3G7GA

Crystal structure of the protein with unknown function from clostridium acetobutylicum atcc 824
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
149
Chain Sequence
EMNYEEVFSITITVDKPILIGQDDIVGRRQLIPIISGKVSGNNFNGKVLPGGIDSQIVRPDGKCELSARYAIRLDDGAAIYIENNGIRTVPDEYIEAVKSGEFVDPNAYYFRTIPTFETYSPKYKWMMNHIFVCCASRENVLLKFYKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein with unknown function from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Structural genomics, unknown function
molecule keywords UPF0311 protein CA_C3321
total genus 35
structure length 149
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11578 DUF3237 Protein of unknown function (DUF3237)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 3g7gA00
3C5OA 1QJPA 1QJ8A 2GE4A 2MHLA 1P4TA 1QJ9A 2MNHA 2ERVA 2M07A 2N2LA 1MM4A 3QRCA 1BXWA 1THQA 3GP6A 1ORMA 2JMMA 2F1TA 2F1VA 1MM5A 3QRAA 4RLCA 1Q9GA 3G7GA 4PUXA 2K0LA 2N2MA 1Q9FA 2M06A 2X27X 1G90A 2LHFA
chains in the Genus database with same CATH superfamily
3HW9A 2X9KA 1QJPA 3PQSA 2GE4A 5KAFO 3SYBA 5ADXL 3HOLA 4U9CA 5FVNA 2K4TA 4N59A 4KR4A 4CTDA 2R8AA 3LK2B 8PRNA 3A0BO 2PRNA 3T20A 4C4VB 4K3CA 4GCPA 4RLBA 1BXWA 5AFUL 4GHBA 3K19A 4FZLA 2R4NA 4O3YA 5D5DA 1GFPA 1T16A 1ZHWA 2YNKA 3VZTX 4N58A 1ORMA 3VE2A 1G90A 3PQUA 2XE2A 3DWOX 2AXTO 4C00A 3DWNA 5DL5A 3UPGA 1Q9GA 3HWBA 5KAIO 1IZNB 1S5LO 3JCUO 3LK41 4FRTA 1GFQA 3BS0A 3SY7A 3AA0B 5AFUK 4FOZA 2R4OA 1T1LA 5B5EO 4FMSA 3SZDA 2KZ7B 3LK3A 4LSFA 2XE3A 2KXPA 2XMXA 4FZMA 4FUVA 3C5OA 4IL6O 4AZLA 5GTHO 4FRXA 4D64A 1QJ8A 2Y0LA 4AYEC 5B66O 1IZNA 2J4UP 4JFBA 1HXTA 1E54A 2JQYA 5E79O 4KR8A 3PF1A 4C4VA 3V8UA 3NSGA 3AA1A 4G75A 2ZFGA 4XNKA 3LK42 5GV0A 3AAAA 3WI5A 4G76A 2R4PA 3GP6A 4AYNA 1PRNA 1HXXA 3WI4A 4XNLA 2W81C 2YPVA 1YS5A 3WU2O 1ZHTA 3AAEB 4O3XB 1MM5A 2XTRA 3AA6A 3POQA 4RL9A 3G7GA 4UB8O 4K3BA 4AYID 2K0LA 3DZMA 1HXUA 3KVDD 4O4UA 4PJ0O 4BUMX 4E1SA 1OSMA 2XE1A 3KZIO 5IYUA 2X27X 2Y0KA 4RJXA 3JTYA 4LSEA 4GCSA 2LHFA 4AKRA 4AKRB 2FGQX 3VY9X 4AUIA 4C69X 2F1CX 3PGRA 5G26A 2LFUA 