4FZMA

Crystal structure of the bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzmA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzmA02
2XTRA 2XTQA 2XMXA 3DA4A 4G75A 4N59A 4FZLA 3DA3A 4G76A 4FZNA 4N58A 4FZMA
chains in the Genus database with same CATH superfamily
3KHRA 3HP6A 2PFOA 3EPIA 1XNSA 2W9AA 1U9LA 4DOBA 5CB1A 2KD1A 4ED1A 4ED6A 2BDUA 2AQ0A 4P0QB 3TANA 2HSZA 5KTQA 3RB6A 5JDPA 2AXTU 2FLLA 4YR3A 5AM2A 1ZD4A 3AAAA 2W03A 3M8SA 1SV0A 4Z6CA 5KG5A 3RH4A 2NYVA 3KHLA 2ISOA 1L6NA 4QZDA 3CYMA 4BJQA 1N5XA 5HR6A 1F0MA 5DDYA 3C2LA 5KFIA 4KLOA 5AKXA 4F92B 2ALZA 5HHIA 3F5AA 3AN1A 5ALIA 3PORA 4C4SA 4JV1A 5K4LA 1L8LA 4F91B 3QU7A 2G5HB 9ICFA 4N58A 5C0YA 3AEVA 4F8RA 4AUIA 2D3DA 2ZIXA 5DQGA 4M9NA 2ASJA 4J9KA 2OYYA 1MN8A 4XA5A 1ZQCA 4NLZA 2KSOB 5DG7A 2PXIA 5J2GA 4D5UA 2IOHA 3LYSA 9ICMA 4J9LA 5EE2A 4B61A 2ZIUA 2IOFK 5AKYA 4GFJA 2FPMA 1NJXA 4Q8EA 1S77D 1CEZA 3ISDA 3QX7A 5AFUL 2KFNA 2DKXA 3KOOA 1X9XA 2FGQX 5AIAA 2F1IA 4QZ9A 3QUQA 2AH5A 4C8MA 3J81j 5CRXA 9ICKA 2JGAA 9ICCA 4USAA 5AHXA 5AK5A 4XNKA 2J1NA 1MQ2A 3MR3A 1CI4A 1X9MA 2DKZA 3ZDBA 4OJ6A 3D2SA 2MHLA 5ALGA 4A8EA 5AKHA 4J9PA 4CNQA 4KX5A 4FBUA 2HOIA 2Y0HA 4OO1J 1QH9A 3AQFA 4QZIA 1SXDA 3SAFA 5KT7A 2UVRA 3PX0A 1GFPA 3SV4A 4QW8A 1K1QA 1FIQA 4Y2JA 3UU2A 4UB1A 2KSOA 4PZNA 4BX9C 2B0CA 3RAQA 3T0SA 4AP9A 1XC9A 3KTQA 2UVVA 4RQNA 3NGDA 4R64A 4JMUA 3NASA 2HVHA 2ZIXB 3A0HU 4UB8O 4YD1A 5HHHA 5J0OA 2BCUA 3PW5A 1Y88A 2WJRA 4Y2YA 4TQSA 3PY8A 3V6HA 3PF1A 1RZTA 2F8KA 2FJ6A 5F9LA 5HR7A 1Z00A 4JK1A 4GHBA 3T5LA 3B9JA 3OJSA 1NJZA 4FUVA 4DWIA 1XSLA 2R4NA 5ALHA 1RXWA 2C2RA 1IZNB 1X66A 4Z6FA 5J0UA 4I27A 6PRNA 1L3UA 5EE1A 4P4PA 1V38A 4AYMC 5G38A 3PSPA 1S0NA 5D46A 1QLNA 1E54A 4RPXA 4QWAA 5KFAA 1T3QA 3MBYA 5KFQA 2HHVA 4TUPA 2M07A 4OCZA 8ICFA 7ICSA 1A76A 2OXOA 5AM3A 3M6ZA 2FMSA 4KMUA 4ED7A 3L3FX 1EXNA 2LFUA 8ICPA 2M06A 3G7GA 2QARA 4F4YA 3TAPA 4OJOA 2BQ3A 2EZXA 2K8BB 3NJTA 3T20A 3IG8A 2JXJA 1Z4NA 2ZIWB 5KAFO 4I2IA 4ECUA 4KLLA 3JCUO 1KTQA 2IMWP 4FSPA 4Z6DA 4EENA 2W81C 1B0XA 2P35A 5J0RA 4JB3A 4FRXA 1QSLA 5KT3A 3M9OB 2A3VA 2ZIUB 2W80C 4RQ8A 3HRDD 4J9RA 3IP4B 2AJQA 4DSEA 4O9MA 3PW0A 1T16A 2ODJA 4M9HA 7ICMA 4KLIA 2R89A 5ALPA 2BHNA 3FC4A 7ICQA 4UATA 3V8UA 3RBHA 2XICA 3N97B 3VZTX 1T94A 3D2NA 4C4VA 9ICVA 2EZZA 3O0FA 3C2KA 1B43A 4EYHB 3SYBA 2KXPB 5KFJA 5KG6A 3SMVA 5ALVA 3H8JA 4P0PB 1MM5A 2WJQA 3GU3A 2BCSA 4AFKA 4OD0A 1BPEA 1DGSA 2YMLA 3BQTA 4R65A 2KICA 4FSOA 5KFDA 2N1RA 2HMXA 3LWMA 3IDWA 9ICRA 3C23A 2F1VA 3I1YA 1JX4A 3MDCA 3IN5A 3KHHA 5J2DA 1WWVA 5DLGA 3ZDDA 5PRNA 4Y2PA 2L5YA 5KFPA 2BZFA 3RH6A 3F53A 4K4IA 1BXWA 1QTMA 2BCVA 3RAXA 3F5EA 4P4MA 1SKSA 4P0QA 2A19A 5KFWA 2ZUDA 2FI1A 2XTRA 3LVWA 5J0QA 1URJA 4B9NA 5DQIA 1N48A 5AM1A 2G5IB 2HHTA 3V7KA 3LK3B 1JXLA 4OJLA 2WF5A 5ALLA 5CHGA 5AM0A 4DLGA 4DL2A 4PHAA 1S10A 1QCKA 2DUYA 1XSPA 8ICOA 1Q9GA 2ZLDA 1N60A 4KLGA 1IIPA 5KT6A 2OCEA 4Q44A 2EH9A 3RR7A 5TZVA 4FO6A 3NVZA 5EE9A 1BPBA 2D8CA 2LKYA 2OEHA 2KZZA 3OTQA 5CEHA 1G90A 4IC9A 3ZDAA 3HT3A 4FESA 2PMZF 2NO4A 1TAUA 2VKQA 4MF8A 3FYXA 4ECRA 2LMRA 2JMMA 9ICJA 1Q8KA 2NRVA 2KHVA 1VLBA 2KOBA 7ICIA 3B0XA 3JPTA 3AA1A 4BWMA 1GFQA 1NK8A 2WB1F 3UM9A 1AQ6A 2FPKA 2R8AA 4FT6A 3TADA 3ALRA 4IR9A 3M8RA 3LWLA 1DRGA 2KVSA 1OPFA 3PVXA 3T24A 3EUB2 1K1SA 2F1HA 5CA7A 1SB3C 1ZQNA 8ICWA 7ICUA 2JZBA 1VDVA 1X9WA 2XCAA 4RT3A 5CWRA 3KFUF 5AM5A 4YR2A 4RPZA 5AFUK 3MABA 2QLTA 1KKXA 3QRAA 2AU0A 4DSJA 2Y0SF 3SD7A 8ICQA 2RHFA 5KFHA 2OH2A 4BGDA 4LJXA 3BQ2A 4NWIA 4ED2A 1A77A 3AAEB 4RJXA 2R4PA 1B4FA 2AHOB 2ES6A 3MFHA 1KQQA 3GP6A 5IYUA 2KTQA 1JXEA 3RJKA 4CCHA 2XMXA 3E2EA 4PL2A 1F44A 4F4BA 5ALQA 5KFUA 2KJ8A 1Z4OA 3QEAZ 4JUZA 1JALA 5ADXK 2GOLA 2ASLA 2PI5A 1THQA 5JU5A 1UHUA 3WKDA 5AK3A 4MF2A 3OPXA 4I29A 3OJUA 3KZIU 3H4BA 1IG6A 3QE9Y 5KFXA 3MGHA 4C00A 2K4IA 1XO0A 2BPFA 5EE0A 5ALXA 1ZQRA 1ZHZA 5J2BA 3D2QA 1N62A 1S5LO 1DOQA 4QNLA 3K4GA 4MHVA 3PGRA 5B5EO 2FPLA 5DGAA 2HOQA 2XI9A 1FFVA 3NVYA 5KL8B 5IINA 2A1JB 1KFDA 2KMDA 3H40A 4YFKA 1PK1B 2QKQA 4F2RA 7ICHA 3AA1B 2KE7A 3WK6A 4XRHA 3AM9A 2JEGA 2I9GA 5EOZA 4DLEA 5DB6A 4CE6A 5AICA 3V6KA 2AQ4A 2W9CB 2W7OA 2ZIVA 3IRUA 1Z19A 1D8YA 4KTQA 4UB6U 5KFMA 9ICOA 5J2HA 5KFLA 2WF8A 3C28A 1J2NA 2FMPA 4RUCA 4LSHA 3SZDA 1MQ3A 3AA7A 1NKCA 1BH3A 3M7DA 4QWEA 3EZ5A 4O0IA 4R63A 4RQ0A 1ZQPA 1CRXA 3AQEA 1X6IA 2VA8A 2JQYA 3QU2A 2H3QA 3BS7A 3SR6A 2O4VA 1SL0A 4ED8A 5G3AA 4RQ3A 1RM6C 4DQQA 2NRWA 7ICPA 3JPPA 3TQ1A 1S0MA 2HHXA 3WK4A 4I2HA 3LDAA 3PW7A 9ICAA 5EWEA 2W11A 2DL0A 1NJYA 4QZGA 3RB0A 2K4EA 3WKBA 1YZ6A 4F50A 2NO5A 3VCBA 4QIWF 1DGJA 1S8OA 4BUGA 1HXUA 3BZCA 2XE5A 7ICVA 4B9SA 4O3PA 3L5KA 3WKAA 1BVSA 4C7ZA 1SZHA 3CP8A 2BCRA 5IIJA 4KRAA 4KLJA 5KG1A 4ECSA 2W54A 3QXGA 5ALEA 3UAQA 3N7RC 1NNLA 5DL8A 1RYSA 2W3RA 2ZJ5A 2ATLA 1F5SA 3DA4A 4PR7A 2BDPA 5KFRA 2HW3A 2NRXA 4UAUA 1O08A 5KT5A 2R18A 5DG9A 5KNIA 1KDHA 4F5RA 5AI4A 4NJ8A 2E8NA 1SV4A 4GLXA 5T5FA 4PHPA 3DDHA 1ZQEA 2G09A 3WK7A 1LVHA 1WYGA 2WF6A 3HWTA 5HMMA 4YXJA 1KLNA 3K1RB 5KFCA 2HHQA 1D8BA 2KG5A 5AI0A 5J0YA 5AI6A 4Y2UA 5GTHU 4DFMA 3QNMA 4I2CA 2EANA 2V9WA 5KG3A 2WB1C 2QARB 4BDPA 5TISO 4D64A 2ISPA 4IR1A 2K4PA 3AA0B 2PORA 4AYBF 3SEIA 4KLTA 5AI8A 1TFRA 3C1ZA 3F2BA 1OSMA 4PZOA 2Y0KA 4AYBC 1ZQBA 4ECVA 2LYAA 5CP2A 3ZDEA 3UXNA 5DBCA 2XY6A 2LYBA 1TVAA 2K8CB 2Z7JA 4ACOA 2LHTA 3PV8A 2KZ3A 