXTA 5DL7A 3WI4A 2Y0HA 4FRXA 4D64A 2XG6A 2XE5A 4D5UA 2FGRA 4FT6A 4GCPA 4JFBA 1GFPA 2QTKA 2XE1A 2Y0KA 6PRNA 2Y2XA 4FRTA 1HXXA 1GFQA 4LSHA 2Y0LA 3VZWX 5DL5A 1E54A 1GFNA 1OSMA 1PRNA 3PORA 2J1NA 3POQA 2O4VA 5FVNA 3NSGA 3A2SX 5JDPA 2J4UP 3UPGA 4KR4A 1GFOA 4D65A 4LSIA
chains in the Genus database with same CATH superfamily
5B66O 8PRNA 4FQEA 2N2LA 3DA4A 5GTIO 5T5FA 3POXA 2GE4A 1S5LO 1IZNA 4UB8O 1ZHTA 5GV0A 4FESA 3VE1A 1YS5A 5DL8A 5G26A 1BH3A 3KZIO 3PQUA 1Q9FA 3T24A 5IYUA 2KXPB 1BT9A 2XE3A 4GCQA 2F1VA 4GCSA 4KR8A 3WU2O 3PGRA 3SZVA 3VY9X 4LSEA 3FYXA 3HW9A 5DL6A 4AZLA 4C69X 2XTQA 3BS0A 4C4VA 4BUMX 4UB6O 4O49A 2KC0A 2KZ7A 4JCHA 2X9KA 4AUIA 2IWWA 3PGUA 4B61A 1OPFA 2WJRA 4AKRB 2PRNA 4FUVA 1PHOA 4AYID 7PRNA 4AYNA 4PR7A 3AA0B 4RJXA 5AFUK 4N59A 3O0EA 3PQSA 3BRZA 2LFUA 2XE2A 3AAAB 1MM5A 3JTYA 5D5DA 3LK3A 3A0BO 4RL9A 1MPFA 2R88A 1BXWA 2WJQA 3PRNA 3JCUO 3DWNA 4FSPA 4PJ0O 3SY9A 2JMMA 4GF4A 3KVDD 2YPVA 3C5OA 3SY7A 1G90A 4KRAA 1ZHWA 2ODJA 2KXPA 5KAFO 2PORA 3SYSA 3VE2A 3K19A 3VZUX 2ZLDA 5B5EO 3LK41 4QQ1A 3VZTX 2K0LA 4CTDA 3HOLA 3HWBA 5TISO 2KDYA 4O3YA 4FOZA 3AA1B 3RBHA 1GFMA 1ZHZA 3WI5A 4AFKA 3BRYA 3NJTA 4FMSA 1H6S1 4RJWA 3VY8X 2K4TA 4AKRA 5ADXL 1HXUA 4IL6O 2ZFGA 3EMNX 1T1LA 4G75A 4U9CA 4N58A 2X27X 3AA0A 3QRAA 3T20A 2JQYA 2FGQX 5E79O 5PRNA 3SZDA 3POUA 4LSFA 3T0SA 3A0HO 3AAAA 4FSOA 2OMFA 5GTHO 4AYMC 5G39A 4AYEC 4O3WA 3SYBA 3UU2A 2R4LA 1HXTA 2F1CX 3LK42 4K3BA 5DL7A 3WI4A 2Y7SA 4FZMA 5KAIO 3QRCA 2Y0HA 4E1SA 4RLBA 4AYDC 3AA6B 3LK2B 3PGSA 4FZLA 4FRXA 4D64A 2ERVA 3AAEB 1Q9GA 2XTRA 2XG6A 2XE5A 4D5UA 2FGRA 4FT6A 3TZGA 2MHLA 2W80C 4GCPA 5G38A 1P4TA 4JFBA 4XNLA 2R4OA 4G76A 5AFUL 1GFPA 3AA7B 4Z3TA 3AA1A 1QJ9A 2QTKA 2XE1A 4O4UA 2Y0KA 6PRNA 2N2MA 2Y2XA 5ADXK 1THQA 2WVPA 4FRTA 1HXXA 1QJPA 1GFQA 4F4BA 2R8AA 3DA3A 4LSHA 4O3ZA 2LHFA 1IZNB 2M07A 3G7GA 4N74A 5G3AA 1ORMA 2Y0LA 3V8UA 3VZWX 5DL5A 2XMXA 3GP6A 1E54A 4O3XB 4XNKA 1GFNA 1OSMA 2AXTO 3UAQA 2M06A 2R4PA 4N75A 1PRNA 4C4VB 3AA6A 3LK2A 4E1TA 3PORA 2J1NA 2R89A 4C00A 2MNHA 2KZ7B 3POQA 1ZHXA 2O4VA 3AAEA 5FVNA 4AKMA 1ZHYA 2R4NA 3NSGA 4PUXA 3HOEA 4O4XA 3PF1A 3A2SX 5JDPA 5H2FO 5EE2A 2F1TA 2J4UP 4FZNA 3UPGA 2W81C 1T16A 3DWOX 3AA7A 1QJ8A 4KR4A 4GHBA 1MM4A 4K3CA 3DZMA 1GFOA 4RLCA 2YNKA 2IWVA 4D65A 4LSIA 3LK3B