2FGRA 2MHLA 3UAQA 7PRNA 1MPFA 2XG6A 2Y7SA 3SY9A 4D65A 3DA4A 4F4BA 5EE2A 5T5FA 4D5UA 3AA7A 3AA1B 1PHOA 4N75A 1OPFA 4FQEA 4FSPA 3PGSA 3QRCA 1ZHXA 4O4XA 5DL6A 1BT9A 2KC0A 1GFOA 1THQA 2W80C 5DL7A 3SYSA 4FT6A 3VE1A 2XE5A 3VZWX 2KXPB 3AA6B 1ZHYA 2IWVA 3A2SX 1H6S1 2OMFA 2KDYA 2R4LA 2F1TA 3AAEA 3LK3B 3FYXA 3POUA 3AA0A 2F1VA 4FSOA 2O4VA 3QRAA 4RLCA 4AKMA 3PRNA 5TISO 4KRAA 3VZUX 2WJRA 2Y2XA 3T24A 5PRNA 4AFKA 2N2MA 1Q9FA 2M06A 2ODJA 3AA7B 4GCQA 3AAAB 2J1NA 3BRZA 4LSIA 1BH3A 3T0SA 4Z3TA 5DL8A 2ZLDA 5G39A 4AYMC 2IWWA 4UB6O 3A0HO 4O3WA 3SZVA 3POXA 1GFMA 1P4TA 3TZGA 4AYDC 4RJWA 5G38A 4B61A 4GF4A 1GFNA 1QJ9A 2MNHA 2PORA 2R88A 2QTKA 3LK2A 2KZ7A 3O0EA 1ZHZA 5G3AA 2WJQA 4LSHA 2ERVA 2M07A 2N2LA 1MM4A 5H2FO 6PRNA 4QQ1A 3DA3A 2R89A 2XTQA 3UU2A 3PGUA 3VY8X 4PR7A 4N74A 3NJTA 5JDPA 2JMMA 2Y0HA 4O3ZA 4E1TA 2WVPA 3BRYA 3HOEA 3EMNX 4FZNA 4PUXA 5ADXK 4O49A 4JCHA 3RBHA 3PORA 4FESA 5GTIO
chains in the Genus database with same CATH topology
3HW9A 1QJPA 3PQSA 2GE4A 3SYBA 5ADXL 3HOLA 4U9CA 5FVNA 2K4TA 4N59A 4KR4A 8PRNA 3LK2B 2PRNA 3T20A 4GCPA 4RLBA 1BXWA 5AFUL 4GHBA 3K19A 4FZLA 4O3YA 5D5DA 1GFPA 1ZHWA 3VZTX 2YNKA 4N58A 1ORMA 3VE2A 1G90A 3PQUA 2XE2A 3UPGA 5DL5A 1Q9GA 3HWBA 1IZNB 3LK41 4FRTA 3SY7A 1GFQA 5AFUK 3AA0B 4FOZA 4FMSA 3SZDA 2KZ7B 3LK3A 4LSFA 2XE3A 2XMXA 2KXPA 4FZMA 4FUVA 3C5OA 4AZLA 4FRXA 4D64A 1QJ8A 2Y0LA 4AYEC 1IZNA 2J4UP 4JFBA 1HXTA 1E54A 4KR8A 3V8UA 3NSGA 3AA1A 4G75A 2ZFGA 4XNKA 3LK42 5GV0A 3AAAA 3WI5A 4G76A 3GP6A 4AYNA 1PRNA 1HXXA 3WI4A 4XNLA 2YPVA 2W81C 1YS5A 1ZHTA 3AAEB 4O3XB 1MM5A 2XTRA 3AA6A 3POQA 4RL9A 3G7GA 4AYID 2K0LA 4O4UA 1HXUA 3KVDD 4BUMX 4E1SA 1OSMA 2XE1A 5IYUA 2X27X 2Y0KA 4RJXA 3JTYA 4LSEA 4GCSA 2LHFA 4AKRA 4AKRB 2FGQX 3VY9X 4AUIA 4C69X 5G26A 2LFUA 2FGRA 2MHLA 3UAQA 7PRNA 1MPFA 2XG6A 2Y7SA 3SY9A 4D65A 3DA4A 4F4BA 5EE2A 5T5FA 4D5UA 3AA7A 3AA1B 1PHOA 1OPFA 4FSPA 3QRCA 1ZHXA 4O4XA 5DL6A 1BT9A 2KC0A 1GFOA 1THQA 2W80C 5DL7A 3SYSA 4FT6A 3VE1A 2XE5A 3VZWX 2KXPB 3AA6B 1ZHYA 3A2SX 3LK3B 1H6S1 2OMFA 2KDYA 3AAEA 2F1TA 3POUA 3FYXA 3AA0A 2F1VA 4FSOA 