3G7GA

Crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
149
Chain Sequence
EMNYEEVFSITITVDKPILIGQDDIVGRRQLIPIISGKVSGNNFNGKVLPGGIDSQIVRPDGKCELSARYAIRLDDGAAIYIENNGIRTVPDEYIEAVKSGEFVDPNAYYFRTIPTFETYSPKYKWMMNHIFVCCASRENVLLKFYKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0311 protein CA_C3321
publication title The crystal structure of the protein with unknown function from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum atcc 824
total genus 35
structure length 149
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3g7gA00
2MNHA 3QRCA 2F1VA 1THQA 3C5OA 1Q9GA 1QJ8A 1QJPA 2ERVA 2K0LA 2M06A 4PUXA 2F1TA 3GP6A 2N2LA 1BXWA 3QRAA 2GE4A 1MM5A 2N2MA 1P4TA 2JMMA 3G7GA 2M07A 1QJ9A 1MM4A 4RLCA 2LHFA 2MHLA 1Q9FA 2X27X 1ORMA 1G90A
chains in the Genus database with same CATH superfamily
3HW9A 2W81C 3KVDD 5G26A 1PRNA 3AAAA 3NSGA 4K3BA 5E79O 3VE1A 3LK2B 4UB8O 2F1VA 3VZWX 2WJRA 2Y0LA 1GFOA 4D65A 4FZMA 8PRNA 1Q9GA 2F1CX 3UAQA 3PQUA 1QJ8A 1QJPA 2ERVA 2K0LA 4FSOA 4LSEA 2YPVA 3HWBA 3JTYA 2Y0HA 2J1NA 4FSPA 4FESA 1OPFA 2KZ7A 2IWWA 2GE4A 1MM5A 4FRTA 1MPFA 3UU2A 4F4BA 1P4TA 2XE1A 4FUVA 4GHBA 4KR4A 3LK41 4PR7A 3RBHA 4C69X 2J4UP 3PRNA 3AAEB 4D5UA 2R4NA 1HXTA 1GFNA 2ODJA 3PF1A 3VY9X 3UPGA 5PRNA 3VZTX 4IL6O 4AFKA 3AA6A 4LSIA 5ADXL 2AXTO 2W80C 1HXUA 4C00A 3POQA 1G90A 1ZHTA 4KR8A 3WU2O 1GFQA 3AA6B 1ZHXA 3VY8X 5H2FO 3AA7A 4O3YA 4FMSA 4U9CA 3DZMA 3WI4A 3AA0A 3AA7B 4PUXA 4N59A 3DA3A 2FGQX 4N58A 3DWOX 2R89A 3GP6A 4XNKA 4AYID 2N2LA 1BXWA 3AAEA 2OMFA 2N2MA 3AA0B 4FOZA 4UB6O 4FQEA 2R4LA 1H6S1 2K4TA 4G76A 1HXXA 1GFPA 4JCHA 2Y7SA 4N74A 4RLBA 3EMNX 4FZLA 2XTRA 4AKRB 3LK42 4B61A 4D64A 4RLCA 2R4PA 3DA4A 5D5DA 6PRNA 4FT6A 3A0BO 2R4OA 3A2SX 4LSFA 5KAFO 2X27X 2Y0KA 5G39A 5TISO 3VZUX 3T20A 1PHOA 3O0EA 4C4VB 3QRCA 5ADXK 2Y2XA 1THQA 2WVPA 5FVNA 4G75A 4KRAA 3WI5A 5DL7A 4AYMC 4AKMA 4XNLA 4GF4A 4PJ0O 2M06A 4C4VA 3JCUO 5G38A 3LK3A 4AUIA 2F1TA 5T5FA 2O4VA 1YS5A 1OSMA 3T24A 4E1SA 5IYUA 4AYEC 4AKRA 3SYBA 5GTHO 3LK3B 2LFUA 