3G7GA

Crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
149
Chain Sequence
EMNYEEVFSITITVDKPILIGQDDIVGRRQLIPIISGKVSGNNFNGKVLPGGIDSQIVRPDGKCELSARYAIRLDDGAAIYIENNGIRTVPDEYIEAVKSGEFVDPNAYYFRTIPTFETYSPKYKWMMNHIFVCCASRENVLLKFYKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0311 protein CA_C3321
publication title The crystal structure of the protein with unknown function from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Structural genomics, unknown function
total genus 35
structure length 149
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3g7gA00
2MNHA 1Q9FA 2GE4A 2N2LA 1Q9GA 1MM4A 2LHFA 1G90A 3G7GA 1P4TA 2ERVA 3C5OA 1QJPA 2N2MA 1BXWA 2MHLA 3GP6A 2X27X 4RLCA 2F1TA 1ORMA 1QJ9A 3QRAA 1THQA 1MM5A 4PUXA 1QJ8A 2F1VA 2JMMA 3QRCA 2M06A 2M07A 2K0LA
chains in the Genus database with same CATH superfamily
3HOLA 4FESA 4G75A 3POXA 2WJRA 4XNKA 3LK42 1ZHWA 4N59A 1HXUA 1Q9GA 4KR8A 2XMXA 3A2SX 4LSHA 3LK3A 4D65A 4AYDC 2O4VA 3VY8X 5G3AA 2KC0A 4GCQA 1H6S1 3AAEA 4KR4A 4N75A 4AUIA 3PGRA 4FSPA 3SY7A 4FZLA 2PRNA 5G39A 4O3WA 5KAFO 5ADXK 4AYEC 4Z3TA 4C4VB 3VZWX 7PRNA 2X27X 3DWOX 3HW9A 4FZNA 4KRAA 4RLCA 3SYBA 5G38A 4LSEA 2R4NA 1QJ9A 4FQEA 4LSFA 4O4UA 4RL9A 4AFKA 4B61A 5AFUK 3BRZA 1QJ8A 1E54A 2F1VA 2LFUA 4RJXA 4RLBA 2OMFA 6PRNA 2XE2A 4FMSA 2XTQA 5G26A 1PRNA 2WVPA 2K0LA 1HXXA 2JQYA 2KZ7A 2ODJA 3EMNX 4GCPA 2R8AA 5DL6A 2Y7SA 3UAQA 5B66O 5GV0A 3KVDD 4JCHA 3WI4A 4AYMC 4RJWA 3A0HO 5B5EO 1GFPA 3AA6A 4FSOA 3DWNA 2F1CX 3AAEB 1ZHZA 1OPFA 4U9CA 5EE2A 4BUMX 3T24A 2LHFA 2ZLDA 3PORA 1G90A 1P4TA 2AXTO 3FYXA 3AAAA 3HOEA 4FT6A 4D64A 2ERVA 3C5OA 3VE1A 5FVNA 3K19A 2N2MA 3PGSA 4N74A 4D5UA 3PQUA 3SY9A 5GTIO 4AKRA 2W80C 3AA1A 3JTYA 4CTDA 1ORMA 3LK41 3QRAA 4PR7A 3NSGA 4PUXA 5PRNA 2KZ7B 4UB6O 4FRXA 2JMMA 2R88A 4XNLA 2M07A 3PF1A 2J1NA 4FOZA 2QTKA 3AA6B 4C00A 3NJTA 5JDPA 3LK2A 1HXTA 3JCUO 1GFQA 2MNHA 2WJQA 2R4OA 3UPGA 3LK3B 4JFBA 2GE4A 5TISO 3TZGA 1MM4A 3UU2A 4E1TA 2Y0HA 2KXPA 3VY9X 3VE2A 2Y0LA 1PHOA 3BS0A 4AKRB 2K4TA 2R89A 