1H6S1

Asymmetric conductivity of engineered proteins
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
307
structure length
289
Chain Sequence
EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asymmetric Conductivity of Engineered Porins
pubmed doi rcsb
source organism Rhodopseudomonas blastica
molecule tags Membrane protein
molecule keywords PORIN
total genus 73
structure length 289
sequence length 307
ec nomenclature
pdb deposition date 2001-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1h6s100
3UU2A 4LSIA 2PRNA 4AUIA 2ZFGA 3O0EA 8PRNA 1HXTA 2XG6A 3T24A 1HXXA 3SY9A 1E54A 4C69X 2FGRA 5DL5A 4GCSA 3UPGA 1GFNA 3SY7A 4BUMX 3SYBA 1PRNA 2XE2A 3POXA 4FT6A 2Y2XA 1OSMA 1BT9A 2J4UP 4FSPA 4KRAA 5JDPA 3POQA 1BH3A 3A2SX 4FRTA 2OMFA 3T20A 4LSFA 3VZWX 2O4VA 4D5UA 4KR4A 4FOZA 3WI4A 3T0SA 3VZTX 3SZDA 3K19A 5DL8A 2XE5A 2QTKA 4LSEA 3VZUX 1MPFA 3JTYA 5DL6A 1PHOA 1OPFA 4RJXA 4FSOA 4RJWA 3PRNA 3EMNX 7PRNA 3PORA 5FVNA 5PRNA 6PRNA 3SYSA 3HW9A 4LSHA 1GFMA 2Y0LA 5DL7A 2XE1A 3HWBA 4D64A 2ODJA 2K4TA 3POUA 2ZLDA 3WI5A 2Y0KA 4JFBA 1GFQA 2PORA 1HXUA 3SZVA 4KR8A 2J1NA 3VY9X 1GFOA 4FRXA 4FMSA 2XE3A 2FGQX 1H6S1 4GCQA 4D65A 1GFPA 2Y0HA 3VY8X 4GCPA 3FYXA 3NSGA
chains in the Genus database with same CATH superfamily
2R88A 3UU2A 3AAEB 4RL9A 3VE2A 4F4BA 4LSIA 4JCHA 4UB8O 2PRNA 3WU2O 4AUIA 2R89A 2ZFGA 3O0EA 3TZGA 5AFUL 3RBHA 1HXTA 8PRNA 2R4OA 2XG6A 3T24A 3KZIO 3HOLA 1THQA 3BRYA 1HXXA 5GTIO 3SY9A 5IYUA 1E54A 2AXTO 3NJTA 4XNLA 4GHBA 4C69X 2FGRA 3QRAA 4QQ1A 2MNHA 5DL5A 2Y7SA 3DZMA 2KXPB 4B61A 2N2MA 4RLBA 4CTDA 5GTHO 4PR7A 3BS0A 4GCSA 4O4XA 3A0HO 3UPGA 1ZHWA 1GFNA 3KVDD 2R4NA 4O3WA 3SY7A 4BUMX 4XNKA 4O49A 2M06A 3SYBA 4G75A 1PRNA 4UB6O 2XE2A 3POXA 4FT6A 4AYEC 4G76A 2Y2XA 5E79O 4FESA 1YS5A 1OSMA 4FZNA 5G38A 2IWWA 1BT9A 3AA7B 2J4UP 3DA4A 1G90A 2LHFA 3G7GA 4FZMA 3V8UA 1ORMA 4FSPA 5G39A 4KRAA 5JDPA 2ERVA 3POQA 1BH3A 3A2SX 4FRTA 2OMFA 4O3YA 2M07A 2WJRA 3PGRA 3T20A 3BRZA 4IL6O 1QJ8A 4LSFA 4RLCA 4E1TA 4AKRB 2K0LA 3AAAA 4AKMA 3LK3A 3VZWX 2O4VA 4O4UA 3AAEA 4N58A 4KR4A 4D5UA 5G26A 1ZHYA 3JCUO 2KC0A 1MM5A 4FOZA 2WVPA 5G3AA 3WI4A 3T0SA 3VZTX 4PUXA 4C4VB 3LK2A 3PQSA 2KZ7B 2XMXA 3SZDA 3K19A 5B66O 3LK2B 5DL8A 1S5LO 4K3CA 3PGUA 2XE5A 3C5OA 3UAQA 2X9KA 1Q9FA 2QTKA 4AZLA 4LSEA 3VZUX 1MPFA 5KAIO 3QRCA 3JTYA 5DL6A 5ADXL 1PHOA 4GF4A 2R8AA 4K3BA 1OPFA 3AA0A 4RJXA 4FSOA 4RJWA 1ZHTA 3LK42 3PRNA 1MM4A 4O3XB 5B5EO 3EMNX 7PRNA 1BXWA 3AA6B 3PORA 4U9CA 5FVNA 5PRNA 6PRNA 2JQYA 2R4LA 3GP6A 5H2FO 4FUVA 3SYSA 3HW9A 4C00A 4LSHA 1GFMA 2F1TA 2JMMA 3DWOX 2GE4A 3HOEA 2IWVA 3DWNA 2Y0LA 4O3ZA 5DL7A 2XE1A 3HWBA 4D64A 2LFUA 1QJPA 3AA1B 3LK41 4AYID 2KXPA 1P4TA 2ODJA 2W80C 1T1LA 2K4TA 5EE2A 3PQUA 3POUA 2ZLDA 2R4PA 2X27X 2YPVA 3AA0B 4FQEA 3A0BO 1ZHXA 2N2LA 3PF1A 5ADXK 3WI5A 2XTQA 2Y0KA 1QJ9A 4JFBA 1GFQA 2PORA 1HXUA 1IZNB 3AA6A 3SZVA 4AFKA 4FZLA 2J1NA 1IZNA 4KR8A 4N75A 3VE1A 3AA7A 3AAAB 5KAFO 3LK3B 2MHLA 1ZHZA 2WJQA 2YNKA 3VY9X 4C4VA 2KZ7A 1GFOA 2F1VA 3DA3A 3PGSA 4N74A 4AYMC 4FRXA 4FMSA 4AYDC 5D5DA 4AYNA 2XE3A 1H6S1 2FGQX 3AA1A 2KDYA 4GCQA 5TISO 4AKRA 4PJ0O 4D65A 1GFPA 4Z3TA 2XTRA 2Y0HA 1Q9GA 2W81C 4E1SA 5T5FA 1T16A 3VY8X 5GV0A 4N59A 4GCPA 5AFUK 2F1CX 3FYXA 3NSGA
chains in the Genus database with same CATH topology
3UU2A 3AAEB 4RL9A 3VE2A 4F4BA 4LSIA 4JCHA 2PRNA 4AUIA 5AFUL 2ZFGA 3O0EA 3TZGA 3RBHA 1HXTA 8PRNA 2XG6A 3T24A 3HOLA 1THQA 1HXXA 5IYUA 3SY9A 1E54A 4C69X 4XNLA 4GHBA 2FGRA 3QRAA 4QQ1A 2MNHA 5DL5A 2Y7SA 2KXPB 4B61A 2N2MA 4RLBA 4GCSA 4O4XA 3UPGA 1ZHWA 1GFNA 3KVDD 4O3WA 3SY7A 4BUMX 4XNKA 4O49A 2M06A 3SYBA 4G75A 1PRNA 2XE2A 3POXA 4FT6A 4AYEC 4G76A 2Y2XA 4FESA 1YS5A 1OSMA 4FZNA 1BT9A 3AA7B 2J4UP 3DA4A 1G90A 2LHFA 3G7GA 4FZMA 3V8UA 1ORMA 4FSPA 4KRAA 5JDPA 2ERVA 3POQA 1BH3A 3A2SX 4FRTA 2OMFA 4O3YA 2M07A 3T20A 1QJ8A 4LSFA 4RLCA 4E1TA 4AKRB 2K0LA 3AAAA 4AKMA 3LK3A 3VZWX 2O4VA 4O4UA 3AAEA 4N58A 4KR4A 4D5UA 5G26A 1ZHYA 2KC0A 1MM5A 4FOZA 3WI4A 3T0SA 3VZTX 4PUXA 3LK2A 3PQSA 2KZ7B 2XMXA 3SZDA 3K19A 3LK2B 5DL8A 2XE5A 3C5OA 3UAQA 1Q9FA 2QTKA 4AZLA 4LSEA 3VZUX 1MPFA 3QRCA 3JTYA 5DL6A 5ADXL 1PHOA 4GF4A 1OPFA 3AA0A 4RJXA 4FSOA 4RJWA 1ZHTA 3LK42 3PRNA 1MM4A 4O3XB 3EMNX 7PRNA 1BXWA 3AA6B 3PORA 4U9CA 5FVNA 5PRNA 6PRNA 3GP6A 4FUVA 3SYSA 3HW9A 4LSHA 1GFMA 2F1TA 2JMMA 3HOEA 2GE4A 4O3ZA 2Y0LA 5DL7A 2XE1A 3HWBA 4D64A 2LFUA 1QJPA 3AA1B 3LK41 4AYID 2KXPA 1P4TA 2ODJA 2W80C 2K4TA 5EE2A 3PQUA 3POUA 2ZLDA 2X27X 2YPVA 3AA0B 1ZHXA 2N2LA 5ADXK 3WI5A 2XTQA 2Y0KA 1QJ9A 4JFBA 1GFQA 2PORA 1HXUA 