2XE3A 1GFMA 2M07A 2KDYA 3AA1A 5AFUL 5DL6A 3HOLA 2PRNA 3PGSA 3SY9A 3NJTA 5KAIO 3POXA 2XTQA 3POUA 4O4XA 2ZLDA 2MHLA 3BS0A 3DWNA 3AA1B 3PGUA 2XE5A 2X9KA 4RJWA 2KXPB 4RL9A 5DL8A 3SY7A 5G3AA 3FYXA 3VE2A 5GV0A 2WJQA 3TZGA 4Z3TA 2XMXA 4O3WA 2MNHA 2ZFGA 4AYNA 5EE2A 4AZLA 4GCPA 2XG6A 4FRXA 4QQ1A 5DL5A 3C5OA 4AYDC 3KZIO 3AAAB 3T0SA 4BUMX 3SYSA 1ZHYA 4O3XB 4O49A 2QTKA 3V8UA 1ZHZA 2R88A 3A0HO 3PORA 1E54A 4N75A 4GCSA 4GCQA 4O3ZA 3QRAA 2IWVA 3SZDA 1ZHWA 2KC0A 2YNKA 3HOEA 3K19A 4E1TA 1BT9A 2JMMA 4CTDA 2R8AA 2XE2A 3BRZA 2KZ7B 3G7GA 4JFBA 4K3CA 4RJXA 5JDPA 1T16A 1IZNA 3PQSA 4O4UA 1MM4A 1QJ9A 5GTIO 2FGRA 2KXPA 1S5LO 1T1LA 2LHFA 7PRNA 2PORA 3LK2A 4LSHA 3PGRA 1BH3A 1IZNB 1Q9FA 3SZVA 5AFUK 2JQYA 1ORMA 4FZNA 5B5EO 3BRYA 5B66O
chains in the Genus database with same CATH topology
3HW9A 2W81C 3KVDD 5G26A 1PRNA 3AAAA 3NSGA 3VZWX 3VE1A 3LK2B 4D65A 2F1VA 2Y0LA 1GFOA 8PRNA 4FZMA 1Q9GA 3UAQA 3PQUA 1QJ8A 1QJPA 2ERVA 2K0LA 4FSOA 4LSEA 2YPVA 3HWBA 3JTYA 2Y0HA 2J1NA 4FSPA 4FESA 1OPFA 2KZ7A 2GE4A 1MM5A 4FRTA 1MPFA 3UU2A 4F4BA 1P4TA 2XE1A 4FUVA 4GHBA 4KR4A 3LK41 3RBHA 4C69X 2J4UP 3PRNA 3AAEB 4D5UA 1HXTA 1GFNA 2ODJA 3UPGA 3VY9X 5PRNA 3VZTX 4AFKA 3AA6A 4LSIA 5ADXL 2W80C 1HXUA 3POQA 1G90A 1ZHTA 4KR8A 1GFQA 3AA6B 1ZHXA 3VY8X 3AA7A 4O3YA 4FMSA 4U9CA 3WI4A 3AA0A 3AA7B 4PUXA 4N59A 3DA3A 2FGQX 4N58A 4XNKA 3GP6A 4AYID 2N2LA 1BXWA 3AAEA 2OMFA 2N2MA 3AA0B 4FOZA 1H6S1 2K4TA 4G76A 1HXXA 1GFPA 4JCHA 2Y7SA 4RLBA 3EMNX 4FZLA 2XTRA 4AKRB 3LK42 4B61A 4D64A 4RLCA 3DA4A 5D5DA 6PRNA 4FT6A 3A2SX 4LSFA 2X27X 2Y0KA 3VZUX 3T20A 1PHOA 3O0EA 5ADXK 3QRCA 2Y2XA 1THQA 5FVNA 4G75A 4KRAA 3WI5A 5DL7A 4AYMC 4AKMA 4XNLA 4GF4A 2M06A 3LK3A 4AUIA 2F1TA 5T5FA 2O4VA 1YS5A 1OSMA 3T24A 4E1SA 5IYUA 4AYEC 4AKRA 3SYBA 3LK3B 2LFUA 2XE3A 1GFMA 2M07A 2KDYA 3AA1A 5AFUL 5DL6A 3HOLA 2PRNA 3SY9A 3POXA 2XTQA 3POUA 4O4XA 2ZLDA 2MHLA 3AA1B 2XE5A 4RJWA 5DL8A 2KXPB 4RL9A 3SY7A 3VE2A 5GV0A 3FYXA 3TZGA 4Z3TA 2XMXA 4O3WA 2MNHA 2ZFGA 4AYNA 5EE2A 4AZLA 4GCPA 2XG6A 4FRXA 4QQ1A 5DL5A 