4NLBA 4RU9A 3PMLA 1CUKA 3BRZA 4MEXA 3OSPA 4ELVA 5DKWA 2H3FA 1IZNA 3MC1A 1ZQXA 4FMSA 2KEYA 5JUMA 3JPRA 1ZXIA 2R8GA 3PO4A 4FRTA 1A6SA 1SGGA 4DS4A 2FDRA 5ALRA 5J2JA 1ZQSA 3QUCA 3FDSA 3UXOA 2UVWA 8ICUA 3POXA 4QQ1A 1RG6A 5KFFA 2XC9A 5G39A 4QZEA 3B0YA 3UPQA 3SY9A 1RXVA 3GV7B 3O0EA 5AKKA 4BXOA 2FMQA 3E58A 3EYZA 3A0BU 1L5UA 3MGVA 4NLKA 1H38A 2DF4B 2BCQA 4M9GA 1ECWA 1QJ8A 4DFPA 3LK9A 1PVQA 1S0OA 3GIKA 4UAYA 2O6KA 4DFDA 2JEFA 1U47A 1MSWD 3FYHA 2HHUA 2R8KA 4DSIA 2KFZA 4XQ8A 3WK5A 4QZFA 4DOAA 2LM4A 2WAQC 4F4ZA 2E8OA 4F4KA 5KFEA 4DL4A 4PJ0O 9ICQA 4JV0A 4AYNA 4UAZA 3N7SC 4X5VA 1OUQA 3HX0A 5KFNA 4YMOA 2MU2A 4YP3A 3CRXA 4ICAA 9ICHA 2LM1A 7ICRA 3FM9A 5KL1B 1ZHYA 3HW9A 3PX6A 3ISBA 1HEKA 2Y1JA 1WCLA 4QZCA 5DGBA 3RR8A 4YN4A 1D9DA 4EZ6A 2VANA 1U49A 4D65A 2ODGA 3KZXA 5ALSA 3IM1A 3PZPA 4IL6O 4RLCA 2J6UA 1NKBA 3T5KA 3JPQA 2I6XA 2HVIA 3WKCA 4O49A 4FZNA 4DSLA 3HKZC 2X27X 4NLCA 3JPOA 4I2JA 4GXKA 3TFRA 4ELTA 5J0WA 4MFFA 3QYPA 4JV2A 5AI5A 4B9LA 4C8KA 2M0NA 4EBEA 3WK8A 4DFKA 4AYDC 8ICKA 2IBKA 2CRXA 4RQ7A 4PHEA 1NK9A 4PL1A 1NK5A 1QQ7A 4DF4A 4O5EA 3PW2A 7ICOA 3RRHA 4B6JA 4TUSA 1LKYA 4I28A 7ICJA 4UB6O 1HUOA 5ALNA 4LZDA 2Y0LA 5BOMA 4Q43A 3SZ2A 2EAOA 3C5GA 2RP5A 3WI4A 2OMFA 3SZVA 3AU2A 5DLFA 3PGUA 4B9TA 3G6VA 4ELUA 1LB2B 4UB5A 1L7OA 4I2AA 3H0RB 4TUQA 2FLPA 3VZWX 4YXMA 4DQPA 2KZ7A 2WVPA 5FVNA 5G5GA 4EEKA 3BS0A 2K0LA 7ICEA 3UPGA 1IV8A 8ICLA 1P7DA 4GF4A 2K60A 1ZQ1C 1YS5A 2R4OA 4EZ9A 2ZJ8A 4KMOB 1Q3VA 3KHGA 3QRCA 5J2EA 8ICBA 4IQTA 3AAAB 3ISCA 4RQ2A 2EQYA 2Y7SA 2RQ5A 4US9A 3PW4A 5JRTA 3RJEA 4IQWA 5ALZA 5DBAA 3THVA 2F1TA 5IILA 3C21A 2F76X 1TAQA 2F1CX 2JH7A 2AXTO 4UAWA 2R4LA 4O3WA 5EWGA 3POQA 2P6UA 3QUTA 4B9MA 2JR5A 3SY7A 2MRLA 1ZQIA 1KW4A 3SQIA 9ICSA 8ICCA 2ESEA 4ED3A 3RH5A 1NZPA 5H2FO 5J2KA 1ZQJA 1SXEA 1X40A 3PSFA 1KBUA 4RNMA 3IHQB 2C28A 3HOLA 2DBYA 4AZLA 4J9OA 1AROP 5KFBA 4J9MA 4B9UA 4I2BA 1X6JA 4M6WB 3EMNX 5FP0A 4RNOA 4EBDA 3NTUA 2BPCA 3AU6A 5L1KA 3POUA 2HCFA 2B21A 1TAMA 1BPXA 4U6PA 4CDGA 3ZD9A 5DQHA 5DB7A 4NLGA 5F3XB 3OHBA 2ERVA 1PUZA 4C0ZA 3C2MA 3RJIA 4PGXA 1PVPA 1XWLA 2D6FC 4DEZA 4NL9A 5DL5A 4IRDA 2R8JA 2W9BA 5JTIA 1ZD5A 4EX6A 2JEJA 3RJGA 4C4TA 4G75A 4ECTA 4UASA 9ICLA 2XTQA 2IWWA 2DGZA 2ZXHA 5BOLA 1SWWA 1ZRNA 4XNLA 3VY9X 5DDMA 1RDFA 5AKEA 4QZBA 4ECQA 2KHQA 2C2DA 1L3TA 4QZ8A 2F77X 4IS7A 4Q45A 1MA7A 4NM1A 1T1LA 1D8LA 3GDXA 3V7LA 4F71A 1BPYA 3HPOA 2JRZA 1ZQAA 3QZ7A 4QWBA 3PMNA 5DL6A 4IRCA 4M9LA 4AYID 5IIKA 3SENA 4N59A 2E3TA 2EDUA 3RFAA 3Q8RB 4CTDA 2HHSA 5E79U 2WHEA 3KD3A 3DWNA 2QB0B 1JRPA 2F3NA 4DL5A 1ZQGA 2MUTB 3N28A 3H8MA 3S6JA 5AM4A 4YQWA 5CJ7A 1COKA 2KC0A 4C8OA 1KL9A 2M9NA 2V4QA 4J9NA 5KAFU 5J0XA 4I2DA 4PGYA 2DFLA 3C5FA 5KG2A 1MC8A 4QZHA 2XE2A 2KN7A 4TQRA 4UB3A 4O3SA 2PMZC 5ALOA 3H8SA 4AKRB 3PO5A 4Y2TA 5G26A 1TV9A 2N2LA 4M6WA 3TADC 5KFGA 3SI8A 4AKRA 1UPHA 4WJ3B 1GFMA 2LI6A 4LSEA 4QW9A 4EBCA 2J6TA 5B66U 4KLMA 3ZI4A 4QZAA 1UCVA 3TACB 5IIMA 8ICXA 2DQNB 1Z1BA 2N2MA 1UT5A 4U7CA 1O03A 3MGIA 1T8EA 4M0AA 1PZNA 3ETLA 4EEYA 9ICIA 2Q4TA 4O3NA 1D9FA 2CXYA 4UQGA 3BJYA 4DOCA 5J8YC 2MNHA 8ICMA 1RQLA 1HIWA 1ZYQA 1SV0C 3LK2A 5KG0A 4DF8A 4ECZA 4OJ5A 1UQVA 5DB9A 5J29A 7PRNA 3GIMA 4KLUA 4FQEA 4BUMX 4FZMA 4DQSA 2YNKA 4DL3A 2ZTEA 2ZTDA 1ZD3A 1N2XA 2VJ5A 4F5PA 1B22A 2W9MA 4FS1A 1SL2A 1HJPA 2YX8A 1LV5A 4RNNA 4F5QA 3ORYA 3DWOX 2W7PA 2R8HA 2G07A 1SKRA 3EWAA 1X42A 1TK5A 3G6YA 3WI5A 1TKDA 7ICNA 3TI0A 2R8IA 4RQ1A 5D5DA 1NJWA 2JH1A 5HNKA 2KKVA 2EAPA 1QJ9A 3BQ0A 2Y9UA 5KFTA 4PUXA 2G08A 2YY6A 2V4RA 8ICGA 1ZQUA 4DCCA 5J2IA 4KLQA 4YVZA 2Q0ZX 2KZ7B 4PH5A 2J6SA 4DFJA 4FFDA 1S76D 1XO1A 7ICFA 2W9BB 1UT8A 3F2DA 4J03A 1DK2A 1ZQQA 2W8LA 1SIJA 3MFIA 4P0PA 2KXPA 1QSYA 1T4GA 5ALKA 3UQ0A 2A1AA 1XSNA 4DS5A 8ICJA 3PR5B 3TFSA 5KT4A 4FOZA 3NSGA 2ZG6A 1S9FA 4IL6U 3Q8SB 5F9NA 1DK3A 2WF9A 2YMQA 4KN4A 2H3ZA 3PNCA 3TARA 4NL9C 7ICKA 3L4PA 4MFAA 1PK3A 3JPSA 4LVSA 1PVRA 2F1JA 5ALJA 4UB2A 5ALWA 2E1FA 4M2YA 3PSTA 2VA2A 4Y2XA 3ED5A 4XUSA 2YMPA 9ICWA 1BNPA 2E5SA 2XE1A 3AA6B 2QTKA 4DL6A 3BZKA 5D49A 4CGZA 4RLBA 2J4UP 1ZRMA 2RLTA 4J9SA 2KKPA 3TZGA 2ZIWA 4RQMA 4GC6A 3PQUA 2K4HA 1J97A 4GXJA 4KLFA 1T3NA 4ZH4A 4JCHA 5KAIO 1BPDA 2GE4A 1S5LU 2YMMA 5KT2A 1HUZA 2QB1A 4Z6EA 8ICIA 1GFOA 4Z3TA 1U48A 4KX3A 4C4RA 2E1EA 4O3OA 3QU4A 1A0PA 2K4TA 2BQUA 4Y2VA 8ICYA 1WCNA 4J9QA 2HBMA 5CR0A 3K19A 1ZETA 4YR0A 3HOEA 4PPXA 5ALFA 1WWUA 4KLDA 5EE3A 1RYUA 4RQ5A 2KK0A 1ED1A 9ICEA 4U9CA 1ZQHA 3U26A 1ORMA 4FZLA 2KZMA 1L3VA 1RPLA 2RDIA 2E8PA 1Z00B 5KFSA 2DPIA 3N4MB 1BGXT 1KFSA 4YCXA 2IA6A 5J0TA 1NI3A 3KBBA 3RBDA 2EAMA 1FO4A 2LBOA 4RT2A 5DL7A 1BNOA 3RRGA 1ZQDA 5L9XA 3GFKB 4CF4A 2NV3A 3Q8KA 5AKGA 5D4BA 9ICBA 5C5JA 2MA1A 1LKYB 1N56A 2YPVA 2FGRA 2KP7A 4LSFA 2Y9TA 2VIXA 2KVCA 4RPYA 3Q8PB 3K1ZA 2XO7A 1JN3A 2JV3A 2P66A 2PFQA 2FLNA 4UBCA 3NRZA 4O4XA 7ICTA 3Q8LA 2I5HA 5GTHO 5HMLA 3VE1A 2WTFA 3VZUX 2YQEA 4GCSA 2ZXIA 3GQCA 1WUDA 4O3RA 4MEYA 5ALUA 8ICHA 3H7IA 3KZIO 2BPGA 2IHNA 4QJFB 4GIBA 5DG8A 2PKEA 5ALDA 1QQ6A 4M04A 4DL7A 3KVDD 4NXZA 4C8NA 3GIIA 5A0LA 3NUQA 3M9MB 1UA0A 4I2FA 3AA0A 2RDJA 5GV0A 3G6XA 4KN7A 1BT9A 1RQNA 4G9BA 5ALMA 2KIWA 3FAHA 4F4XA 4I2EA 3RJHA 1N5WA 2ZTCA 3LVVA 1V97A 4EX7A 1L7NA 1ZQLA 2HHWA 4EYIB 5J8YA 3V7JA 1PRNA 3BQ1A 4BWJA 1NK7A 2P6RA 3PX4A 3HW8A 4YD2A 3BQ7A 4C69X 1KRPA 4UARA 5L1JA 3EPGA 4Q8FA 2H3VA 