1IZNB 3AA6A 3SZVA 4AFKA 4FZLA 2J1NA 1IZNA 4KR8A 4AKRA 3VE1A 3AA7A 3AAAB 3VY9X 3LK3B 2MHLA 1ZHZA 2YNKA 2KZ7A 1GFOA 2F1VA 3DA3A 4AYMC 4FRXA 4FMSA 4AYDC 5D5DA 4AYNA 2XE3A 1H6S1 2FGQX 3AA1A 2KDYA 4GCQA 4D65A 1GFPA 4Z3TA 2XTRA 2Y0HA 1Q9GA 2W81C 4E1SA 5T5FA 3VY8X 5GV0A 4N59A 4GCPA 5AFUK 3FYXA 3NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU2 A;  4LSI A;  2PRN A;  4AUI A;  2ZFG A;  3O0E A;  8PRN A;  1HXT A;  2XG6 A;  3T24 A;  1HXX A;  3SY9 A;  1E54 A;  4C69 X;  2FGR A;  5DL5 A;  4GCS A;  3UPG A;  1GFN A;  3SY7 A;  4BUM X;  3SYB A;  1PRN A;  2XE2 A;  3POX A;  4FT6 A;  2Y2X A;  1OSM A;  1BT9 A;  2J4U P;  4FSP A;  4KRA A;  5JDP A;  3POQ A;  1BH3 A;  3A2S X;  4FRT A;  2OMF A;  3T20 A;  4LSF A;  3VZW X;  2O4V A;  4D5U A;  4KR4 A;  4FOZ A;  3WI4 A;  3T0S A;  3VZT X;  3SZD A;  3K19 A;  5DL8 A;  2XE5 A;  2QTK A;  4LSE A;  3VZU X;  1MPF A;  3JTY A;  5DL6 A;  1PHO A;  1OPF A;  4RJX A;  4FSO A;  4RJW A;  3PRN A;  3EMN X;  7PRN A;  3POR A;  5FVN A;  5PRN A;  6PRN A;  3SYS A;  3HW9 A;  4LSH A;  1GFM A;  2Y0L A;  5DL7 A;  2XE1 A;  3HWB A;  4D64 A;  2ODJ A;  2K4T A;  3POU A;  2ZLD A;  3WI5 A;  2Y0K A;  4JFB A;  1GFQ A;  2POR A;  1HXU A;  3SZV A;  4KR8 A;  2J1N A;  3VY9 X;  1GFO A;  4FRX A;  4FMS A;  2XE3 A;  2FGQ X;  1H6S 1;  4GCQ A;  4D65 A;  1GFP A;  2Y0H A;  3VY8 X;  4GCP A;  3FYX A;  3NSG A; 
#chains in the Genus database with same CATH topology
 2R88 A;  3UU2 A;  3AAE B;  4RL9 A;  3VE2 A;  4F4B A;  4LSI A;  4JCH A;  4UB8 O;  2PRN A;  3WU2 O;  4AUI A;  2R89 A;  2ZFG A;  3O0E A;  3TZG A;  5AFU L;  3RBH A;  1HXT A;  8PRN A;  2R4O A;  2XG6 A;  3T24 A;  3KZI O;  3HOL A;  1THQ A;  3BRY A;  1HXX A;  5GTI O;  3SY9 A;  5IYU A;  1E54 A;  2AXT O;  3NJT A;  4XNL A;  4GHB A;  4C69 X;  2FGR A;  3QRA A;  4QQ1 A;  2MNH A;  5DL5 A;  2Y7S A;  3DZM A;  2KXP B;  4B61 A;  2N2M A;  4RLB A;  4CTD A;  5GTH O;  4PR7 A;  3BS0 A;  4GCS A;  4O4X A;  3A0H O;  3UPG A;  1ZHW A;  1GFN A;  3KVD D;  2R4N A;  4O3W A;  3SY7 A;  4BUM X;  4XNK A;  4O49 A;  2M06 A;  3SYB A;  4G75 A;  1PRN A;  4UB6 O;  2XE2 A;  3POX A;  4FT6 A;  4AYE C;  4G76 A;  2Y2X A;  5E79 O;  4FES A;  1YS5 A;  1OSM A;  4FZN A;  5G38 A;  2IWW A;  1BT9 A;  3AA7 B;  2J4U P;  