3C5OA 4AYDC 3AAAB 3T0SA 4BUMX 3SYSA 1ZHYA 4O3XB 4O49A 2QTKA 3V8UA 1ZHZA 3PORA 1E54A 4GCSA 4GCQA 4O3ZA 3QRAA 3SZDA 1ZHWA 2KC0A 2YNKA 3HOEA 3K19A 1BT9A 2JMMA 2XE2A 3G7GA 4JFBA 2KZ7B 4RJXA 5JDPA 3PQSA 1IZNA 4O4UA 1MM4A 1QJ9A 2FGRA 2KXPA 7PRNA 2LHFA 2PORA 3LK2A 4LSHA 3SZVA 1BH3A 1IZNB 1Q9FA 5AFUK 4E1TA 1ORMA 4FZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNH A;  3QRC A;  2F1V A;  1THQ A;  3C5O A;  1Q9G A;  1QJ8 A;  1QJP A;  2ERV A;  2K0L A;  2M06 A;  4PUX A;  2F1T A;  3GP6 A;  2N2L A;  1BXW A;  3QRA A;  2GE4 A;  1MM5 A;  2N2M A;  1P4T A;  2JMM A;  3G7G A;  2M07 A;  1QJ9 A;  1MM4 A;  4RLC A;  2LHF A;  2MHL A;  1Q9F A;  2X27 X;  1ORM A;  1G90 A; 
#chains in the Genus database with same CATH topology
 3HW9 A;  2W81 C;  3KVD D;  5G26 A;  1PRN A;  3AAA A;  3NSG A;  4K3B A;  5E79 O;  3VE1 A;  3LK2 B;  4UB8 O;  2F1V A;  3VZW X;  2WJR A;  2Y0L A;  1GFO A;  4D65 A;  4FZM A;  8PRN A;  1Q9G A;  2F1C X;  3UAQ A;  3PQU A;  1QJ8 A;  1QJP A;  2ERV A;  2K0L A;  4FSO A;  4LSE A;  2YPV A;  3HWB A;  3JTY A;  2Y0H A;  2J1N A;  4FSP A;  4FES A;  1OPF A;  2KZ7 A;  2IWW A;  2GE4 A;  1MM5 A;  4FRT A;  1MPF A;  3UU2 A;  4F4B A;  1P4T A;  2XE1 A;  4FUV A;  4GHB A;  4KR4 A;  3LK4 1;  4PR7 A;  3RBH A;  4C69 X;  2J4U P;  3PRN A;  3AAE B;  4D5U A;  2R4N A;  1HXT A;  1GFN A;  2ODJ A;  3PF1 A;  3VY9 X;  3UPG A;  5PRN A;  3VZT X;  4IL6 O;  4AFK A;  3AA6 A;  4LSI A;  5ADX L;  2AXT O;  2W80 C;  1HXU A;  4C00 A;  3POQ A;  1G90 A;  1ZHT A;  4KR8 A;  3WU2 O;  1GFQ A;  3AA6 B;  1ZHX A;  3VY8 X;  5H2F O;  3AA7 A;  4O3Y A;  4FMS A;  4U9C A;  3DZM A;  3WI4 A;  3AA0 A;  3AA7 B;  4PUX A;  4N59 A;  3DA3 A;  2FGQ X;  4N58 A;  3DWO X;  2R89 A;  3GP6 A;  4XNK A;  4AYI D;  2N2L A;  1BXW A;  3AAE A;  2OMF A;  2N2M A;  3AA0 B;  4FOZ A;  4UB6 O;  4FQE A;  2R4L A;  1H6S 1;  2K4T A;  4G76 A;  1HXX A;  1GFP A;  4JCH A;  2Y7S A;  4N74 A;  4RLB A;  3EMN X;  4FZL A;  2XTR A;  4AKR B;  3LK4 2;  4B61 A;  4D64 A;  4RLC A;  2R4P A;  3DA4 A;  