3PRNA 4PJ0O 3DZMA 1QJPA 2XG6A 2Y0KA 3DA4A 1BXWA 2KDYA 3GP6A 3HWBA 4C69X 1BT9A 1T16A 2Y2XA 2IWVA 5ADXL 3POQA 1ZHTA 2FGQX 2W81C 4N58A 1GFOA 1MM5A 2R4PA 3AA0A 4FZMA 5KAIO 8PRNA 3V8UA 5AFUL 4O49A 1BH3A 3LK2B 5DL5A 5T5FA 4FUVA 2XE3A 1IZNA 4K3BA 4AKMA 4AYID 4AZLA 5GTHO 2J4UP 2XE5A 3AA7A 4LSIA 3VZTX 3PQSA 3A0BO 4GCSA 4K3CA 3WU2O 2FGRA 5DL8A 5D5DA 1Q9FA 2KXPB 3RBHA 3WI5A 2N2LA 2ZFGA 3SZVA 3SZDA 4GHBA 4E1SA 4AYNA 3SYSA 5H2FO 5IYUA 4O3YA 3AAAB 3VZUX 2IWWA 3G7GA 1GFMA 2R4LA 3O0EA 4UB8O 4O3XB 2MHLA 1OSMA 3AA1B 4O3ZA 4QQ1A 5E79O 4F4BA 2XTRA 2XE1A 2PORA 3AA0B 2YPVA 2X9KA 2F1TA 3BRYA 4O4XA 4FRTA 1THQA 3KZIO 4C4VA 1S5LO 1IZNB 1GFNA 4IL6O 1ZHXA 3QRCA 3AA7B 2M06A 4G76A 3DA3A 1ZHYA 1T1LA 2YNKA 3T20A 4GF4A 1MPFA 5DL7A 1YS5A 3T0SA 3POUA 3PGUA
chains in the Genus database with same CATH topology
3HOLA 4FESA 4G75A 3POXA 4XNKA 3LK42 1ZHWA 4N59A 1HXUA 1Q9GA 4KR8A 2XMXA 3A2SX 4LSHA 3LK3A 4D65A 4AYDC 2O4VA 3VY8X 2KC0A 4GCQA 1H6S1 3AAEA 4KR4A 4AUIA 3SY7A 4FSPA 4FZLA 2PRNA 5ADXK 4O3WA 4AYEC 4Z3TA 3VZWX 7PRNA 2X27X 3HW9A 4FZNA 4KRAA 4RLCA 3SYBA 4LSEA 4AFKA 1QJ9A 4LSFA 4O4UA 4B61A 4RL9A 5AFUK 1QJ8A 1E54A 2F1VA 2LFUA 4RJXA 4RLBA 2OMFA 6PRNA 2XE2A 4FMSA 2XTQA 5G26A 1PRNA 2K0LA 1HXXA 2KZ7A 2ODJA 3EMNX 4GCPA 5DL6A 2Y7SA 3UAQA 5GV0A 3KVDD 4JCHA 3WI4A 4AYMC 4RJWA 1GFPA 3AA6A 4FSOA 3AAEB 1ZHZA 1OPFA 4U9CA 5EE2A 4BUMX 3T24A 2LHFA 2ZLDA 3PORA 1G90A 1P4TA 3FYXA 3AAAA 3HOEA 4FT6A 4D64A 2ERVA 3C5OA 3VE1A 5FVNA 3K19A 2N2MA 4D5UA 3PQUA 3SY9A 4AKRA 2W80C 3AA1A 3JTYA 1ORMA 3LK41 3QRAA 3NSGA 4PUXA 5PRNA 2KZ7B 4FRXA 2JMMA 4XNLA 2M07A 2J1NA 4FOZA 2QTKA 3AA6B 5JDPA 3LK2A 1HXTA 1GFQA 2MNHA 3UPGA 3LK3B 4JFBA 2GE4A 3TZGA 1MM4A 3UU2A 4E1TA 2Y0HA 2KXPA 3VY9X 3VE2A 2Y0LA 1PHOA 4AKRB 2K4TA 3PRNA 1QJPA 2XG6A 2Y0KA 3DA4A 1BXWA 2KDYA 3GP6A 3HWBA 4C69X 1BT9A 2Y2XA 5ADXL 3POQA 1ZHTA 2FGQX 2W81C 4N58A 1GFOA 1MM5A 4FZMA 3AA0A 8PRNA 3V8UA 5AFUL 4O49A 1BH3A 3LK2B 5DL5A 5T5FA 4FUVA 2XE3A 1IZNA 4AKMA 4AZLA 4AYID 2J4UP 2XE5A 3AA7A 4LSIA 3VZTX 3PQSA 4GCSA 2FGRA 