2O4VA 3QRAA 4RLCA 4AKMA 3PRNA 4KRAA 3VZUX 2Y2XA 3T24A 5PRNA 4AFKA 2N2MA 1Q9FA 2M06A 2ODJA 3AA7B 4GCQA 3AAAB 2J1NA 4LSIA 3T0SA 1BH3A 4Z3TA 5DL8A 2ZLDA 4AYMC 3SZVA 4O3WA 3POXA 1GFMA 1P4TA 3TZGA 4AYDC 4RJWA 4B61A 4GF4A 1GFNA 1QJ9A 2MNHA 2PORA 3LK2A 2QTKA 2KZ7A 3O0EA 1ZHZA 4LSHA 2ERVA 2M07A 2N2LA 1MM4A 6PRNA 4QQ1A 3DA3A 2XTQA 3UU2A 3VY8X 5JDPA 2JMMA 2Y0HA 4O3ZA 4E1TA 3HOEA 3EMNX 4FZNA 4PUXA 5ADXK 4O49A 4JCHA 3RBHA 3PORA 4FESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5O A;  1QJP A;  1QJ8 A;  2GE4 A;  2MHL A;  1P4T A;  1QJ9 A;  2MNH A;  2ERV A;  2M07 A;  2N2L A;  1MM4 A;  3QRC A;  1BXW A;  1THQ A;  3GP6 A;  1ORM A;  2JMM A;  2F1T A;  2F1V A;  1MM5 A;  3QRA A;  4RLC A;  1Q9G A;  3G7G A;  4PUX A;  2K0L A;  2N2M A;  1Q9F A;  2M06 A;  2X27 X;  1G90 A;  2LHF A; 
#chains in the Genus database with same CATH topology
 3HW9 A;  2X9K A;  1QJP A;  3PQS A;  2GE4 A;  5KAF O;  3SYB A;  5ADX L;  3HOL A;  4U9C A;  5FVN A;  2K4T A;  4N59 A;  4KR4 A;  4CTD A;  2R8A A;  3LK2 B;  8PRN A;  3A0B O;  2PRN A;  3T20 A;  4C4V B;  4K3C A;  4GCP A;  4RLB A;  1BXW A;  5AFU L;  4GHB A;  3K19 A;  4FZL A;  2R4N A;  4O3Y A;  5D5D A;  1GFP A;  1T16 A;  1ZHW A;  2YNK A;  3VZT X;  4N58 A;  1ORM A;  3VE2 A;  1G90 A;  3PQU A;  2XE2 A;  3DWO X;  2AXT O;  4C00 A;  3DWN A;  5DL5 A;  3UPG A;  1Q9G A;  3HWB A;  5KAI O;  1IZN B;  1S5L O;  3JCU O;  3LK4 1;  4FRT A;  1GFQ A;  3BS0 A;  3SY7 A;  3AA0 B;  5AFU K;  4FOZ A;  2R4O A;  1T1L A;  5B5E O;  4FMS A;  3SZD A;  2KZ7 B;  3LK3 A;  4LSF A;  2XE3 A;  2KXP A;  2XMX A;  4FZM A;  4FUV A;  3C5O A;  4IL6 O;  4AZL A;  5GTH O;  4FRX A;  4D64 A;  1QJ8 A;  2Y0L A;  4AYE C;  5B66 O;  1IZN A;  2J4U P;  4JFB A;  1HXT A;  1E54 A;  2JQY A;  5E79 O;  4KR8 A;  3PF1 A;  4C4V A;  3V8U A;  3NSG A;  3AA1 A;  4G75 A;  2ZFG A;  4XNK A;  3LK4 2;  5GV0 A;  3AAA A;  3WI5 A;  4G76 A;  2R4P A;  3GP6 A;  4AYN A;  1PRN A;  1HXX A;  3WI4 A;  4XNL A;  2W81 C;  2YPV A;  1YS5 A;  3WU2 O;  1ZHT A;  3AAE B;  4O3X B;  1MM5 A;  2XTR A;  3AA6 A;  3POQ A;  4RL9 A;  3G7G A;  4UB8 O;  4K3B A;  4AYI D;  2K0L A;  3DZM A;  1HXU A;  3KVD D;  4O4U A;  4PJ0 O;  4BUM X;  4E1S A;  1OSM A;  2XE1 A;  3KZI O;  5IYU A;  2X27 X;  2Y0K A;  4RJX A;  3JTY A;  4LSE A;  4GCS A;  2LHF A;  4AKR A;  4AKR B;  2FGQ X;  3VY9 X;  4AUI A;  4C69 X;  2F1C X;  3PGR A;  5G26 A;  2LFU A;  2FGR A;  2MHL A;  3UAQ A;  7PRN A;  1MPF A;  2XG6 A;  2Y7S A;  3SY9 A;  4D65 A;  3DA4 A;  4F4B A;  5EE2 A;  5T5F A;  4D5U A;  3AA7 A;  3AA1 B;  1PHO A;  4N75 A;  1OPF A;  4FQE A;  4FSP A;  3PGS A;  3QRC A;  1ZHX A;  4O4X A;  5DL6 A;  1BT9 A;  2KC0 A;  1GFO A;  1THQ A;  2W80 C;  5DL7 A;  3SYS A;  4FT6 A;  3VE1 A;  2XE5 A;  3VZW X;  2KXP B;  3AA6 B;  1ZHY A;  2IWV A;  3A2S X;  1H6S 1;  2OMF A;  2KDY A;  2R4L A;  2F1T A;  3AAE A;  3LK3 B;  3FYX A;  3POU A;  3AA0 A;  2F1V A;  4FSO A;  2O4V A;  3QRA A;  4RLC A;  4AKM A;  3PRN A;  5TIS O;  4KRA A;  3VZU X;  2WJR A;  2Y2X A;  3T24 A;  5PRN A;  4AFK A;  2N2M A;  1Q9F A;  2M06 A;  2ODJ A;  3AA7 B;  4GCQ A;  3AAA B;  2J1N A;  3BRZ A;  4LSI A;  1BH3 A;  3T0S A;  4Z3T A;  5DL8 A;  2ZLD A;  5G39 A;  4AYM C;  2IWW A;  4UB6 O;  3A0H O;  4O3W A;  3SZV A;  3POX A;  1GFM A;  1P4T A;  3TZG A;  4AYD C;  4RJW A;  5G38 A;  4B61 A;  4GF4 A;  1GFN A;  1QJ9 A;  2MNH A;  2POR A;  2R88 A;  2QTK A;  3LK2 A;  2KZ7 A;  3O0E A;  1ZHZ A;  5G3A A;  2WJQ A;  4LSH A;  2ERV A;  2M07 A;  2N2L A;  1MM4 A;  5H2F O;  6PRN A;  4QQ1 A;  3DA3 A;  2R89 A;  2XTQ A;  3UU2 A;  3PGU A;  3VY8 X;  4PR7 A;  4N74 A;  3NJT A;  5JDP A;  2JMM A;  2Y0H A;  4O3Z A;  4E1T A;  2WVP A;  3BRY A;  3HOE A;  3EMN X;  4FZN A;  4PUX A;  5ADX K;  4O49 A;  4JCH A;  3RBH A;  3POR A;  4FES A;  5GTI O; 
#chains in the Genus database with same CATH homology