5D5D A;  6PRN A;  4FT6 A;  3A0B O;  2R4O A;  3A2S X;  4LSF A;  5KAF O;  2X27 X;  2Y0K A;  5G39 A;  5TIS O;  3VZU X;  3T20 A;  1PHO A;  3O0E A;  4C4V B;  3QRC A;  5ADX K;  2Y2X A;  1THQ A;  2WVP A;  5FVN A;  4G75 A;  4KRA A;  3WI5 A;  5DL7 A;  4AYM C;  4AKM A;  4XNL A;  4GF4 A;  4PJ0 O;  2M06 A;  4C4V A;  3JCU O;  5G38 A;  3LK3 A;  4AUI A;  2F1T A;  5T5F A;  2O4V A;  1YS5 A;  1OSM A;  3T24 A;  4E1S A;  5IYU A;  4AYE C;  4AKR A;  3SYB A;  5GTH O;  3LK3 B;  2LFU A;  2XE3 A;  1GFM A;  2M07 A;  2KDY A;  3AA1 A;  5AFU L;  5DL6 A;  3HOL A;  2PRN A;  3PGS A;  3SY9 A;  3NJT A;  5KAI O;  3POX A;  2XTQ A;  3POU A;  4O4X A;  2ZLD A;  2MHL A;  3BS0 A;  3DWN A;  3AA1 B;  3PGU A;  2XE5 A;  2X9K A;  4RJW A;  2KXP B;  4RL9 A;  5DL8 A;  3SY7 A;  5G3A A;  3FYX A;  3VE2 A;  5GV0 A;  2WJQ A;  3TZG A;  4Z3T A;  2XMX A;  4O3W A;  2MNH A;  2ZFG A;  4AYN A;  5EE2 A;  4AZL A;  4GCP A;  2XG6 A;  4FRX A;  4QQ1 A;  5DL5 A;  3C5O A;  4AYD C;  3KZI O;  3AAA B;  3T0S A;  4BUM X;  3SYS A;  1ZHY A;  4O3X B;  4O49 A;  2QTK A;  3V8U A;  1ZHZ A;  2R88 A;  3A0H O;  3POR A;  1E54 A;  4N75 A;  4GCS A;  4GCQ A;  4O3Z A;  3QRA A;  2IWV A;  3SZD A;  1ZHW A;  2KC0 A;  2YNK A;  3HOE A;  3K19 A;  4E1T A;  1BT9 A;  2JMM A;  4CTD A;  2R8A A;  2XE2 A;  3BRZ A;  2KZ7 B;  3G7G A;  4JFB A;  4K3C A;  4RJX A;  5JDP A;  1T16 A;  1IZN A;  3PQS A;  4O4U A;  1MM4 A;  1QJ9 A;  5GTI O;  2FGR A;  2KXP A;  1S5L O;  1T1L A;  2LHF A;  7PRN A;  2POR A;  3LK2 A;  4LSH A;  3PGR A;  1BH3 A;  1IZN B;  1Q9F A;  3SZV A;  5AFU K;  2JQY A;  1ORM A;  4FZN A;  5B5E O;  3BRY A;  5B66 O; 
#chains in the Genus database with same CATH homology
 3HW9 A;  2W81 C;  3KVD D;  5G26 A;  1PRN A;  3AAA A;  3NSG A;  3VZW X;  3VE1 A;  3LK2 B;  4D65 A;  2F1V A;  2Y0L A;  1GFO A;  8PRN A;  4FZM A;  1Q9G A;  3UAQ A;  3PQU A;  1QJ8 A;  1QJP A;  2ERV A;  2K0L A;  4FSO A;  4LSE A;  2YPV A;  3HWB A;  3JTY A;  2Y0H A;  2J1N A;  4FSP A;  4FES A;  1OPF A;  2KZ7 A;  2GE4 A;  1MM5 A;  4FRT