3DA4 A;  1G90 A;  2LHF A;  3G7G A;  4FZM A;  3V8U A;  1ORM A;  4FSP A;  5G39 A;  4KRA A;  5JDP A;  2ERV A;  3POQ A;  1BH3 A;  3A2S X;  4FRT A;  2OMF A;  4O3Y A;  2M07 A;  2WJR A;  3PGR A;  3T20 A;  3BRZ A;  4IL6 O;  1QJ8 A;  4LSF A;  4RLC A;  4E1T A;  4AKR B;  2K0L A;  3AAA A;  4AKM A;  3LK3 A;  3VZW X;  2O4V A;  4O4U A;  3AAE A;  4N58 A;  4KR4 A;  4D5U A;  5G26 A;  1ZHY A;  3JCU O;  2KC0 A;  1MM5 A;  4FOZ A;  2WVP A;  5G3A A;  3WI4 A;  3T0S A;  3VZT X;  4PUX A;  4C4V B;  3LK2 A;  3PQS A;  2KZ7 B;  2XMX A;  3SZD A;  3K19 A;  5B66 O;  3LK2 B;  5DL8 A;  1S5L O;  4K3C A;  3PGU A;  2XE5 A;  3C5O A;  3UAQ A;  2X9K A;  1Q9F A;  2QTK A;  4AZL A;  4LSE A;  3VZU X;  1MPF A;  5KAI O;  3QRC A;  3JTY A;  5DL6 A;  5ADX L;  1PHO A;  4GF4 A;  2R8A A;  4K3B A;  1OPF A;  3AA0 A;  4RJX A;  4FSO A;  4RJW A;  1ZHT A;  3LK4 2;  3PRN A;  1MM4 A;  4O3X B;  5B5E O;  3EMN X;  7PRN A;  1BXW A;  3AA6 B;  3POR A;  4U9C A;  5FVN A;  5PRN A;  6PRN A;  2JQY A;  2R4L A;  3GP6 A;  5H2F O;  4FUV A;  3SYS A;  3HW9 A;  4C00 A;  4LSH A;  1GFM A;  2F1T A;  2JMM A;  3DWO X;  2GE4 A;  3HOE A;  2IWV A;  3DWN A;  2Y0L A;  4O3Z A;  5DL7 A;  2XE1 A;  3HWB A;  4D64 A;  2LFU A;  1QJP A;  3AA1 B;  3LK4 1;  4AYI D;  2KXP A;  1P4T A;  2ODJ A;  2W80 C;  1T1L A;  2K4T A;  5EE2 A;  3PQU A;  3POU A;  2ZLD A;  2R4P A;  2X27 X;  2YPV A;  3AA0 B;  4FQE A;  3A0B O;  1ZHX A;  2N2L A;  3PF1 A;  5ADX K;  3WI5 A;  2XTQ A;  2Y0K A;  1QJ9 A;  4JFB A;  1GFQ A;  2POR A;  1HXU A;  1IZN B;  3AA6 A;  3SZV A;  4AFK A;  4FZL A;  2J1N A;  1IZN A;  4KR8 A;  4N75 A;  3VE1 A;  3AA7 A;  3AAA B;  5KAF O;  3LK3 B;  2MHL A;  1ZHZ A;  2WJQ A;  2YNK A;  3VY9 X;  4C4V A;  2KZ7 A;  1GFO A;  2F1V A;  3DA3 A;  3PGS A;  4N74 A;  4AYM C;  4FRX A;  4FMS A;  4AYD C;  5D5D A;  4AYN A;  2XE3 A;  1H6S 1;  2FGQ X;  3AA1 A;  2KDY A;  4GCQ A;  5TIS O;  4AKR A;  4PJ0 O;  4D65 A;  1GFP A;  4Z3T A;  2XTR A;  2Y0H A;  1Q9G A;  2W81 C;  4E1S A;  5T5F A;  1T16 A;  3VY8 X;  5GV0 A;  4N59 A;  4GCP A;  5AFU K;  2F1C X;  3FYX A;  3NSG A; 
#chains in the Genus database with same CATH homology
