4FZMA

Crystal structure of the bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzmA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzmA02
2XMXA 4FZLA 4G76A 3DA3A 2XTRA 2XTQA 4FZMA 4G75A 4N58A 4N59A 4FZNA 3DA4A
chains in the Genus database with same CATH superfamily
1BPEA 5DB9A 9ICSA 4RJWA 5JUMA 4NL9A 2YTUA 2HVHA 1BPBA 3MABA 5ALSA 2ZTCA 4M9LA 4ED6A 5DL7A 4EX7A 4Y2TA 3WK4A 1Q9GA 1RG6A 3R9KA 9ICTA 3JPQA 2KIVA 4QZGA 8ICKA 4RPYA 1L3VA 4QZIA 3RBDA 3LDAA 2RP5A 3K4GA 3G6XA 3Q8RB 1PUZA 3PY8A 4NLCA 1XSNA 5KG2A 4UAUA 4QZ8A 2A19A 2NRZA 2H3QA 5CB1A 2BQ3A 3UMGA 2PFQA 5ALWA 4UB4A 2KV2A 1X6IA 5KFNA 3VE1A 4IC9A 3ONNA 2WF7A 4FBTA 5KAFO 3T0SA 4C0ZA 4F5PA 3AAAB 3C29A 2QB0B 2KSOA 4Y2UA 4BXOA 4IRCA 2HVIA 2B21A 2HBKA 3M9OB 1L5UA 1ZQXA 3HOEA 1DGJA 1NK4A 2KZMA 7ICVA 2K4HA 4XUSA 5KAIU 3NGDA 2W8KA 1F44A 2F3NA 2YB1A 5HHHA 8ICSA 3CW2C 3LK2B 2FPMA 3ZD8A 4GF4A 3H0RB 5G5HA 2Y9TA 4O5CA 5ADXL 3CP8A 3CYMA 3SMVA 9ICEA 2PI4A 9ICXA 5BPCA 4M0AA 3QUQA 5DG8A 5ALEA 5KFZA 2HOFA 2DUYA 1O08A 3AQFA 4R63A 1MM5A 1HXTA 4Y2JA 2JZBB 5DB8A 4B9LA 3SY9A 3V7LA 3ZI4A 4DSKA 2PFNA 4RU9A 1V85A 4KMOB 4NWIA 4QJFB 4EEYA 2FI1A 3HOLA 1IV8A 4UAVA 4BWJA 1X40A 1L3UA 2O6KA 2DKXA 3RB6A 3ISDA 2C28A 2KTQA 2GH1A 3M7DA 2VIXA 1ZXIA 1JXLA 3AA6A 4PUXA 2KD1A 1IM4A 3VZUX 3ALRA 1BVSA 1NJWA 1RM6C 4ELUA 3K1RB 3Q8QB 5KFOA 2KXPB 2N2MA 2HHUA 3PF1A 4ECUA 4EZ6A 4Q44A 4EBCA 4RQ6A 3BJYA 4RT3A 1A0PA 1YZ7A 1RDFA 5IILA 3RBEA 1H6S1 3UAQA 2D6FC 3MGHA 1NZBA 5JRTA 3AA0A 3BS7A 2GO7A 5EE3A 3DV9A 4PGYA 3GDXA 4GHBA 2I1QA 3PW2A 3IP4B 1RXWA 2BPFA 2J6TA 4EELA 3RR7A 5TISO 3PW7A 4FUVA 3PO4A 8ICYA 2IOFK 4ECZA 4CCHA 3AA7A 4DSLA 2HI0A 4DSEA 3H0MB 4CTDA 5G3AA 2ZTDA 3QZ8A 3SAGA 2HBLA 3TACB 4TQSA 5D49A 1TK8A 