chains in the Genus database with same CATH topology
8PRNA 2N2LA 3DA4A 5T5FA 3POXA 2GE4A 1IZNA 1ZHTA 5GV0A 4FESA 3VE1A 1YS5A 5DL8A 5G26A 1BH3A 3PQUA 1Q9FA 3T24A 5IYUA 2KXPB 1BT9A 2XE3A 4GCQA 2F1VA 4GCSA 4KR8A 4AZLA 3SZVA 4C69X 3VY9X 4LSEA 3FYXA 3HW9A 5DL6A 2XTQA 4BUMX 4O49A 2KC0A 2KZ7A 4JCHA 4AUIA 4B61A 1OPFA 4AKRB 2PRNA 4FUVA 1PHOA 4AYID 7PRNA 4AYNA 5AFUK 3AA0B 4RJXA 4N59A 3O0EA 3PQSA 2XE2A 2LFUA 3AAAB 1MM5A 3JTYA 5D5DA 3LK3A 4RL9A 1MPFA 1BXWA 3PRNA 4FSPA 3SY9A 2JMMA 4GF4A 3KVDD 2YPVA 3C5OA 3SY7A 1G90A 4KRAA 1ZHWA 2ODJA 2KXPA 2PORA 3SYSA 3VE2A 3K19A 3VZUX 2ZLDA 3LK41 4QQ1A 3VZTX 2K0LA 3HOLA 3HWBA 2KDYA 4O3YA 4FOZA 3AA1B 3RBHA 1GFMA 1ZHZA 3WI5A 4AFKA 4FMSA 1H6S1 4RJWA 3VY8X 2K4TA 4AKRA 5ADXL 1HXUA 2ZFGA 3EMNX 4G75A 4U9CA 4N58A 2X27X 3AA0A 3QRAA 3T20A 2FGQX 3SZDA 5PRNA 3POUA 4LSFA 3T0SA 3AAAA 4FSOA 2OMFA 4AYMC 4AYEC 4O3WA 3SYBA 3UU2A 1HXTA 3LK42 5DL7A 3WI4A 2Y7SA 4FZMA 3QRCA 2Y0HA 4E1SA 4RLBA 4AYDC 3AA6B 3LK2B 4FZLA 4FRXA 4D64A 2ERVA 3AAEB 1Q9GA 2XTRA 2XG6A 2XE5A 4D5UA 2FGRA 4FT6A 3TZGA 2MHLA 2W80C 4GCPA 1P4TA 4JFBA 4XNLA 4G76A 5AFUL 1GFPA 3AA7B 4Z3TA 3AA1A 1QJ9A 2QTKA 2XE1A 4O4UA 2Y0KA 6PRNA 2N2MA 2Y2XA 5ADXK 1THQA 4FRTA 1HXXA 1QJPA 1GFQA 4F4BA 3DA3A 4LSHA 4O3ZA 2LHFA 1IZNB 2M07A 3G7GA 1ORMA 2Y0LA 3V8UA 3VZWX 5DL5A 2XMXA 3GP6A 1E54A 4O3XB 1GFNA 1OSMA 3UAQA 2M06A 4E1TA 1PRNA 3AA6A 3LK2A 3PORA 2J1NA 2MNHA 2KZ7B 3POQA 1ZHXA 2O4VA 3AAEA 5FVNA 4AKMA 1ZHYA 3NSGA 4PUXA 3HOEA 4O4XA 3A2SX 5JDPA 2J4UP 5EE2A 2F1TA 4FZNA 3UPGA 2W81C 3AA7A 1QJ8A 4KR4A 4GHBA 1MM4A 1GFOA 4RLCA 2YNKA 4XNKA 4D65A 4LSIA 3LK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PRN A;  3POX A;  5DL8 A;  1BH3 A;  3T24 A;  2XE3 A;  1BT9 A;  4GCQ A;  4KR8 A;  4GCS A;  3SZV A;  4C69 X;  3VY9 X;  4LSE A;  3FYX A;  3HW9 A;  5DL6 A;  4BUM X;  4AUI A;  1OPF A;  2PRN A;  1PHO A;  