3IG5A 4CF5A 3Q8MA 2G0AA 4QWCA 3A2SX 4UB4A 1ZQOA 3SAHA 5KFZA 1MM4A 4JWMA 4NY8A 3GILA 3OSNA 2IWVA 5DBBA 2UVUA 2AGOA 1L7PA 4GC7A 4O3ZA 2OM6A 2FE9A 4IRKA 1OW5A 4BXOB 2X9KA 1ZHTA 5AKLA 4E0DA 2C22A 4PJ0U 5GTIO 3T5JA 5BPCA 1YT3A 3I28A 1JIHA 2F44A 1UA1A 1ZQMA 2W3SA 3C29A 4O3QA 2XY5A 2BQRA 3DV9A 2RRDA 4M9JA 4FBTA 2F2AB 3PR4A 4LSIA 2IOFA 2YB1A 2R88A 4NLNA 8ICRA 1X2IA 1ZQWA 1ZHWA 3HJEA 1V9PA 3PSIA 1KN5A 1NK4A 1XS9D 2PFNA 1Z1VA 4C7YA 1JMSA 3CNHA 5J2FA 1V85A 9ICUA 4DSKA 4AKMA 4NM2A 3GIJA 3MR6A 2Y2XA 3Q8QB 3SYSA 4Y2QA 2XVTA 9ICPA 3PRNA 2HBLA 1H6S1 3GZFA 2Y0SC 3AMZA 2IHMA 4GCQA 4HAIA 3D6JA 4N75A 3AA6A 4RQ6A 3ICXA 3GV8B 2XG6A 5KG4A 3WU2O 1SWVA 3H0MB 1TK8A 4GXIA 5AK4A 4KITB 4PGQA 5IIOA 8ICVA 5AIBA 1NZBA 3PQSA 2B6GA 1TK0A 3WK9A 4RUAA 2YN4A 2ZUCA 4KLSA 4F93B 1QJPA 4CRXA 3M6KA 2NRTA 5KG7A 4PHDA 4OJPA 3ZDCA 4Y2SA 1ZQTA 2WAQF 2DWQA 7ICGA 1N63A 5ALTA 4R8UA 2JMGA 4ECXA 1U45A 4YMMA 1N61A 1M6YA 2ASDA 1NOMA 3T3FA 3C1YA 3ETRA 4F72A 2DPJA 2A1JA 3KKAA 2GWSA 1JI7A 4C80A 2G06A 3UMCA 1Q3UA 5L1MA 1QQ5A 3QU5A 4RZRA 5AKZA 1COOA 2WF7A 3RBEA 7ICLA 2VA3A 1ZQZA 4UAVA 1RYRA 2GH1A 9ICGA 3F2CA 4DO9A 1JROA 2BKEA 2XY7A 2HI0A 5B66O 2OHFA 4F2SA 1GFNA 4MFCA 3H8WA 3RJFA 2WFAA 4QWDA 3MR2A 2AGQA 5KAIU 2I1QA 4E1TA 1ZQFA 3CW2C 1IM4A 3DEEA 3OHAA 2LPEA 3H0LB 5AK6A 3LK42 1MPFA 4UB8U 3PGSA 3AL0B 3GV5B 1KEJA 4RJWA 3RF9A 4F4WA 3I76A 1WG8A 3UQ2A 9ICNA 3VC8A 2KJ5A 1ZQVA 4LZGA 2XCPA 4F3OA 2H3IA 2MSNA 1U4BA 1BPZA 3LK2B 3E0FA 2LYHA 4O3YA 3AAEA 1L8OA 8ICNA 4K3BA 4ED0A 5J0PA 3HWBA 1L3SA 5KFYA 2PRNA 2ZFGA 4M47A 4RL9A 5T14A 3EW9A 5TISU 4EELA 8ICSA 4AYEC 3RTVA 3BS5B 3AA7B 3BRYA 4DSFA 2PFPA 5L1LA 1NK6A 1FFUA 3UMGA 1SKWA 3A0BO 4IQUA 4O5KA 5EWFA 1ZQYA 5DB8A 2ZIVB 1IXRA 4FE3A 4P4OA 1PHOA 2Y1IA 4ZOHC 3ZD8A 2EZYA 2W9CA 3ONNA 4DQIA 3V72A 2JEIA 1C7YA 1S97A 1Q9FA 4O4UA 2PI4A 8PRNA 3NRWA 2KV2A 3V6JA 3NVVA 4CF3A 2XGQA 1ZJMA 3VY8X 1PK1A 1JUDA 5HP4A 1HXXA 3QZ8A 1K5OA 5IIIA 2GO7A 1YZ7A 3UMBA 1L7MA 3IV6A 3M1YA 1ZOLA 4YG2A 3T5HA 1XU4A 4O3XB 3HKZF 4JFBA 2BR0A 1ZJNA 3A0HO 2CPRA 4F5NA 2LHFA 2CN1A 5AKIA 4KR8A 3R9KA 4UBBA 1GO3F 3BS5A 1ZQKA 4IQVA 4TURA 9ICTA 2MUTA 3K75D 1HXTA 2QB0A 4R66A 3AUOA 2W55A 1FEZA 4US8A 2VJ4A 4QIWC 3SAGA 2XGPA 4P2HA 2JHDA 5B5EU 5ADXL 3T79A 3MDAA 4K4GA 4YMNA 3MR5A 4G3IA 5E79O 1KSPA 2OWOA 1SL1A 1X9SA 4O3MA 3OGUA 4DQRA 5KFVA 5J2CA 4NV0A 3RB4A 2XIDA 2KJ9A 2HBJA 2F8LA 1SZPA 3HILA 5KFOA 2W8KA 1C20A 3N7PD 2ZJAA 5H2FU 4G76A 5L1IA 2W43A 1S0VA 2GLEA 1DXSA 4E1SA 3RB3A 4UW9A 3SYZA 2ZUBA 2W04A 1Z3EB 1Q46A 1TE2A 8ICTA 4O5CA 4HYKA 2YB4A 2E8MA 2BGWA 3DA3A 2MAXA 3BDPA 3DZMA 5G5HA 2JZBB 2K89A 1ZD2P 1T7PA 4JWNA 8ICAA 3QEBZ 4F5OA 2C2EA 4C8LA 4KLHA 3SV3A 2YTUA 3VE2A 4C4VB 1QSSA 3C5OA 2KDYA 3TKAA 1J2MA 2AGPA 5GTIU 3WKEA 4KR4A 9ICXA 4ECWA 2H5XA 5J0SA 3KKAC 3JPNA 3RJJA 4KLEA 3JTYA 5AKJA 3UXPA 1KFTA 3LK41 4GCPA 2K8AA 4FS2A 1ZHXA 4R8UB 4N74A 2NRZA 2HOFA 2KIVA 2KNJA 4RQ4A 3QU9A 1NK0A 2HBKA 4K3CA 2HDOA 3H4DA 3NVWA 4K4HA 3QUBA 5ALYA 1NKEA 1P4TA 8ICZA 4Y2RA 3WU2U 1VJ5A 1OXJA 3TAQA 3NS1A 8ICEA 2XE3A 4I2GA 3LK3A 5KFKA 5AI9A 4B9VA 3M9NB 5J2AA 4ECYA
chains in the Genus database with same CATH topology
3GP6A 4QJFB 2F1TA 5IYUA 1XNSA 3KVDD 5A0LA 2F76X 2XMXA 4PL2A 1F44A 4F4BA 3NUQA 2JH7A 2KJ8A 4O3WA 3AA0A 2KD1A 3POQA 2BDUA 4P0QB 5GV0A 1BT9A 3SY7A 5ADXK 5JDPA 2GOLA 2MRLA 2KIWA 1THQA 3AAAA 2W03A 3SQIA 3OPXA 3LVVA 3PSFA 1KBUA 1PRNA 1L6NA 3CYMA 2K4IA 1XO0A 4BJQA 5HR6A 3HOLA 4C69X 1ZHZA 3D2QA 4AZLA 2H3VA 3IG5A 3A2SX 2G0AA 4QNLA 3SAHA 1MM4A 2HOQA 2XI9A 3F5AA 3EMNX 3PORA 5KL8B 3POUA 2G5HB 4N58A 1TAMA 4U6PA 3AA1B 4CDGA 4O3ZA 5C0YA 2OM6A 4AUIA 2ZIXA 2ERVA 4C0ZA 1ZHTA 2OYYA 1PVPA 1YT3A 2D6FC 5DL5A 2W7OA 3C29A 2ZIVA 4D5UA 1Z19A 4G75A 2RRDA 2XTQA 2F2AB 2DGZA 3LYSA 3C28A 4LSHA 3SZDA 2ZXHA 4LSIA 5EE2A 4B61A 4XNLA 2ZIUA 2YB1A 4GFJA 3AA7A 3VY9X 1BH3A 3M7DA 2KHQA 1ZHWA 2F77X 5AFUL 3PSIA 1MA7A 1CRXA 2FGQX 3AQEA 4AKMA 2Y2XA 5DL6A 5CRXA 4AYID 2H3QA 2JGAA 2O4VA 3SYSA 4XNKA 2XVTA 4N59A 3PRNA 2J1NA 2HBLA 1H6S1 3RFAA 3GZFA 2Y0SC 4OJ6A 4GCQA 3D2SA 3AA6A 2MHLA 4A8EA 3ICXA 2XG6A 3H0MB 4KX5A 2HOIA 2Y0HA 4OO1J 2K4EA 2KC0A 3AQFA 3VCBA 3SAFA 4QIWF 1HXUA 4BUGA 1NZBA 3PQSA 1GFPA 2XE5A 1QJPA 4CRXA 3UU2A 3M6KA 1SZHA 3CP8A 4OJPA 4KRAA 4BX9C 2WAQF 3T0SA 3UAQA 4JMUA 3N7RC 5DL8A 2XE2A 2ZIXB 2JMGA 3DA4A 2PMZC 4AKRB 2R18A 5G26A 2N2LA 2G06A 1Q3UA 4AKRA 1UPHA 5HR7A 5T5FA 4WJ3B 1GFMA 4GHBA 4LSEA 4FUVA 2G09A 2GH1A 3F2CA 2DQNB 1Z1BA 1IZNB 2N2MA 6PRNA 4U7CA 4AYMC 1GFNA 3PSPA 1D8BA 2Q4TA 1E54A 2MNHA 1HIWA 4E1TA 3LK2A 4OJ5A 2WB1C 2M07A 3DEEA 7PRNA 4BUMX 4FZMA 4D64A 2YNKA 3H0LB 3AA0B 3LK42 2PORA 1MPFA 3AL0B 2OXOA 4AYBF 3M6ZA 4RJWA 2VJ5A 3RF9A 3L3FX 3F2BA 1OSMA 2YX8A 2LFUA 2Y0KA 3VC8A 2KJ5A 4AYBC 2M06A 3G7GA 4OJOA 2H3IA 2LYAA 2K8BB 2W7PA 3E0FA 2G07A 3LK2B 3T20A 3IG8A 4O3YA 3AAEA 2ZIWB 3WI5A 2LYBA 2K8CB 5D5DA 2Z7JA 2JH1A 3HWBA 2KKVA 4ACOA 2LHTA 1QJ9A 2PRNA 4FSPA 2ZFGA 4NLBA 4RL9A 5T14A 4PUXA 2G08A 2W81C 4FRXA 2H3FA 1IZNA 4AYEC 3AA7B 2A3VA 4FMSA 2KEYA 2ZIUB 2W80C 4FRTA 3IP4B 1A6SA 2KZ7B 2ODJA 2ZIVB 4FE3A 3F2DA 1PHOA 3POXA 3V8UA 4QQ1A 4P0PA 3RBHA 2XICA 3ONNA 2KXPA 1Q9FA 3VZTX 1T94A 4O4UA 3SY9A 3D2NA 3O0EA 8PRNA 3NRWA 2KV2A 3MGVA 3O0FA 4FOZA 3NSGA 3VY8X 2ZG6A 2DF4B 3SYBA 1HXXA 2KXPB 1ECWA 3SMVA 1QJ8A 4P0PB 1MM5A 1PVQA 3GU3A 2H3ZA 4O3XB 3HKZF 