5DL8A 5D5DA 1Q9FA 2KXPB 3RBHA 3WI5A 2N2LA 2ZFGA 3SZVA 3SZDA 4GHBA 4E1SA 4AYNA 3SYSA 5IYUA 4O3YA 3AAAB 3VZUX 3G7GA 1GFMA 3O0EA 4O3XB 2MHLA 1OSMA 3AA1B 4O3ZA 4QQ1A 4F4BA 2XTRA 2XE1A 2PORA 3AA0B 2YPVA 2F1TA 4O4XA 4FRTA 1THQA 1IZNB 1GFNA 1ZHXA 3QRCA 3AA7B 2M06A 4G76A 3DA3A 1ZHYA 2YNKA 3T20A 4GF4A 1MPFA 5DL7A 1YS5A 3T0SA 3POUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNH A;  1Q9F A;  2GE4 A;  2N2L A;  1Q9G A;  1MM4 A;  2LHF A;  1G90 A;  3G7G A;  1P4T A;  2ERV A;  3C5O A;  1QJP A;  2N2M A;  1BXW A;  2MHL A;  3GP6 A;  2X27 X;  4RLC A;  2F1T A;  1ORM A;  1QJ9 A;  3QRA A;  1THQ A;  1MM5 A;  4PUX A;  1QJ8 A;  2F1V A;  2JMM A;  3QRC A;  2M06 A;  2M07 A;  2K0L A; 
#chains in the Genus database with same CATH topology
 3HOL A;  4FES A;  4G75 A;  3POX A;  2WJR A;  4XNK A;  3LK4 2;  1ZHW A;  4N59 A;  1HXU A;  1Q9G A;  4KR8 A;  2XMX A;  3A2S X;  4LSH A;  3LK3 A;  4D65 A;  4AYD C;  2O4V A;  3VY8 X;  5G3A A;  2KC0 A;  4GCQ A;  1H6S 1;  3AAE A;  4KR4 A;  4N75 A;  4AUI A;  3PGR A;  4FSP A;  3SY7 A;  4FZL A;  2PRN A;  5G39 A;  4O3W A;  5KAF O;  5ADX K;  4AYE C;  4Z3T A;  4C4V B;  3VZW X;  7PRN A;  2X27 X;  3DWO X;  3HW9 A;  4FZN A;  4KRA A;  4RLC A;  3SYB A;  5G38 A;  4LSE A;  2R4N A;  1QJ9 A;  4FQE A;  4LSF A;  4O4U A;  4RL9 A;  4AFK A;  4B61 A;  5AFU K;  3BRZ A;  1QJ8 A;  1E54 A;  2F1V A;  2LFU A;  4RJX A;  4RLB A;  2OMF A;  6PRN A;  2XE2 A;  4FMS A;  2XTQ A;  5G26 A;  1PRN A;  2WVP A;  2K0L A;  1HXX A;  2JQY A;  2KZ7 A;  2ODJ A;  3EMN X;  4GCP A;  2R8A A;  5DL6 A;  2Y7S A;  3UAQ A;  5B66 O;  5GV0 A;  3KVD D;  4JCH A;  3WI4 A;  4AYM C;  4RJW A;  3A0H O;  5B5E O;  1GFP A;  3AA6 A;  4FSO A;  3DWN A;  2F1C X;  3AAE B;  1ZHZ A;  1OPF A;  4U9C A;  5EE2 A;  4BUM X;  3T24 A;  2LHF A;  2ZLD A;  3POR A;  1G90 A;  1P4T A;  2AXT O;  3FYX A;  3AAA A;  3HOE A;  4FT6 A;  4D64 A;  2ERV A;  3C5O A;  3VE1 A;  5FVN A;  3K19 A;  2N2M A;  3PGS A;  4N74 A;  4D5U A;  3PQU A;  3SY9 A;  5GTI O;  4AKR A;  2W80 C;  3AA1 A;  