1U9LA 4M47A 2RDJA 5BOMA 4ED1A 2KJ8A 4AKRB 4X5VA 1A6SA 3KHGA 5L1KA 2R4OA 2EZYA 3LK3A 4YR2A 2IOHA 1ZQZA 2AGQA 5ALZA 5F3XB 4QZHA 4O5KA 3EMNX 1ZRMA 2G09A 3T20A 8ICWA 3QU5A 4FZMA 1KTQA 3HT3A 4QWDA 1RXVA 2KVCA 4TUPA 8ICQA 2F1CX 1GFQA 3WU2U 1RYSA 2B6GA 3BZCA 2LYBA 2G0AA 3O0EA 4RQ7A 2M9NA 9ICVA 2DL0A 2ZG6A 2E1FA 7ICHA 2LYAA 1X66A 5GTIO 2BQUA 9ICMA 1ZQFA 4J9PA 3PQUA 1ZQCA 4UBBA 2MU2A 4MFFA 5KFKA 1T7PA 1NOMA 4OCZA 5ALYA 3E0FA 1XNSA 3QE9Y 1S76D 2LKYA 3AM9A 4KX3A 4DSIA 4KRAA 5DL5A 3RAQA 3QX7A 2IMWP 2UVUA 1ZD5A 4P0PA 1K1QA 5G5GA 8ICNA 2W55A 3QUCA 4US8A 4N59A 4K4IA 3Q8KA 4PJ0U 3JPRA 3SQIA 1XO1A 4UB8O 1Q8KA 4J9NA 3GILA 2F8LA 2VA8A 4QW9A 5KFIA 1SZHA 4AKMA 2XY7A 3DWOX 4OD0A 5JDPA 5KT7A 3PZPA 3PGRA 1ZQPA 4J9QA 3QEAZ 1E54A 1N63A 3SZ2A 2QKQA 1L6NA 2KZ7A 3VY8X 8PRNA 3T5HA 2HMXA 3M9NB 4IS7A 4KITB 5AHXA 5EOZA 2R4NA 4RUCA 3TI0A 1JIHA 4FS1A 5J0PA 4R65A 1XSPA 3LK9A 4IQWA 3NTUA 3ZDBA 5ALOA 5IIMA 3RJJA 1SKRA 5J0XA 3MR3A 2VJ4A 5J2GA 3C5GA 5KG3A 5KFCA 1XS9D 4PHEA 1L8LA 1KFTA 1X6JA 5EE0A 4XA5A 1ZQNA 1QJ8A 3HP6A 4EYIB 2Y1IA 2H5XA 2LM4A 1DK2A 4BXOB 3OJSA 4Z6CA 3A0HO 4KLHA 4DS4A 1GFOA 2CN1A 1PZNA 2NO5A 5D4BA 4NLZA 1JUDA 4U6PA 5C5JA 4YMOA 2EH9A 1H38A 1QSYA 3GU3A 4LJXA 3TADA 3TFSA 1KLNA 3RF9A 2ZUCA 1ZQWA 1KN5A 2WVPA 5EE9A 5IIKA 7PRNA 4JV2A 4FFDA 1RYUA 4F5OA 5H2FO 4Q45A 2HBMA 4F92B 5AI5A 3AAAA 2KNJA 2G5IB 4DQQA 1ED1A 2F1JA 6PRNA 2W3RA 1GO3F 2K4IA 2VA3A 2Y7SA 4M9GA 1VJ5A 1ZOLA 2HHTA 9ICLA 3LK2A 2QTKA 4O3WA 4AYBF 3F53A 1S77D 4YR0A 4PL1A 4ECWA 2YMQA 3IG5A 1A76A 3AA6B 3A0BO 2WJQA 3T3FA 3LYSA 4FRXA 3AEVA 2JZBA 1TK0A 3SEIA 4OO1J 2GE4A 2KKVA 2JRZA 2LYHA 3UMCA 4DOCA 4F4YA 3PVXA 3JPTA 3KOOA 2AXTO 5DDYA 2JGAA 2JHDA 4PHPA 3PW4A 3QZ7A 2MNHA 4B9MA 4OJ5A 1B0XA 