4AFKA 4JFBA 1PVRA 2CPRA 2LHFA 2CN1A 2WAQC 2KICA 4FSOA 2E1FA 4KR8A 3PSTA 2N1RA 2HMXA 1GO3F 4AYNA 3N7SC 1OUQA 2F1VA 2E5SA 2XE1A 3CRXA 1HXTA 4ICAA 3AA6B 3IN5A 2QTKA 4CGZA 4RLBA 2J4UP 5KL1B 5PRNA 1ZHYA 3HW9A 1HEKA 2KKPA 2VJ4A 3TZGA 3F53A 2ZIWA 4QIWC 3SAGA 1BXWA 3PQUA 2K4HA 2JHDA 3F5EA 4D65A 5ADXL 3KZXA 4P0QA 4JCHA 3T79A 3PZPA 2GE4A 4RLCA 1GFOA 2XTRA 4Z3TA 3LVWA 4O49A 1URJA 4KX3A 4FZNA 4O3MA 2E1EA 3HKZC 2X27X 1A0PA 2K4TA 4NLCA 4NV0A 2HBMA 2G5IB 3K19A 2XIDA 2KJ9A 2HBJA 2F8LA 3LK3B 3N7PD 4OJLA 3HOEA 4G76A 4E1SA 1Q9GA 2M0NA 2ZLDA 1IIPA 1ED1A 2W04A 4AYDC 2CRXA 2YB4A 4PL1A 3DA3A 4U9CA 2LKYA 1G90A 2K89A 4IC9A 1ORMA 4FESA 2PMZF 4FZLA 2VKQA 3FYXA 2JMMA 2KHVA 2KOBA 3VE2A 2Y0LA 3AA1A 1GFQA 3C5OA 2KDYA 2WB1F 2RP5A 2LBOA 3WI4A 2OMFA 4KR4A 5DL7A 3SZVA 4FT6A 3ALRA 3JTYA 1DRGA 2NV3A 3LK41 1OPFA 4GCPA 3H0RB 3VZWX 2K8AA 1ZHXA 3T24A 2HOFA 2KZ7A 5FVNA 2MA1A 2KNJA 2YPVA 2FGRA 2HBKA 2K0LA 4LSFA 3KFUF 2VIXA 5AFUK 3UPGA 2KVCA 3K1ZA 3QRAA 1P7DA 1P4TA 4GF4A 1ZQ1C 1YS5A 4KMOB 1Q3VA 4O4XA 2Y0SF 2RHFA 2OH2A 3QRCA 2XE3A 3AAAB 3VE1A 3VZUX 4NWIA 3AAEB 4RJXA 3LK3A 4GCSA 2ZXIA 2Y7SA 1WUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTR A;  2XTQ A;  2XMX A;  3DA4 A;  4G75 A;  4N59 A;  4FZL A;  3DA3 A;  4G76 A;  4FZN A;  4N58 A;  4FZM A; 
#chains in the Genus database with same CATH topology
 3KHR A;  3HP6 A;  2PFO A;  3EPI A;  1XNS A;  2W9A A;  1U9L A;  4DOB A;  5CB1 A;  2KD1 A;  4ED1 A;  4ED6 A;  2BDU A;  2AQ0 A;  4P0Q B;  3TAN A;  2HSZ A;  5KTQ A;  3RB6 A;  5JDP A;  2AXT U;  2FLL A;  4YR3 A;  5AM2 A;  1ZD4 A;  3AAA A;  2W03 A;  3M8S A;  1SV0 A;  4Z6C A;  5KG5 A;  3RH4 A;  2NYV A;  3KHL A;  2ISO A;  1L6N A;  4QZD A;  3CYM A;  4BJQ A;  1N5X A;  5HR6 A;  1F0M A;  5DDY A;  3C2L A;  5KFI A;  4KLO A;  5AKX A;  4F92 B;  2ALZ A;  5HHI A;  3F5A A;  3AN1 A;  5ALI A;  3POR A;  4C4S A;  4JV1 A;  5K4L A;  1L8L A;  4F91 B;  3QU7 A;  2G5H B;  9ICF A;  4N58 A;  5C0Y A;  3AEV A;  4F8R A;  4AUI A;  2D3D A;  2ZIX A;  5DQG A;  4M9N A;  2ASJ A;  4J9K A;  2OYY A;  1MN8 A;  4XA5 A;  1ZQC A;  4NLZ A;  2KSO B;  5DG7 A;  2PXI A;  5J2G A;  4D5U A;  2IOH A;  3LYS A;  9ICM A;  4J9L A;  5EE2 A;  4B61 A;  2ZIU A;  2IOF K;  5AKY A;  4GFJ A;  2FPM A;  1NJX A;  4Q8E A;  1S77 D;  1CEZ A;  3ISD A;  3QX7 A;  5AFU L;  2KFN A;  2DKX A;  3KOO A;  1X9X A;  2FGQ X;  5AIA A;  2F1I A;  4QZ9 A;  3QUQ A;  2AH5 A;  4C8M A;  3J81 j;  5CRX A;  9ICK A;  2JGA A;  9ICC A;  4USA A;  5AHX A;  5AK5 A;  4XNK A;  2J1N A;  1MQ2 A;  3MR3 A;  1CI4 A;  1X9M A;  2DKZ A;  3ZDB A;  4OJ6 A;  3D2S A;  2MHL A;  5ALG A;  4A8E A;  5AKH A;  4J9P A;  4CNQ A;  4KX5 A;  4FBU A;  2HOI A;  2Y0H A;  4OO1 J;  1QH9 A;  3AQF A;  4QZI A;  1SXD A;  3SAF A;  5KT7 A;  2UVR A;  3PX0 A;  1GFP A;  3SV4 A;  4QW8 A;  1K1Q A;  1FIQ A;  4Y2J A;  3UU2 A;  4UB1 A;  2KSO A;  4PZN A;  4BX9 C;  2B0C A;  3RAQ A;  3T0S A;  4AP9 A;  1XC9 A;  3KTQ A;  2UVV A;  4RQN A;  3NGD A;  4R64 A;  4JMU A;  3NAS A;  2HVH A;  2ZIX B;  3A0H U;  4UB8 O;  4YD1 A;  5HHH A;  5J0O A;  2BCU A;  3PW5 A;  1Y88 A;  2WJR A;  4Y2Y A;  4TQS A;  3PY8 A;  3V6H A;  3PF1 A;  1RZT A;  2F8K A;  2FJ6 A;  5F9L A;  5HR7 A;  1Z00 A;  4JK1 A;  4GHB A;  3T5L A;  3B9J A;  3OJS A;  1NJZ A;  4FUV A;  4DWI A;  1XSL A;  2R4N A;  5ALH A;  1RXW A;  2C2R A;  1IZN B;  1X66 A;  4Z6F A;  5J0U A;  4I27 A;  6PRN A;  1L3U A;  5EE1 A;  4P4P A;  1V38 A;  4AYM C;  5G38 A;  3PSP A;  1S0N A;  5D46 A;  1QLN A;  1E54 A;  4RPX A;  4QWA A;  5KFA A;  1T3Q A;  3MBY A;  5KFQ A;  2HHV A;  4TUP A;  2M07 A;  4OCZ A;  8ICF A;  7ICS A;  1A76 A;  2OXO A;  5AM3 A;  3M6Z A;  2FMS A;  4KMU A;  4ED7 A;  3L3F X;  1EXN A;  2LFU A;  8ICP A;  2M06 A;  3G7G A;  2QAR A;  4F4Y A;  3TAP A;  4OJO A;  2BQ3 A;  2EZX A;  2K8B B;  3NJT A;  3T20 A;  3IG8 A;  2JXJ A;  1Z4N A;  2ZIW B;  5KAF O;  4I2I A;  4ECU A;  4KLL A;  3JCU O;  1KTQ A;  2IMW P;  4FSP A;  4Z6D A;  4EEN A;  2W81 C;  1B0X A;  2P35 A;  5J0R A;  4JB3 A;  4FRX A;  1QSL A;  5KT3 A;  3M9O B;  2A3V A;  2ZIU B;  2W80 C;  4RQ8 A;  3HRD D;  4J9R A;  3IP4 B;  2AJQ A;  4DSE A;  4O9M A;  3PW0 A;  1T16 A;  2ODJ A;  4M9H A;  7ICM A;  4KLI A;  2R89 A;  5ALP A;  2BHN A;  3FC4 A;  7ICQ A;  4UAT A;  3V8U A;  3RBH A;  2XIC A;  3N97 B;  3VZT X;  1T94 A;  3D2N A;  4C4V A;  9ICV A;  2EZZ A;  3O0F A;  3C2K A;  1B43 A;  4EYH B;  3SYB A;  2KXP B;  5KFJ A;  5KG6 A;  3SMV A;  5ALV A;  3H8J A;  4P0P B;  1MM5 A;  2WJQ A;  3GU3 A;  2BCS A;  4AFK A;  4OD0 A;  1BPE A;  1DGS A;  2YML A;  3BQT A;  4R65 A;  2KIC A;  4FSO A;  5KFD A;  2N1R A;  2HMX A;  3LWM A;  3IDW A;  9ICR A;  3C23 A;  2F1V A;  3I1Y A;  1JX4 A;  3MDC A;  3IN5 A;  3KHH A;  5J2D A;  1WWV A;  5DLG A;  3ZDD A;  5PRN A;  4Y2P A;  2L5Y A;  5KFP A;  2BZF A;  3RH6 A;  3F53 A;  4K4I A;  1BXW A;  1QTM A;  2BCV A;  3RAX A;  3F5E A;  4P4M A;  1SKS A;  4P0Q A;  2A19 A;  5KFW A;  2ZUD A;  2FI1 A;  2XTR A;  3LVW A;  5J0Q A;  1URJ A;  4B9N A;  5DQI A;  1N48 A;  5AM1 A;  2G5I B;  2HHT A;  3V7K A;  3LK3 B;  1JXL A;  4OJL A;  2WF5 A;  5ALL A;  5CHG A;  5AM0 A;  4DLG A;  4DL2 A;  4PHA A;  1S10 A;  1QCK A;  2DUY A;  1XSP A;  8ICO A;  1Q9G A;  2ZLD A;  1N60 A;  4KLG A;  1IIP A;  5KT6 A;  2OCE A;  4Q44 A;  2EH9 A;  3RR7 A;  