3JTY A;  4CTD A;  1ORM A;  3LK4 1;  3QRA A;  4PR7 A;  3NSG A;  4PUX A;  5PRN A;  2KZ7 B;  4UB6 O;  4FRX A;  2JMM A;  2R88 A;  4XNL A;  2M07 A;  3PF1 A;  2J1N A;  4FOZ A;  2QTK A;  3AA6 B;  4C00 A;  3NJT A;  5JDP A;  3LK2 A;  1HXT A;  3JCU O;  1GFQ A;  2MNH A;  2WJQ A;  2R4O A;  3UPG A;  3LK3 B;  4JFB A;  2GE4 A;  5TIS O;  3TZG A;  1MM4 A;  3UU2 A;  4E1T A;  2Y0H A;  2KXP A;  3VY9 X;  3VE2 A;  2Y0L A;  1PHO A;  3BS0 A;  4AKR B;  2K4T A;  2R89 A;  3PRN A;  4PJ0 O;  3DZM A;  1QJP A;  2XG6 A;  2Y0K A;  3DA4 A;  1BXW A;  2KDY A;  3GP6 A;  3HWB A;  4C69 X;  1BT9 A;  1T16 A;  2Y2X A;  2IWV A;  5ADX L;  3POQ A;  1ZHT A;  2FGQ X;  2W81 C;  4N58 A;  1GFO A;  1MM5 A;  2R4P A;  3AA0 A;  4FZM A;  5KAI O;  8PRN A;  3V8U A;  5AFU L;  4O49 A;  1BH3 A;  3LK2 B;  5DL5 A;  5T5F A;  4FUV A;  2XE3 A;  1IZN A;  4K3B A;  4AKM A;  4AYI D;  4AZL A;  5GTH O;  2J4U P;  2XE5 A;  3AA7 A;  4LSI A;  3VZT X;  3PQS A;  3A0B O;  4GCS A;  4K3C A;  3WU2 O;  2FGR A;  5DL8 A;  5D5D A;  1Q9F A;  2KXP B;  3RBH A;  3WI5 A;  2N2L A;  2ZFG A;  3SZV A;  3SZD A;  4GHB A;  4E1S A;  4AYN A;  3SYS A;  5H2F O;  5IYU A;  4O3Y A;  3AAA B;  3VZU X;  2IWW A;  3G7G A;  1GFM A;  2R4L A;  3O0E A;  4UB8 O;  4O3X B;  2MHL A;  1OSM A;  3AA1 B;  4O3Z A;  4QQ1 A;  5E79 O;  4F4B A;  2XTR A;  2XE1 A;  2POR A;  3AA0 B;  2YPV A;  2X9K A;  2F1T A;  3BRY A;  4O4X A;  4FRT A;  1THQ A;  3KZI O;  4C4V A;  1S5L O;  1IZN B;  1GFN A;  4IL6 O;  1ZHX A;  3QRC A;  3AA7 B;  2M06 A;  4G76 A;  3DA3 A;  1ZHY A;  1T1L A;  2YNK A;  3T20 A;  4GF4 A;  1MPF A;  5DL7 A;  1YS5 A;  3T0S A;  3POU A;  3PGU A; 
#chains in the Genus database with same CATH homology
 3HOL A;  4FES A;  4G75 A;  3POX A;  4XNK A;  3LK4 2;  1ZHW A;  4N59 A;  1HXU A;  1Q9G A;  4KR8 A;  2XMX A;  3A2S X;  4LSH A;  3LK3 A;  4D65 A;  4AYD C;  2O4V A;  3VY8 X;  2KC0 A;  4GCQ A;  1H6S 1;  3AAE A;  4KR4 A;  4AUI A;  3SY7 A;  4FSP A;  4FZL A;  2PRN A;  5ADX K;  4O3W A;  4AYE C;  4Z3T A;  3VZW X;  7PRN A;  2X27 X;  