 3UU2 A;  3AAE B;  4RL9 A;  3VE2 A;  4F4B A;  4LSI A;  4JCH A;  2PRN A;  4AUI A;  5AFU L;  2ZFG A;  3O0E A;  3TZG A;  3RBH A;  1HXT A;  8PRN A;  2XG6 A;  3T24 A;  3HOL A;  1THQ A;  1HXX A;  5IYU A;  3SY9 A;  1E54 A;  4C69 X;  4XNL A;  4GHB A;  2FGR A;  3QRA A;  4QQ1 A;  2MNH A;  5DL5 A;  2Y7S A;  2KXP B;  4B61 A;  2N2M A;  4RLB A;  4GCS A;  4O4X A;  3UPG A;  1ZHW A;  1GFN A;  3KVD D;  4O3W A;  3SY7 A;  4BUM X;  4XNK A;  4O49 A;  2M06 A;  3SYB A;  4G75 A;  1PRN A;  2XE2 A;  3POX A;  4FT6 A;  4AYE C;  4G76 A;  2Y2X A;  4FES A;  1YS5 A;  1OSM A;  4FZN A;  1BT9 A;  3AA7 B;  2J4U P;  3DA4 A;  1G90 A;  2LHF A;  3G7G A;  4FZM A;  3V8U A;  1ORM A;  4FSP A;  4KRA A;  5JDP A;  2ERV A;  3POQ A;  1BH3 A;  3A2S X;  4FRT A;  2OMF A;  4O3Y A;  2M07 A;  3T20 A;  1QJ8 A;  4LSF A;  4RLC A;  4E1T A;  4AKR B;  2K0L A;  3AAA A;  4AKM A;  3LK3 A;  3VZW X;  2O4V A;  4O4U A;  3AAE A;  4N58 A;  4KR4 A;  4D5U A;  5G26 A;  1ZHY A;  2KC0 A;  1MM5 A;  4FOZ A;  3WI4 A;  3T0S A;  3VZT X;  4PUX A;  3LK2 A;  3PQS A;  2KZ7 B;  2XMX A;  3SZD A;  3K19 A;  3LK2 B;  5DL8 A;  2XE5 A;  3C5O A;  3UAQ A;  1Q9F A;  2QTK A;  4AZL A;  4LSE A;  3VZU X;  1MPF A;  3QRC A;  3JTY A;  5DL6 A;  5ADX L;  1PHO A;  4GF4 A;  1OPF A;  3AA0 A;  4RJX A;  4FSO A;  4RJW A;  1ZHT A;  3LK4 2;  3PRN A;  1MM4 A;  4O3X B;  3EMN X;  7PRN A;  1BXW A;  3AA6 B;  3POR A;  4U9C A;  5FVN A;  5PRN A;  6PRN A;  3GP6 A;  4FUV A;  3SYS A;  3HW9 A;  4LSH A;  1GFM A;  2F1T A;  2JMM A;  3HOE A;  2GE4 A;  4O3Z A;  2Y0L A;  5DL7 A;  2XE1 A;  3HWB A;  4D64 A;  2LFU A;  1QJP A;  3AA1 B;  3LK4 1;  4AYI D;  2KXP A;  1P4T A;  2ODJ A;  2W80 C;  2K4T A;  5EE2 A;  3PQU A;  3POU A;  2ZLD A;  2X27 X;  2YPV A;  3AA0 B;  1ZHX A;  2N2L A;  5ADX K;  3WI5 A;  2XTQ A;  2Y0K A;  1QJ9 A;  4JFB A;  1GFQ A;  2POR A;  1HXU A;  1IZN B;  3AA6 A;  3SZV A;  4AFK A;  4FZL A;  2J1N A;  1IZN A;  4KR8 A;  4AKR A;  3VE1 A;  3AA7 A;  3AAA B;  3VY9 X;  3LK3 B;  2MHL A;  1ZHZ A;  2YNK A;  2KZ7 A;  1GFO A;  2F1V A;  3DA3 A;  4AYM C;  4FRX A;  4FMS A;  4AYD C;  5D5D A;  4AYN A;  2XE3 A;  1H6S 1;  2FGQ X;  3AA1 A;  2KDY A;  4GCQ A;  4D65 A;  1GFP A;  4Z3T A;  2XTR A;  2Y0H A;  1Q9G A;  2W81 C;  4E1S A;  5T5F A;  3VY8 X;  5GV0 A;  4N59 A;  4GCP A;  5AFU K;  3FYX A;  3NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...