7PRN A;  4RJX A;  3O0E A;  2XE2 A;  3JTY A;  1MPF A;  3PRN A;  4FSP A;  3SY9 A;  3SY7 A;  4KRA A;  2ODJ A;  2POR A;  3SYS A;  3K19 A;  3VZU X;  2ZLD A;  3VZT X;  3HWB A;  4FOZ A;  3WI5 A;  1GFM A;  4FMS A;  1H6S 1;  4RJW A;  3VY8 X;  2K4T A;  1HXU A;  2ZFG A;  3EMN X;  3T20 A;  2FGQ X;  3SZD A;  5PRN A;  3POU A;  4LSF A;  3T0S A;  4FSO A;  2OMF A;  3SYB A;  3UU2 A;  1HXT A;  5DL7 A;  3WI4 A;  2Y0H A;  4FRX A;  4D64 A;  2XG6 A;  2XE5 A;  4D5U A;  2FGR A;  4FT6 A;  4GCP A;  4JFB A;  1GFP A;  2QTK A;  2XE1 A;  2Y0K A;  6PRN A;  2Y2X A;  4FRT A;  1HXX A;  1GFQ A;  4LSH A;  2Y0L A;  3VZW X;  5DL5 A;  1E54 A;  1GFN A;  1OSM A;  1PRN A;  3POR A;  2J1N A;  3POQ A;  2O4V A;  5FVN A;  3NSG A;  3A2S X;  5JDP A;  2J4U P;  3UPG A;  4KR4 A;  1GFO A;  4D65 A;  4LSI A; 
#chains in the Genus database with same CATH topology
 5B66 O;  8PRN A;  4FQE A;  2N2L A;  3DA4 A;  5GTI O;  5T5F A;  3POX A;  2GE4 A;  1S5L O;  1IZN A;  4UB8 O;  1ZHT A;  5GV0 A;  4FES A;  3VE1 A;  1YS5 A;  5DL8 A;  5G26 A;  1BH3 A;  3KZI O;  3PQU A;  1Q9F A;  3T24 A;  5IYU A;  2KXP B;  1BT9 A;  2XE3 A;  4GCQ A;  2F1V A;  4GCS A;  4KR8 A;  3WU2 O;  3PGR A;  3SZV A;  3VY9 X;  4LSE A;  3FYX A;  3HW9 A;  5DL6 A;  4AZL A;  4C69 X;  2XTQ A;  3BS0 A;  4C4V A;  4BUM X;  4UB6 O;  4O49 A;  2KC0 A;  2KZ7 A;  4JCH A;  2X9K A;  4AUI A;  2IWW A;  3PGU A;  4B61 A;  1OPF A;  2WJR A;  4AKR B;  2PRN A;  4FUV A;  1PHO A;  4AYI D;  7PRN A;  4AYN A;  4PR7 A;  3AA0 B;  4RJX A;  5AFU K;  4N59 A;  3O0E A;  3PQS A;  3BRZ A;  2LFU A;  2XE2 A;  3AAA B;  1MM5 A;  3JTY A;  5D5D A;  3LK3 A;  3A0B O;  4RL9 A;  1MPF A;  2R88 A;  1BXW A;  2WJQ A;  3PRN A;  3JCU O;  3DWN A;  4FSP A;  4PJ0 O;  3SY9 A;  2JMM A;  4GF4 A;  3KVD D;  2YPV A;  3C5O A;  3SY7 A;  1G90 A;  4KRA A;  1ZHW A;  2ODJ A;  2KXP A;  5KAF O;  2POR A;  3SYS A;  3VE2 A;  3K19 A;  3VZU X;  2ZLD A;  5B5E O;  3LK4 1;  4QQ1 A;  3VZT X;  2K0L A;  4CTD A;  3HOL A;  3HWB A;  5TIS O;  2KDY A;  4O3Y A;  4FOZ A;  3AA1 B;  3RBH A;  1GFM A;  1ZHZ A;  