3HW9 A;  4FZN A;  4KRA A;  4RLC A;  3SYB A;  4LSE A;  4AFK A;  1QJ9 A;  4LSF A;  4O4U A;  4B61 A;  4RL9 A;  5AFU K;  1QJ8 A;  1E54 A;  2F1V A;  2LFU A;  4RJX A;  4RLB A;  2OMF A;  6PRN A;  2XE2 A;  4FMS A;  2XTQ A;  5G26 A;  1PRN A;  2K0L A;  1HXX A;  2KZ7 A;  2ODJ A;  3EMN X;  4GCP A;  5DL6 A;  2Y7S A;  3UAQ A;  5GV0 A;  3KVD D;  4JCH A;  3WI4 A;  4AYM C;  4RJW A;  1GFP A;  3AA6 A;  4FSO A;  3AAE B;  1ZHZ A;  1OPF A;  4U9C A;  5EE2 A;  4BUM X;  3T24 A;  2LHF A;  2ZLD A;  3POR A;  1G90 A;  1P4T A;  3FYX A;  3AAA A;  3HOE A;  4FT6 A;  4D64 A;  2ERV A;  3C5O A;  3VE1 A;  5FVN A;  3K19 A;  2N2M A;  4D5U A;  3PQU A;  3SY9 A;  4AKR A;  2W80 C;  3AA1 A;  3JTY A;  1ORM A;  3LK4 1;  3QRA A;  3NSG A;  4PUX A;  5PRN A;  2KZ7 B;  4FRX A;  2JMM A;  4XNL A;  2M07 A;  2J1N A;  4FOZ A;  2QTK A;  3AA6 B;  5JDP A;  3LK2 A;  1HXT A;  1GFQ A;  2MNH A;  3UPG A;  3LK3 B;  4JFB A;  2GE4 A;  3TZG A;  1MM4 A;  3UU2 A;  4E1T A;  2Y0H A;  2KXP A;  3VY9 X;  3VE2 A;  2Y0L A;  1PHO A;  4AKR B;  2K4T A;  3PRN A;  1QJP A;  2XG6 A;  2Y0K A;  3DA4 A;  1BXW A;  2KDY A;  3GP6 A;  3HWB A;  4C69 X;  1BT9 A;  2Y2X A;  5ADX L;  3POQ A;  1ZHT A;  2FGQ X;  2W81 C;  4N58 A;  1GFO A;  1MM5 A;  4FZM A;  3AA0 A;  8PRN A;  3V8U A;  5AFU L;  4O49 A;  1BH3 A;  3LK2 B;  5DL5 A;  5T5F A;  4FUV A;  2XE3 A;  1IZN A;  4AKM A;  4AZL A;  4AYI D;  2J4U P;  2XE5 A;  3AA7 A;  4LSI A;  3VZT X;  3PQS A;  4GCS A;  2FGR A;  5DL8 A;  5D5D A;  1Q9F A;  2KXP B;  3RBH A;  3WI5 A;  2N2L A;  2ZFG A;  3SZV A;  3SZD A;  4GHB A;  4E1S A;  4AYN A;  3SYS A;  5IYU A;  4O3Y A;  3AAA B;  3VZU X;  3G7G A;  1GFM A;  3O0E A;  4O3X B;  2MHL A;  1OSM A;  3AA1 B;  4O3Z A;  4QQ1 A;  4F4B A;  2XTR A;  2XE1 A;  2POR A;  3AA0 B;  2YPV A;  2F1T A;  4O4X A;  4FRT A;  1THQ A;  1IZN B;  1GFN A;  1ZHX A;  3QRC A;  3AA7 B;  2M06 A;  4G76 A;  3DA3 A;  1ZHY A;  2YNK A;  3T20 A;  4GF4 A;  1MPF A;  5DL7 A;  1YS5 A;  3T0S A;  3POU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...