5TZV A;  4FO6 A;  3NVZ A;  5EE9 A;  1BPB A;  2D8C A;  2LKY A;  2OEH A;  2KZZ A;  3OTQ A;  5CEH A;  1G90 A;  4IC9 A;  3ZDA A;  3HT3 A;  4FES A;  2PMZ F;  2NO4 A;  1TAU A;  2VKQ A;  4MF8 A;  3FYX A;  4ECR A;  2LMR A;  2JMM A;  9ICJ A;  1Q8K A;  2NRV A;  2KHV A;  1VLB A;  2KOB A;  7ICI A;  3B0X A;  3JPT A;  3AA1 A;  4BWM A;  1GFQ A;  1NK8 A;  2WB1 F;  3UM9 A;  1AQ6 A;  2FPK A;  2R8A A;  4FT6 A;  3TAD A;  3ALR A;  4IR9 A;  3M8R A;  3LWL A;  1DRG A;  2KVS A;  1OPF A;  3PVX A;  3T24 A;  3EUB 2;  1K1S A;  2F1H A;  5CA7 A;  1SB3 C;  1ZQN A;  8ICW A;  7ICU A;  2JZB A;  1VDV A;  1X9W A;  2XCA A;  4RT3 A;  5CWR A;  3KFU F;  5AM5 A;  4YR2 A;  4RPZ A;  5AFU K;  3MAB A;  2QLT A;  1KKX A;  3QRA A;  2AU0 A;  4DSJ A;  2Y0S F;  3SD7 A;  8ICQ A;  2RHF A;  5KFH A;  2OH2 A;  4BGD A;  4LJX A;  3BQ2 A;  4NWI A;  4ED2 A;  1A77 A;  3AAE B;  4RJX A;  2R4P A;  1B4F A;  2AHO B;  2ES6 A;  3MFH A;  1KQQ A;  3GP6 A;  5IYU A;  2KTQ A;  1JXE A;  3RJK A;  4CCH A;  2XMX A;  3E2E A;  4PL2 A;  1F44 A;  4F4B A;  5ALQ A;  5KFU A;  2KJ8 A;  1Z4O A;  3QEA Z;  4JUZ A;  1JAL A;  5ADX K;  2GOL A;  2ASL A;  2PI5 A;  1THQ A;  5JU5 A;  1UHU A;  3WKD A;  5AK3 A;  4MF2 A;  3OPX A;  4I29 A;  3OJU A;  3KZI U;  3H4B A;  1IG6 A;  3QE9 Y;  5KFX A;  3MGH A;  4C00 A;  2K4I A;  1XO0 A;  2BPF A;  5EE0 A;  5ALX A;  1ZQR A;  1ZHZ A;  5J2B A;  3D2Q A;  1N62 A;  1S5L O;  1DOQ A;  4QNL A;  3K4G A;  4MHV A;  3PGR A;  5B5E O;  2FPL A;  5DGA A;  2HOQ A;  2XI9 A;  1FFV A;  3NVY A;  5KL8 B;  5IIN A;  2A1J B;  1KFD A;  2KMD A;  3H40 A;  4YFK A;  1PK1 B;  2QKQ A;  4F2R A;  7ICH A;  3AA1 B;  2KE7 A;  3WK6 A;  4XRH A;  3AM9 A;  2JEG A;  2I9G A;  5EOZ A;  4DLE A;  5DB6 A;  4CE6 A;  5AIC A;  3V6K A;  2AQ4 A;  2W9C B;  2W7O A;  2ZIV A;  3IRU A;  1Z19 A;  1D8Y A;  4KTQ A;  4UB6 U;  5KFM A;  9ICO A;  5J2H A;  5KFL A;  2WF8 A;  3C28 A;  1J2N A;  2FMP A;  4RUC A;  4LSH A;  3SZD A;  1MQ3 A;  3AA7 A;  1NKC A;  1BH3 A;  3M7D A;  4QWE A;  3EZ5 A;  4O0I A;  4R63 A;  4RQ0 A;  1ZQP A;  1CRX A;  3AQE A;  1X6I A;  2VA8 A;  2JQY A;  3QU2 A;  2H3Q A;  3BS7 A;  3SR6 A;  2O4V A;  1SL0 A;  4ED8 A;  5G3A A;  4RQ3 A;  1RM6 C;  4DQQ A;  2NRW A;  7ICP A;  3JPP A;  3TQ1 A;  1S0M A;  2HHX A;  3WK4 A;  4I2H A;  3LDA A;  3PW7 A;  9ICA A;  5EWE A;  2W11 A;  2DL0 A;  1NJY A;  4QZG A;  3RB0 A;  2K4E A;  3WKB A;  1YZ6 A;  4F50 A;  2NO5 A;  3VCB A;  4QIW F;  1DGJ A;  1S8O A;  4BUG A;  1HXU A;  3BZC A;  2XE5 A;  7ICV A;  4B9S A;  4O3P A;  3L5K A;  3WKA A;  1BVS A;  4C7Z A;  1SZH A;  3CP8 A;  2BCR A;  5IIJ A;  4KRA A;  4KLJ A;  5KG1 A;  4ECS A;  2W54 A;  3QXG A;  5ALE A;  3UAQ A;  3N7R C;  1NNL A;  5DL8 A;  1RYS A;  2W3R A;  2ZJ5 A;  2ATL A;  1F5S A;  3DA4 A;  4PR7 A;  2BDP A;  5KFR A;  2HW3 A;  2NRX A;  4UAU A;  1O08 A;  5KT5 A;  2R18 A;  5DG9 A;  5KNI A;  1KDH A;  4F5R A;  5AI4 A;  4NJ8 A;  2E8N A;  1SV4 A;  4GLX A;  5T5F A;  4PHP A;  3DDH A;  1ZQE A;  2G09 A;  3WK7 A;  1LVH A;  1WYG A;  2WF6 A;  3HWT A;  5HMM A;  4YXJ A;  1KLN A;  3K1R B;  5KFC A;  2HHQ A;  1D8B A;  2KG5 A;  5AI0 A;  5J0Y A;  5AI6 A;  4Y2U A;  5GTH U;  4DFM A;  3QNM A;  4I2C A;  2EAN A;  2V9W A;  5KG3 A;  2WB1 C;  2QAR B;  4BDP A;  5TIS O;  4D64 A;  2ISP A;  4IR1 A;  2K4P A;  3AA0 B;  2POR A;  4AYB F;  3SEI A;  4KLT A;  5AI8 A;  1TFR A;  3C1Z A;  3F2B A;  1OSM A;  4PZO A;  2Y0K A;  4AYB C;  1ZQB A;  4ECV A;  2LYA A;  5CP2 A;  3ZDE A;  3UXN A;  5DBC A;  2XY6 A;  2LYB A;  1TVA A;  2K8C B;  2Z7J A;  4ACO A;  2LHT A;  3PV8 A;  2KZ3 A;  4NLB A;  4RU9 A;  3PML A;  1CUK A;  3BRZ A;  4MEX A;  3OSP A;  4ELV A;  5DKW A;  2H3F A;  1IZN A;  3MC1 A;  1ZQX A;  4FMS A;  2KEY A;  5JUM A;  3JPR A;  1ZXI A;  2R8G A;  3PO4 A;  4FRT A;  1A6S A;  1SGG A;  4DS4 A;  2FDR A;  5ALR A;  5J2J A;  1ZQS A;  3QUC A;  3FDS A;  3UXO A;  2UVW A;  8ICU A;  3POX A;  4QQ1 A;  1RG6 A;  5KFF A;  2XC9 A;  5G39 A;  4QZE A;  3B0Y A;  3UPQ A;  3SY9 A;  1RXV A;  3GV7 B;  3O0E A;  5AKK A;  4BXO A;  2FMQ A;  3E58 A;  3EYZ A;  3A0B U;  1L5U A;  3MGV A;  4NLK A;  1H38 A;  2DF4 B;  2BCQ A;  4M9G A;  1ECW A;  1QJ8 A;  4DFP A;  3LK9 A;  1PVQ A;  1S0O A;  3GIK A;  4UAY A;  2O6K A;  4DFD A;  2JEF A;  1U47 A;  1MSW D;  3FYH A;  2HHU A;  2R8K A;  4DSI A;  2KFZ A;  4XQ8 A;  3WK5 A;  4QZF A;  4DOA A;  2LM4 A;  2WAQ C;  4F4Z A;  2E8O A;  4F4K A;  5KFE A;  4DL4 A;  4PJ0 O;  9ICQ A;  4JV0 A;  4AYN A;  4UAZ A;  3N7S C;  4X5V A;  1OUQ A;  3HX0 A;  5KFN A;  4YMO A;  2MU2 A;  4YP3 A;  3CRX A;  4ICA A;  9ICH A;  2LM1 A;  7ICR A;  3FM9 A;  5KL1 B;  1ZHY A;  3HW9 A;  3PX6 A;  3ISB A;  1HEK A;  2Y1J A;  1WCL A;  4QZC A;  5DGB A;  3RR8 A;  4YN4 A;  1D9D A;  4EZ6 A;  2VAN A;  1U49 A;  4D65 A;  2ODG A;  3KZX A;  5ALS A;  3IM1 A;  3PZP A;  4IL6 O;  4RLC A;  2J6U A;  1NKB A;  3T5K A;  3JPQ A;  2I6X A;  2HVI A;  3WKC A;  4O49 A;  4FZN A;  4DSL A;  3HKZ C;  2X27 X;  4NLC A;  3JPO A;  4I2J A;  4GXK A;  3TFR A;  4ELT A;  5J0W A;  4MFF A;  3QYP A;  4JV2 A;  5AI5 A;  4B9L A;  4C8K A;  2M0N A;  4EBE A;  3WK8 A;  4DFK A;  4AYD C;  8ICK A;  2IBK A;  2CRX A;  4RQ7 A;  4PHE A;  1NK9 A;  4PL1 A;  1NK5 A;  1QQ7 A;  4DF4 A;  4O5E A;  3PW2 A;  7ICO A;  3RRH A;  4B6J A;  4TUS A;  1LKY A;  4I28 A;  7ICJ A;  4UB6 