 3HW9 A;  1QJP A;  3PQS A;  2GE4 A;  3SYB A;  5ADX L;  3HOL A;  4U9C A;  5FVN A;  2K4T A;  4N59 A;  4KR4 A;  8PRN A;  3LK2 B;  2PRN A;  3T20 A;  4GCP A;  4RLB A;  1BXW A;  5AFU L;  4GHB A;  3K19 A;  4FZL A;  4O3Y A;  5D5D A;  1GFP A;  1ZHW A;  3VZT X;  2YNK A;  4N58 A;  1ORM A;  3VE2 A;  1G90 A;  3PQU A;  2XE2 A;  3UPG A;  5DL5 A;  1Q9G A;  3HWB A;  1IZN B;  3LK4 1;  4FRT A;  3SY7 A;  1GFQ A;  5AFU K;  3AA0 B;  4FOZ A;  4FMS A;  3SZD A;  2KZ7 B;  3LK3 A;  4LSF A;  2XE3 A;  2XMX A;  2KXP A;  4FZM A;  4FUV A;  3C5O A;  4AZL A;  4FRX A;  4D64 A;  1QJ8 A;  2Y0L A;  4AYE C;  1IZN A;  2J4U P;  4JFB A;  1HXT A;  1E54 A;  4KR8 A;  3V8U A;  3NSG A;  3AA1 A;  4G75 A;  2ZFG A;  4XNK A;  3LK4 2;  5GV0 A;  3AAA A;  3WI5 A;  4G76 A;  3GP6 A;  4AYN A;  1PRN A;  1HXX A;  3WI4 A;  4XNL A;  2YPV A;  2W81 C;  1YS5 A;  1ZHT A;  3AAE B;  4O3X B;  1MM5 A;  2XTR A;  3AA6 A;  3POQ A;  4RL9 A;  3G7G A;  4AYI D;  2K0L A;  4O4U A;  1HXU A;  3KVD D;  4BUM X;  4E1S A;  1OSM A;  2XE1 A;  5IYU A;  2X27 X;  2Y0K A;  4RJX A;  3JTY A;  4LSE A;  4GCS A;  2LHF A;  4AKR A;  4AKR B;  2FGQ X;  3VY9 X;  4AUI A;  4C69 X;  5G26 A;  2LFU A;  2FGR A;  2MHL A;  3UAQ A;  7PRN A;  1MPF A;  2XG6 A;  2Y7S A;  3SY9 A;  4D65 A;  3DA4 A;  4F4B A;  5EE2 A;  5T5F A;  4D5U A;  3AA7 A;  3AA1 B;  1PHO A;  1OPF A;  4FSP A;  3QRC A;  1ZHX A;  4O4X A;  5DL6 A;  1BT9 A;  2KC0 A;  1GFO A;  1THQ A;  2W80 C;  5DL7 A;  3SYS A;  4FT6 A;  3VE1 A;  2XE5 A;  3VZW X;  2KXP B;  3AA6 B;  1ZHY A;  3A2S X;  3LK3 B;  1H6S 1;  2OMF A;  2KDY A;  3AAE A;  2F1T A;  3POU A;  3FYX A;  3AA0 A;  2F1V A;  4FSO A;  2O4V A;  3QRA A;  4RLC A;  4AKM A;  3PRN A;  4KRA A;  3VZU X;  2Y2X A;  3T24 A;  5PRN A;  4AFK A;  2N2M A;  1Q9F A;  2M06 A;  2ODJ A;  3AA7 B;  4GCQ A;  3AAA B;  2J1N A;  4LSI A;  3T0S A;  1BH3 A;  4Z3T A;  5DL8 A;  2ZLD A;  4AYM C;  3SZV A;  4O3W A;  3POX A;  1GFM A;  1P4T A;  3TZG A;  4AYD C;  4RJW A;  4B61 A;  4GF4 A;  1GFN A;  1QJ9 A;  2MNH A;  2POR A;  3LK2 A;  2QTK A;  2KZ7 A;  3O0E A;  1ZHZ A;  4LSH A;  2ERV A;  2M07 A;  2N2L A;  1MM4 A;  6PRN A;  4QQ1 A;  3DA3 A;  2XTQ A;  3UU2 A;  3VY8 X;  5JDP A;  2JMM A;  2Y0H A;  4O3Z A;  4E1T A;  3HOE A;  3EMN X;  4FZN A;  4PUX A;  5ADX K;  4O49 A;  4JCH A;  3RBH A;  3POR A;  4FES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...