3WI5 A;  4AFK A;  3BRY A;  3NJT A;  4FMS A;  1H6S 1;  4RJW A;  3VY8 X;  2K4T A;  4AKR A;  5ADX L;  1HXU A;  4IL6 O;  2ZFG A;  3EMN X;  1T1L A;  4G75 A;  4U9C A;  4N58 A;  2X27 X;  3AA0 A;  3QRA A;  3T20 A;  2JQY A;  2FGQ X;  5E79 O;  5PRN A;  3SZD A;  3POU A;  4LSF A;  3T0S A;  3A0H O;  3AAA A;  4FSO A;  2OMF A;  5GTH O;  4AYM C;  5G39 A;  4AYE C;  4O3W A;  3SYB A;  3UU2 A;  2R4L A;  1HXT A;  2F1C X;  3LK4 2;  4K3B A;  5DL7 A;  3WI4 A;  2Y7S A;  4FZM A;  5KAI O;  3QRC A;  2Y0H A;  4E1S A;  4RLB A;  4AYD C;  3AA6 B;  3LK2 B;  3PGS A;  4FZL A;  4FRX A;  4D64 A;  2ERV A;  3AAE B;  1Q9G A;  2XTR A;  2XG6 A;  2XE5 A;  4D5U A;  2FGR A;  4FT6 A;  3TZG A;  2MHL A;  2W80 C;  4GCP A;  5G38 A;  1P4T A;  4JFB A;  4XNL A;  2R4O A;  4G76 A;  5AFU L;  1GFP A;  3AA7 B;  4Z3T A;  3AA1 A;  1QJ9 A;  2QTK A;  2XE1 A;  4O4U A;  2Y0K A;  6PRN A;  2N2M A;  2Y2X A;  5ADX K;  1THQ A;  2WVP A;  4FRT A;  1HXX A;  1QJP A;  1GFQ A;  4F4B A;  2R8A A;  3DA3 A;  4LSH A;  4O3Z A;  2LHF A;  1IZN B;  2M07 A;  3G7G A;  4N74 A;  5G3A A;  1ORM A;  2Y0L A;  3V8U A;  3VZW X;  5DL5 A;  2XMX A;  3GP6 A;  1E54 A;  4O3X B;  4XNK A;  1GFN A;  1OSM A;  2AXT O;  3UAQ A;  2M06 A;  2R4P A;  4N75 A;  1PRN A;  4C4V B;  3AA6 A;  3LK2 A;  4E1T A;  3POR A;  2J1N A;  2R89 A;  4C00 A;  2MNH A;  2KZ7 B;  3POQ A;  1ZHX A;  2O4V A;  3AAE A;  5FVN A;  4AKM A;  1ZHY A;  2R4N A;  3NSG A;  4PUX A;  3HOE A;  4O4X A;  3PF1 A;  3A2S X;  5JDP A;  5H2F O;  5EE2 A;  2F1T A;  2J4U P;  4FZN A;  3UPG A;  2W81 C;  1T16 A;  3DWO X;  3AA7 A;  1QJ8 A;  4KR4 A;  4GHB A;  1MM4 A;  4K3C A;  3DZM A;  1GFO A;  4RLC A;  2YNK A;  2IWV A;  4D65 A;  4LSI A;  3LK3 B; 
#chains in the Genus database with same CATH homology