O;  1HUO A;  5ALN A;  4LZD A;  2Y0L A;  5BOM A;  4Q43 A;  3SZ2 A;  2EAO A;  3C5G A;  2RP5 A;  3WI4 A;  2OMF A;  3SZV A;  3AU2 A;  5DLF A;  3PGU A;  4B9T A;  3G6V A;  4ELU A;  1LB2 B;  4UB5 A;  1L7O A;  4I2A A;  3H0R B;  4TUQ A;  2FLP A;  3VZW X;  4YXM A;  4DQP A;  2KZ7 A;  2WVP A;  5FVN A;  5G5G A;  4EEK A;  3BS0 A;  2K0L A;  7ICE A;  3UPG A;  1IV8 A;  8ICL A;  1P7D A;  4GF4 A;  2K60 A;  1ZQ1 C;  1YS5 A;  2R4O A;  4EZ9 A;  2ZJ8 A;  4KMO B;  1Q3V A;  3KHG A;  3QRC A;  5J2E A;  8ICB A;  4IQT A;  3AAA B;  3ISC A;  4RQ2 A;  2EQY A;  2Y7S A;  2RQ5 A;  4US9 A;  3PW4 A;  5JRT A;  3RJE A;  4IQW A;  5ALZ A;  5DBA A;  3THV A;  2F1T A;  5IIL A;  3C21 A;  2F76 X;  1TAQ A;  2F1C X;  2JH7 A;  2AXT O;  4UAW A;  2R4L A;  4O3W A;  5EWG A;  3POQ A;  2P6U A;  3QUT A;  4B9M A;  2JR5 A;  3SY7 A;  2MRL A;  1ZQI A;  1KW4 A;  3SQI A;  9ICS A;  8ICC A;  2ESE A;  4ED3 A;  3RH5 A;  1NZP A;  5H2F O;  5J2K A;  1ZQJ A;  1SXE A;  1X40 A;  3PSF A;  1KBU A;  4RNM A;  3IHQ B;  2C28 A;  3HOL A;  2DBY A;  4AZL A;  4J9O A;  1ARO P;  5KFB A;  4J9M A;  4B9U A;  4I2B A;  1X6J A;  4M6W B;  3EMN X;  5FP0 A;  4RNO A;  4EBD A;  3NTU A;  2BPC A;  3AU6 A;  5L1K A;  3POU A;  2HCF A;  2B21 A;  1TAM A;  1BPX A;  4U6P A;  4CDG A;  3ZD9 A;  5DQH A;  5DB7 A;  4NLG A;  5F3X B;  3OHB A;  2ERV A;  1PUZ A;  4C0Z A;  3C2M A;  3RJI A;  4PGX A;  1PVP A;  1XWL A;  2D6F C;  4DEZ A;  4NL9 A;  5DL5 A;  4IRD A;  2R8J A;  2W9B A;  5JTI A;  1ZD5 A;  4EX6 A;  2JEJ A;  3RJG A;  4C4T A;  4G75 A;  4ECT A;  4UAS A;  9ICL A;  2XTQ A;  2IWW A;  2DGZ A;  2ZXH A;  5BOL A;  1SWW A;  1ZRN A;  4XNL A;  3VY9 X;  5DDM A;  1RDF A;  5AKE A;  4QZB A;  4ECQ A;  2KHQ A;  2C2D A;  1L3T A;  4QZ8 A;  2F77 X;  4IS7 A;  4Q45 A;  1MA7 A;  4NM1 A;  1T1L A;  1D8L A;  3GDX A;  3V7L A;  4F71 A;  1BPY A;  3HPO A;  2JRZ A;  1ZQA A;  3QZ7 A;  4QWB A;  3PMN A;  5DL6 A;  4IRC A;  4M9L A;  4AYI D;  5IIK A;  3SEN A;  4N59 A;  2E3T A;  2EDU A;  3RFA A;  3Q8R B;  4CTD A;  2HHS A;  5E79 U;  2WHE A;  3KD3 A;  3DWN A;  2QB0 B;  1JRP A;  2F3N A;  4DL5 A;  1ZQG A;  2MUT B;  3N28 A;  3H8M A;  3S6J A;  5AM4 A;  4YQW A;  5CJ7 A;  1COK A;  2KC0 A;  4C8O A;  1KL9 A;  2M9N A;  2V4Q A;  4J9N A;  5KAF U;  5J0X A;  4I2D A;  4PGY A;  2DFL A;  3C5F A;  5KG2 A;  1MC8 A;  4QZH A;  2XE2 A;  2KN7 A;  4TQR A;  4UB3 A;  4O3S A;  2PMZ C;  5ALO A;  3H8S A;  4AKR B;  3PO5 A;  4Y2T A;  5G26 A;  1TV9 A;  2N2L A;  4M6W A;  3TAD C;  5KFG A;  3SI8 A;  4AKR A;  1UPH A;  4WJ3 B;  1GFM A;  2LI6 A;  4LSE A;  4QW9 A;  4EBC A;  2J6T A;  5B66 U;  4KLM A;  3ZI4 A;  4QZA A;  1UCV A;  3TAC B;  5IIM A;  8ICX A;  2DQN B;  1Z1B A;  2N2M A;  1UT5 A;  4U7C A;  1O03 A;  3MGI A;  1T8E A;  4M0A A;  1PZN A;  3ETL A;  4EEY A;  9ICI A;  2Q4T A;  4O3N A;  1D9F A;  2CXY A;  4UQG A;  3BJY A;  4DOC A;  5J8Y C;  2MNH A;  8ICM A;  1RQL A;  1HIW A;  1ZYQ A;  1SV0 C;  3LK2 A;  5KG0 A;  4DF8 A;  4ECZ A;  4OJ5 A;  1UQV A;  5DB9 A;  5J29 A;  7PRN A;  3GIM A;  4KLU A;  4FQE A;  4BUM X;  4FZM A;  4DQS A;  2YNK A;  4DL3 A;  2ZTE A;  2ZTD A;  1ZD3 A;  1N2X A;  2VJ5 A;  4F5P A;  1B22 A;  2W9M A;  4FS1 A;  1SL2 A;  1HJP A;  2YX8 A;  1LV5 A;  4RNN A;  4F5Q A;  3ORY A;  3DWO X;  2W7P A;  2R8H A;  2G07 A;  1SKR A;  3EWA A;  1X42 A;  1TK5 A;  3G6Y A;  3WI5 A;  1TKD A;  7ICN A;  3TI0 A;  2R8I A;  4RQ1 A;  5D5D A;  1NJW A;  2JH1 A;  5HNK A;  2KKV A;  2EAP A;  1QJ9 A;  3BQ0 A;  2Y9U A;  5KFT A;  4PUX A;  2G08 A;  2YY6 A;  2V4R A;  8ICG A;  1ZQU A;  4DCC A;  5J2I A;  4KLQ A;  4YVZ A;  2Q0Z X;  2KZ7 B;  4PH5 A;  2J6S A;  4DFJ A;  4FFD A;  1S76 D;  1XO1 A;  7ICF A;  2W9B B;  1UT8 A;  3F2D A;  4J03 A;  1DK2 A;  1ZQQ A;  2W8L A;  1SIJ A;  3MFI A;  4P0P A;  2KXP A;  1QSY A;  1T4G A;  5ALK A;  3UQ0 A;  2A1A A;  1XSN A;  4DS5 A;  8ICJ A;  3PR5 B;  3TFS A;  5KT4 A;  4FOZ A;  3NSG A;  2ZG6 A;  1S9F A;  4IL6 U;  3Q8S B;  5F9N A;  1DK3 A;  2WF9 A;  2YMQ A;  4KN4 A;  2H3Z A;  3PNC A;  3TAR A;  4NL9 C;  7ICK A;  3L4P A;  4MFA A;  1PK3 A;  3JPS A;  4LVS A;  1PVR A;  2F1J A;  5ALJ A;  4UB2 A;  5ALW A;  2E1F A;  4M2Y A;  3PST A;  2VA2 A;  4Y2X A;  3ED5 A;  4XUS A;  2YMP A;  9ICW A;  1BNP A;  2E5S A;  2XE1 A;  3AA6 B;  2QTK A;  4DL6 A;  3BZK A;  5D49 A;  4CGZ A;  4RLB A;  2J4U P;  1ZRM A;  2RLT A;  4J9S A;  2KKP A;  3TZG A;  2ZIW A;  4RQM A;  4GC6 A;  3PQU A;  2K4H A;  1J97 A;  4GXJ A;  4KLF A;  1T3N A;  4ZH4 A;  4JCH A;  5KAI O;  1BPD A;  2GE4 A;  1S5L U;  2YMM A;  5KT2 A;  1HUZ A;  2QB1 A;  4Z6E A;  8ICI A;  1GFO A;  4Z3T A;  1U48 A;  4KX3 A;  4C4R A;  2E1E A;  4O3O A;  3QU4 A;  1A0P A;  2K4T A;  2BQU A;  4Y2V A;  8ICY A;  1WCN A;  4J9Q A;  2HBM A;  5CR0 A;  3K19 A;  1ZET A;  4YR0 A;  3HOE A;  4PPX A;  5ALF A;  1WWU A;  4KLD A;  5EE3 A;  1RYU A;  4RQ5 A;  2KK0 A;  1ED1 A;  9ICE A;  4U9C A;  1ZQH A;  3U26 A;  1ORM A;  4FZL A;  2KZM A;  1L3V A;  1RPL A;  2RDI A;  2E8P A;  1Z00 B;  5KFS A;  2DPI A;  3N4M B;  1BGX T;  1KFS A;  4YCX A;  2IA6 A;  5J0T A;  1NI3 A;  3KBB A;  3RBD A;  2EAM A;  1FO4 A;  2LBO A;  4RT2 A;  5DL7 A;  1BNO A;  3RRG A;  1ZQD A;  5L9X A;  3GFK B;  4CF4 A;  2NV3 A;  3Q8K A;  5AKG A;  5D4B A;  9ICB A;  5C5J A;  2MA1 A;  1LKY B;  1N56 A;  2YPV A;  2FGR A;  2KP7 