A;  1MPF A;  3UU2 A;  4F4B A;  1P4T A;  2XE1 A;  4FUV A;  4GHB A;  4KR4 A;  3LK4 1;  3RBH A;  4C69 X;  2J4U P;  3PRN A;  3AAE B;  4D5U A;  1HXT A;  1GFN A;  2ODJ A;  3UPG A;  3VY9 X;  5PRN A;  3VZT X;  4AFK A;  3AA6 A;  4LSI A;  5ADX L;  2W80 C;  1HXU A;  3POQ A;  1G90 A;  1ZHT A;  4KR8 A;  1GFQ A;  3AA6 B;  1ZHX A;  3VY8 X;  3AA7 A;  4O3Y A;  4FMS A;  4U9C A;  3WI4 A;  3AA0 A;  3AA7 B;  4PUX A;  4N59 A;  3DA3 A;  2FGQ X;  4N58 A;  4XNK A;  3GP6 A;  4AYI D;  2N2L A;  1BXW A;  3AAE A;  2OMF A;  2N2M A;  3AA0 B;  4FOZ A;  1H6S 1;  2K4T A;  4G76 A;  1HXX A;  1GFP A;  4JCH A;  2Y7S A;  4RLB A;  3EMN X;  4FZL A;  2XTR A;  4AKR B;  3LK4 2;  4B61 A;  4D64 A;  4RLC A;  3DA4 A;  5D5D A;  6PRN A;  4FT6 A;  3A2S X;  4LSF A;  2X27 X;  2Y0K A;  3VZU X;  3T20 A;  1PHO A;  3O0E A;  5ADX K;  3QRC A;  2Y2X A;  1THQ A;  5FVN A;  4G75 A;  4KRA A;  3WI5 A;  5DL7 A;  4AYM C;  4AKM A;  4XNL A;  4GF4 A;  2M06 A;  3LK3 A;  4AUI A;  2F1T A;  5T5F A;  2O4V A;  1YS5 A;  1OSM A;  3T24 A;  4E1S A;  5IYU A;  4AYE C;  4AKR A;  3SYB A;  3LK3 B;  2LFU A;  2XE3 A;  1GFM A;  2M07 A;  2KDY A;  3AA1 A;  5AFU L;  5DL6 A;  3HOL A;  2PRN A;  3SY9 A;  3POX A;  2XTQ A;  3POU A;  4O4X A;  2ZLD A;  2MHL A;  3AA1 B;  2XE5 A;  4RJW A;  5DL8 A;  2KXP B;  4RL9 A;  3SY7 A;  3VE2 A;  5GV0 A;  3FYX A;  3TZG A;  4Z3T A;  2XMX A;  4O3W A;  2MNH A;  2ZFG A;  4AYN A;  5EE2 A;  4AZL A;  4GCP A;  2XG6 A;  4FRX A;  4QQ1 A;  5DL5 A;  3C5O A;  4AYD C;  3AAA B;  3T0S A;  4BUM X;  3SYS A;  1ZHY A;  4O3X B;  4O49 A;  2QTK A;  3V8U A;  1ZHZ A;  3POR A;  1E54 A;  4GCS A;  4GCQ A;  4O3Z A;  3QRA A;  3SZD A;  1ZHW A;  2KC0 A;  2YNK A;  3HOE A;  3K19 A;  1BT9 A;  2JMM A;  2XE2 A;  3G7G A;  4JFB A;  2KZ7 B;  4RJX A;  5JDP A;  3PQS A;  1IZN A;  4O4U A;  1MM4 A;  1QJ9 A;  2FGR A;  2KXP A;  7PRN A;  2LHF A;  2POR A;  3LK2 A;  4LSH A;  3SZV A;  1BH3 A;  1IZN B;  1Q9F A;  5AFU K;  4E1T A;  1ORM A;  4FZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...