 8PRN A;  2N2L A;  3DA4 A;  5T5F A;  3POX A;  2GE4 A;  1IZN A;  1ZHT A;  5GV0 A;  4FES A;  3VE1 A;  1YS5 A;  5DL8 A;  5G26 A;  1BH3 A;  3PQU A;  1Q9F A;  3T24 A;  5IYU A;  2KXP B;  1BT9 A;  2XE3 A;  4GCQ A;  2F1V A;  4GCS A;  4KR8 A;  4AZL A;  3SZV A;  4C69 X;  3VY9 X;  4LSE A;  3FYX A;  3HW9 A;  5DL6 A;  2XTQ A;  4BUM X;  4O49 A;  2KC0 A;  2KZ7 A;  4JCH A;  4AUI A;  4B61 A;  1OPF A;  4AKR B;  2PRN A;  4FUV A;  1PHO A;  4AYI D;  7PRN A;  4AYN A;  5AFU K;  3AA0 B;  4RJX A;  4N59 A;  3O0E A;  3PQS A;  2XE2 A;  2LFU A;  3AAA B;  1MM5 A;  3JTY A;  5D5D A;  3LK3 A;  4RL9 A;  1MPF A;  1BXW A;  3PRN A;  4FSP A;  3SY9 A;  2JMM A;  4GF4 A;  3KVD D;  2YPV A;  3C5O A;  3SY7 A;  1G90 A;  4KRA A;  1ZHW A;  2ODJ A;  2KXP A;  2POR A;  3SYS A;  3VE2 A;  3K19 A;  3VZU X;  2ZLD A;  3LK4 1;  4QQ1 A;  3VZT X;  2K0L A;  3HOL A;  3HWB A;  2KDY A;  4O3Y A;  4FOZ A;  3AA1 B;  3RBH A;  1GFM A;  1ZHZ A;  3WI5 A;  4AFK A;  4FMS A;  1H6S 1;  4RJW A;  3VY8 X;  2K4T A;  4AKR A;  5ADX L;  1HXU A;  2ZFG A;  3EMN X;  4G75 A;  4U9C A;  4N58 A;  2X27 X;  3AA0 A;  3QRA A;  3T20 A;  2FGQ X;  3SZD A;  5PRN A;  3POU A;  4LSF A;  3T0S A;  3AAA A;  4FSO A;  2OMF A;  4AYM C;  4AYE C;  4O3W A;  3SYB A;  3UU2 A;  1HXT A;  3LK4 2;  5DL7 A;  3WI4 A;  2Y7S A;  4FZM A;  3QRC A;  2Y0H A;  4E1S A;  4RLB A;  4AYD C;  3AA6 B;  3LK2 B;  4FZL A;  4FRX A;  4D64 A;  2ERV A;  3AAE B;  1Q9G A;  2XTR A;  2XG6 A;  2XE5 A;  4D5U A;  2FGR A;  4FT6 A;  3TZG A;  2MHL A;  2W80 C;  4GCP A;  1P4T A;  4JFB A;  4XNL A;  4G76 A;  5AFU L;  1GFP A;  3AA7 B;  4Z3T A;  3AA1 A;  1QJ9 A;  2QTK A;  2XE1 A;  4O4U A;  2Y0K A;  6PRN A;  2N2M A;  2Y2X A;  5ADX K;  1THQ A;  4FRT A;  1HXX A;  1QJP A;  1GFQ A;  4F4B A;  3DA3 A;  4LSH A;  4O3Z A;  2LHF A;  1IZN B;  2M07 A;  3G7G A;  1ORM A;  2Y0L A;  3V8U A;  3VZW X;  5DL5 A;  2XMX A;  3GP6 A;  1E54 A;  4O3X B;  1GFN A;  1OSM A;  3UAQ A;  2M06 A;  4E1T A;  1PRN A;  3AA6 A;  3LK2 A;  3POR A;  2J1N A;  2MNH A;  2KZ7 B;  3POQ A;  1ZHX A;  2O4V A;  3AAE A;  5FVN A;  4AKM A;  1ZHY A;  3NSG A;  4PUX A;  3HOE A;  4O4X A;  3A2S X;  5JDP A;  2J4U P;  5EE2 A;  2F1T A;  4FZN A;  3UPG A;  2W81 C;  3AA7 A;  1QJ8 A;  4KR4 A;  4GHB A;  1MM4 A;  1GFO A;  4RLC A;  2YNK A;  4XNK A;  4D65 A;  4LSI A;  3LK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...