A;  4LSF A;  2Y9T A;  2VIX A;  2KVC A;  4RPY A;  3Q8P B;  3K1Z A;  2XO7 A;  1JN3 A;  2JV3 A;  2P66 A;  2PFQ A;  2FLN A;  4UBC A;  3NRZ A;  4O4X A;  7ICT A;  3Q8L A;  2I5H A;  5GTH O;  5HML A;  3VE1 A;  2WTF A;  3VZU X;  2YQE A;  4GCS A;  2ZXI A;  3GQC A;  1WUD A;  4O3R A;  4MEY A;  5ALU A;  8ICH A;  3H7I A;  3KZI O;  2BPG A;  2IHN A;  4QJF B;  4GIB A;  5DG8 A;  2PKE A;  5ALD A;  1QQ6 A;  4M04 A;  4DL7 A;  3KVD D;  4NXZ A;  4C8N A;  3GII A;  5A0L A;  3NUQ A;  3M9M B;  1UA0 A;  4I2F A;  3AA0 A;  2RDJ A;  5GV0 A;  3G6X A;  4KN7 A;  1BT9 A;  1RQN A;  4G9B A;  5ALM A;  2KIW A;  3FAH A;  4F4X A;  4I2E A;  3RJH A;  1N5W A;  2ZTC A;  3LVV A;  1V97 A;  4EX7 A;  1L7N A;  1ZQL A;  2HHW A;  4EYI B;  5J8Y A;  3V7J A;  1PRN A;  3BQ1 A;  4BWJ A;  1NK7 A;  2P6R A;  3PX4 A;  3HW8 A;  4YD2 A;  3BQ7 A;  4C69 X;  1KRP A;  4UAR A;  5L1J A;  3EPG A;  4Q8F A;  2H3V A;  3IG5 A;  4CF5 A;  3Q8M A;  2G0A A;  4QWC A;  3A2S X;  4UB4 A;  1ZQO A;  3SAH A;  5KFZ A;  1MM4 A;  4JWM A;  4NY8 A;  3GIL A;  3OSN A;  2IWV A;  5DBB A;  2UVU A;  2AGO A;  1L7P A;  4GC7 A;  4O3Z A;  2OM6 A;  2FE9 A;  4IRK A;  1OW5 A;  4BXO B;  2X9K A;  1ZHT A;  5AKL A;  4E0D A;  2C22 A;  4PJ0 U;  5GTI O;  3T5J A;  5BPC A;  1YT3 A;  3I28 A;  1JIH A;  2F44 A;  1UA1 A;  1ZQM A;  2W3S A;  3C29 A;  4O3Q A;  2XY5 A;  2BQR A;  3DV9 A;  2RRD A;  4M9J A;  4FBT A;  2F2A B;  3PR4 A;  4LSI A;  2IOF A;  2YB1 A;  2R88 A;  4NLN A;  8ICR A;  1X2I A;  1ZQW A;  1ZHW A;  3HJE A;  1V9P A;  3PSI A;  1KN5 A;  1NK4 A;  1XS9 D;  2PFN A;  1Z1V A;  4C7Y A;  1JMS A;  3CNH A;  5J2F A;  1V85 A;  9ICU A;  4DSK A;  4AKM A;  4NM2 A;  3GIJ A;  3MR6 A;  2Y2X A;  3Q8Q B;  3SYS A;  4Y2Q A;  2XVT A;  9ICP A;  3PRN A;  2HBL A;  1H6S 1;  3GZF A;  2Y0S C;  3AMZ A;  2IHM A;  4GCQ A;  4HAI A;  3D6J A;  4N75 A;  3AA6 A;  4RQ6 A;  3ICX A;  3GV8 B;  2XG6 A;  5KG4 A;  3WU2 O;  1SWV A;  3H0M B;  1TK8 A;  4GXI A;  5AK4 A;  4KIT B;  4PGQ A;  5IIO A;  8ICV A;  5AIB A;  1NZB A;  3PQS A;  2B6G A;  1TK0 A;  3WK9 A;  4RUA A;  2YN4 A;  2ZUC A;  4KLS A;  4F93 B;  1QJP A;  4CRX A;  3M6K A;  2NRT A;  5KG7 A;  4PHD A;  4OJP A;  3ZDC A;  4Y2S A;  1ZQT A;  2WAQ F;  2DWQ A;  7ICG A;  1N63 A;  5ALT A;  4R8U A;  2JMG A;  4ECX A;  1U45 A;  4YMM A;  1N61 A;  1M6Y A;  2ASD A;  1NOM A;  3T3F A;  3C1Y A;  3ETR A;  4F72 A;  2DPJ A;  2A1J A;  3KKA A;  2GWS A;  1JI7 A;  4C80 A;  2G06 A;  3UMC A;  1Q3U A;  5L1M A;  1QQ5 A;  3QU5 A;  4RZR A;  5AKZ A;  1COO A;  2WF7 A;  3RBE A;  7ICL A;  2VA3 A;  1ZQZ A;  4UAV A;  1RYR A;  2GH1 A;  9ICG A;  3F2C A;  4DO9 A;  1JRO A;  2BKE A;  2XY7 A;  2HI0 A;  5B66 O;  2OHF A;  4F2S A;  1GFN A;  4MFC A;  3H8W A;  3RJF A;  2WFA A;  4QWD A;  3MR2 A;  2AGQ A;  5KAI U;  2I1Q A;  4E1T A;  1ZQF A;  3CW2 C;  1IM4 A;  3DEE A;  3OHA A;  2LPE A;  3H0L B;  5AK6 A;  3LK4 2;  1MPF A;  4UB8 U;  3PGS A;  3AL0 B;  3GV5 B;  1KEJ A;  4RJW A;  3RF9 A;  4F4W A;  3I76 A;  1WG8 A;  3UQ2 A;  9ICN A;  3VC8 A;  2KJ5 A;  1ZQV A;  4LZG A;  2XCP A;  4F3O A;  2H3I A;  2MSN A;  1U4B A;  1BPZ A;  3LK2 B;  3E0F A;  2LYH A;  4O3Y A;  3AAE A;  1L8O A;  8ICN A;  4K3B A;  4ED0 A;  5J0P A;  3HWB A;  1L3S A;  5KFY A;  2PRN A;  2ZFG A;  4M47 A;  4RL9 A;  5T14 A;  3EW9 A;  5TIS U;  4EEL A;  8ICS A;  4AYE C;  3RTV A;  3BS5 B;  3AA7 B;  3BRY A;  4DSF A;  2PFP A;  5L1L A;  1NK6 A;  1FFU A;  3UMG A;  1SKW A;  3A0B O;  4IQU A;  4O5K A;  5EWF A;  1ZQY A;  5DB8 A;  2ZIV B;  1IXR A;  4FE3 A;  4P4O A;  1PHO A;  2Y1I A;  4ZOH C;  3ZD8 A;  2EZY A;  2W9C A;  3ONN A;  4DQI A;  3V72 A;  2JEI A;  1C7Y A;  1S97 A;  1Q9F A;  4O4U A;  2PI4 A;  8PRN A;  3NRW A;  2KV2 A;  3V6J A;  3NVV A;  4CF3 A;  2XGQ A;  1ZJM A;  3VY8 X;  1PK1 A;  1JUD A;  5HP4 A;  1HXX A;  3QZ8 A;  1K5O A;  5III A;  2GO7 A;  1YZ7 A;  3UMB A;  1L7M A;  3IV6 A;  3M1Y A;  1ZOL A;  4YG2 A;  3T5H A;  1XU4 A;  4O3X B;  3HKZ F;  4JFB A;  2BR0 A;  1ZJN A;  3A0H O;  2CPR A;  4F5N A;  2LHF A;  2CN1 A;  5AKI A;  4KR8 A;  3R9K A;  4UBB A;  1GO3 F;  3BS5 A;  1ZQK A;  4IQV A;  4TUR A;  9ICT A;  2MUT A;  3K75 D;  1HXT A;  2QB0 A;  4R66 A;  3AUO A;  2W55 A;  1FEZ A;  4US8 A;  2VJ4 A;  4QIW C;  3SAG A;  2XGP A;  4P2H A;  2JHD A;  5B5E U;  5ADX L;  3T79 A;  3MDA A;  4K4G A;  4YMN A;  3MR5 A;  4G3I A;  5E79 O;  1KSP A;  2OWO A;  1SL1 A;  1X9S A;  4O3M A;  3OGU A;  4DQR A;  5KFV A;  5J2C A;  4NV0 A;  3RB4 A;  2XID A;  2KJ9 A;  2HBJ A;  2F8L A;  1SZP A;  3HIL A;  5KFO A;  2W8K A;  1C20 A;  3N7P D;  2ZJA A;  5H2F U;  4G76 A;  5L1I A;  2W43 A;  1S0V A;  2GLE A;  1DXS A;  4E1S A;  3RB3 A;  4UW9 A;  3SYZ A;  2ZUB A;  2W04 A;  1Z3E B;  1Q46 A;  1TE2 A;  8ICT A;  4O5C A;  4HYK A;  2YB4 A;  2E8M A;  2BGW A;  3DA3 A;  2MAX A;  3BDP A;  3DZM A;  5G5H A;  2JZB B;  2K89 A;  1ZD2 P;  1T7P A;  4JWN A;  8ICA A;  3QEB Z;  4F5O A;  2C2E A;  4C8L A;  4KLH A;  3SV3 A;  2YTU A;  3VE2 A;  4C4V B;  1QSS A;  3C5O A;  2KDY A;  3TKA A;  1J2M A;  2AGP A;  5GTI U;  3WKE A;  4KR4 A;  9ICX A;  4ECW A;  2H5X A;  5J0S A;  3KKA C;  3JPN A;  3RJJ A;  4KLE A;  3JTY A;  5AKJ A;  3UXP A;  1KFT A;  3LK4 1;  4GCP A;  2K8A A;  4FS2 A;  1ZHX A;  4R8U B;  4N74 A;  2NRZ A;  2HOF A;  2KIV A;  2KNJ A;  4RQ4 A;  3QU9 A;  1NK0 A;  2HBK A;  4K3C A;  2HDO A;  3H4D A;  3NVW A;  4K4H A;  3QUB A;  5ALY A;  1NKE A;  1P4T A;  8ICZ A;  4Y2R A;  3WU2 U;  1VJ5 A;  1OXJ A;  3TAQ A;  3NS1 A;  8ICE A;  2XE3 A;  4I2G A;  3LK3 A;  5KFK A;  5AI9 A;  4B9V A;  3M9N B;  5J2A A;  4ECY A; 
#chains in the Genus database with same CATH homology
 3GP6 A;  4QJF B;  2F1T A;  5IYU A;  1XNS A;  3KVD D;  5A0L A;  2F76 X;  2XMX A;  4PL2 A;  1F44 A;  4F4B A;  3NUQ A;  2JH7 A;  2KJ8 A;  4O3W A;  3AA0 A;  2KD1 A;  3POQ A;  2BDU A;  4P0Q B;  5GV0 A;  1BT9 A;  3SY7 A;  5ADX K;  5JDP A;  2GOL A;  2MRL A;  2KIW A;  1THQ A;  3AAA A;  2W03 A;  3SQI A;  3OPX A;  3LVV A;  3PSF A;  1KBU A;  1PRN A;  1L6N A;  3CYM A;  2K4I A;  1XO0 A;  4BJQ A;  5HR6 A;  3HOL A;  4C69 X;  1ZHZ A;  3D2Q A;  4AZL A;  2H3V A;  3IG5 A;  3A2S X;  2G0A A;  4QNL A;  3SAH A;  1MM4 A;  2HOQ A;  2XI9 A;  3F5A A;  3EMN X;  3POR A;  5KL8 B;  3POU A;  2G5H B;  4N58 A;  1TAM A;  4U6P A;  3AA1 B;  4CDG A;  4O3Z A;  5C0Y A;  2OM6 A;  4AUI A;  2ZIX A;  2ERV A;  4C0Z A;  1ZHT A;  2OYY A;  1PVP A;  1YT3 A;  2D6F C;  5DL5 A;  2W7O A;  3C29 A;  2ZIV A;  4D5U A;  1Z19 A;  4G75 A;  2RRD A;  2XTQ A;  2F2A B;  2DGZ A;  3LYS A;  3C28 A;  4LSH A;  3SZD A;  2ZXH A;  4LSI A;  5EE2 A;  4B61 A;  4XNL A;  2ZIU A;  2YB1 A;  4GFJ A;  3AA7 A;  3VY9 X;  1BH3 A;  3M7D A;  2KHQ A;  1ZHW A;  2F77 X;  5AFU L;  3PSI A;  1MA7 A;  1CRX A;  2FGQ X;  3AQE A;  4AKM A;  2Y2X A;  5DL6 A;  5CRX A;  4AYI D;  2H3Q A;  2JGA A;  2O4V A;  3SYS A;  4XNK A;  2XVT A;  4N59 A;  3PRN A;  2J1N A;  2HBL A;  1H6S 1;  3RFA A;  3GZF A;  2Y0S C;  4OJ6 A;  4GCQ A;  3D2S A;  3AA6 A;  2MHL A;  4A8E A;  3ICX A;  2XG6 A;  3H0M B;  4KX5 A;  2HOI A;  2Y0H A;  4OO1 J;  2K4E A;  2KC0 A;  3AQF A;  3VCB A;  3SAF A;  4QIW F;  1HXU A;  4BUG A;  1NZB A;  3PQS A;  1GFP A;  2XE5 A;  1QJP A;  4CRX A;  3UU2 A;  3M6K A;  1SZH A;  3CP8 A;  4OJP A;  4KRA A;  4BX9 C;  2WAQ F;  3T0S A;  3UAQ A;  4JMU A;  3N7R C;  5DL8 A;  2XE2 A;  2ZIX B;  2JMG A;  3DA4 A;  2PMZ C;  4AKR B;  2R18 A;  5G26 A;  2N2L A;  2G06 A;  1Q3U A;  4AKR A;  1UPH A;  5HR7 A;  5T5F A;  4WJ3 B;  1GFM A;  4GHB A;  4LSE A;  4FUV A;  2G09 A;  2GH1 A;  3F2C A;  2DQN B;  1Z1B A;  1IZN B;  2N2M A;  6PRN A;  4U7C A;  4AYM C;  1GFN A;  3PSP A;  1D8B A;  2Q4T A;  1E54 A;  2MNH A;  1HIW A;  4E1T A;  3LK2 A;  4OJ5 A;  2WB1 C;  2M07 A;  3DEE A;  7PRN A;  4BUM X;  4FZM A;  4D64 A;  2YNK A;  3H0L B;  3AA0 B;  3LK4 2;  2POR A;  1MPF A;  3AL0 B;  2OXO A;  4AYB F;  3M6Z A;  4RJW A;  2VJ5 A;  3RF9 A;  3L3F X;  3F2B A;  1OSM A;  2YX8 A;  2LFU A;  2Y0K A;  3VC8 A;  2KJ5 A;  4AYB C;  2M06 A;  3G7G A;  4OJO A;  2H3I A;  2LYA A;  2K8B B;  2W7P A;  3E0F A;  2G07 A;  3LK2 B;  3T20 A;  3IG8 A;  4O3Y A;  3AAE A;  2ZIW B;  3WI5 A;  2LYB A;  2K8C B;  5D5D A;  2Z7J A;  2JH1 A;  3HWB A;  2KKV A;  4ACO A;  2LHT A;  1QJ9 A;  2PRN A;  4FSP A;  2ZFG A;  4NLB A;  4RL9 A;  5T14 A;  4PUX A;  2G08 A;  2W81 C;  4FRX A;  2H3F A;  1IZN A;  4AYE C;  3AA7 B;  2A3V A;  4FMS A;  2KEY A;  2ZIU B;  2W80 C;  4FRT A;  3IP4 B;  1A6S A;  2KZ7 B;  2ODJ A;  2ZIV B;  4FE3 A;  3F2D A;  1PHO A;  3POX A;  3V8U A;  4QQ1 A;  4P0P A;  3RBH A;  2XIC A;  3ONN A;  2KXP A;  1Q9F A;  3VZT X;  1T94 A;  4O4U A;  3SY9 A;  3D2N A;  3O0E A;  8PRN A;  3NRW A;  2KV2 A;  3MGV A;  3O0F A;  4FOZ A;  3NSG A;  3VY8 X;  2ZG6 A;  2DF4 B;  3SYB A;  1HXX A;  2KXP B;  1ECW A;  3SMV A;  1QJ8 A;  4P0P B;  1MM5 A;  1PVQ A;  3GU3 A;  2H3Z A;  4O3X B;  3HKZ F;  4AFK A;  4JFB A;  1PVR A;  2CPR A;  2LHF A;  2CN1 A;  2WAQ C;  2KIC A;  4FSO A;  2E1F A;  4KR8 A;  3PST A;  2N1R A;  2HMX A;  1GO3 F;  4AYN A;  3N7S C;  1OUQ A;  2F1V A;  2E5S A;  2XE1 A;  3CRX A;  1HXT A;  4ICA A;  3AA6 B;  3IN5 A;  2QTK A;  4CGZ A;  4RLB A;  2J4U P;  5KL1 B;  5PRN A;  1ZHY A;  3HW9 A;  1HEK A;  2KKP A;  2VJ4 A;  3TZG A;  3F53 A;  2ZIW A;  4QIW C;  3SAG A;  1BXW A;  3PQU A;  2K4H A;  2JHD A;  3F5E A;  4D65 A;  5ADX L;  3KZX A;  4P0Q A;  4JCH A;  3T79 A;  3PZP A;  2GE4 A;  4RLC A;  1GFO A;  2XTR A;  4Z3T A;  3LVW A;  4O49 A;  1URJ A;  4KX3 A;  4FZN A;  4O3M A;  2E1E A;  3HKZ C;  2X27 X;  1A0P A;  2K4T A;  4NLC A;  4NV0 A;  2HBM A;  2G5I B;  3K19 A;  2XID A;  2KJ9 A;  2HBJ A;  2F8L A;  3LK3 B;  3N7P D;  4OJL A;  3HOE A;  4G76 A;  4E1S A;  1Q9G A;  2M0N A;  2ZLD A;  1IIP A;  1ED1 A;  2W04 A;  4AYD C;  2CRX A;  2YB4 A;  4PL1 A;  3DA3 A;  4U9C A;  2LKY A;  1G90 A;  2K89 A;  4IC9 A;  1ORM A;  4FES A;  2PMZ F;  4FZL A;  2VKQ A;  3FYX A;  2JMM A;  2KHV A;  2KOB A;  3VE2 A;  2Y0L A;  3AA1 A;  1GFQ A;  3C5O A;  2KDY A;  2WB1 F;  2RP5 A;  2LBO A;  3WI4 A;  2OMF A;  4KR4 A;  5DL7 A;  3SZV A;  4FT6 A;  3ALR A;  3JTY A;  1DRG A;  2NV3 A;  3LK4 1;  1OPF A;  4GCP A;  3H0R B;  3VZW X;  2K8A A;  1ZHX A;  3T24 A;  2HOF A;  2KZ7 A;  5FVN A;  2MA1 A;  2KNJ A;  2YPV A;  2FGR A;  2HBK A;  2K0L A;  4LSF A;  3KFU F;  2VIX A;  5AFU K;  3UPG A;  2KVC A;  3K1Z A;  3QRA A;  1P7D A;  1P4T A;  4GF4 A;  1ZQ1 C;  1YS5 A;  4KMO B;  1Q3V A;  4O4X A;  2Y0S F;  2RHF A;  2OH2 A;  3QRC A;  2XE3 A;  3AAA B;  3VE1 A;  3VZU X;  4NWI A;  3AAE B;  4RJX A;  3LK3 A;  4GCS A;  2ZXI A;  2Y7S A;  1WUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...