2ZIUB 3FDSA 8ICGA 2EAMA 2L5YA 2BQRA 4KLQA 1KEJA 3AA0B 1TK5A 4RNMA 3QYPA 8ICEA 2DQNB 2HW3A 4JB3A 1N62A 4M6WB 3LK41 1UPHA 7ICNA 2RQ5A 3FAHA 8ICFA 4AUIA 1HIWA 4US9A 2JR5A 4I2BA 3QU9A 2QARA 4DL3A 3NSGA 4Y2XA 4QZAA 2W80C 2AHOB 2K60A 1MM4A 3IV6A 1OW5A 2G06A 4N58A 7ICEA 3VCBA 7ICPA 1S97A 2KE7A 5HR6A 8ICUA 5KG7A 4P4MA 3AL0B 4TQRA 3KTQA 4AYBC 3FYHA 1KBUA 3G7GA 1Z00B 3UM9A 3TKAA 3BRYA 4FE3A 1ZQSA 2ZXHA 1P4TA 4JUZA 4F5QA 5J0OA 4AFKA 4O4XA 2V9WA 9ICFA 2EDUA 2A1JB 3Q8SB 2JEFA 4DL4A 1HXXA 1COOA 4KLJA 4ECRA 4CF4A 1FEZA 1D9DA 4KLLA 5J2JA 4AKRA 5J2KA 5L1MA 4KR8A 2FMPA 1MN8A 2W04A 1Z1VA 5J8YC 3GV5B 2W43A 5DQGA 4U9CA 4LZDA 4F5NA 3RJEA 4C8NA 1ZHZA 3TADC 4C4VA 5AKHA 2LI6A 4E0DA 3O0FA 4IL6O 4F2SA 5AIBA 4R66A 1UHUA 1RYRA 2PORA 2F44A 5DB6A 4P0PB 4YR3A 4FQEA 4PR7A 1N5XA 4CGZA 2FGQX 2ZIXB 2J1NA 2XE1A 2R88A 2XVTA 2KG5A 3KZIU 2W7OA 1UQVA 1T94A 1ZQUA 5DL6A 5AI0A 3OSPA 4LSIA 2RLTA 5AK5A 4KLMA 1VDVA 3UQ0A 4GLXA 4K3CA 2EZZA 2Z7JA 3C23A 3OHAA 4DFDA 5ALGA 3HX0A 3PGUA 4CRXA 8ICIA 5TZVA 2F1VA 4ED2A 4GIBA 2WHEA 2QLTA 2KK0A 4I2EA 3AU6A 1XSLA 5AM1A 9ICNA 2AGOA 1RPLA 1Z3EB 3T24A 4ECTA 1QTMA 1MQ2A 2E8MA 4RUAA 1O03A 4MF8A 1COKA 1J2NA 5J2HA 3ZDAA 2W81C 2J4UP 1J97A 2ESEA 1MC8A 1L3SA 3V6JA 2WF9A 1SZPA 5J0YA 2VJ5A 2K8CB 3TQ1A 2LM1A 1QQ5A 2KJ9A 3RJHA 3SENA 4I27A 3JPNA 5KFXA 1B4FA 1ZJNA 2GLEA 4M9HA 4NLGA 1OXJA 3M8RA 3EUB2 5T14A 3EZ5A 2M06A 4IQUA 9ICRA 4JFBA 1FIQA 3LWMA 3MBYA 3WK6A 9ICAA 5DQHA 4TUSA 5DLFA 1HJPA 4YCXA 5T5FA 3M6ZA 2BR0A 7ICTA 4R8UB 2FLLA 3H0LB 4QZCA 4LVSA 1NK7A 2KJ5A 2WTFA 5AKIA 5KG0A 4DL2A 4LZGA 4ECXA 4RQ0A 1TAUA 4QZBA 4KR4A 3H7IA 1ZQBA 1N60A 4N75A 1T1LA 5J2AA 2FE9A 3SZDA 5GTHO 2XTRA 5KFEA 3MR6A 3VZTX 3JTYA 4EENA 4JMUA 3K19A 1C7YA 1LKYA 3HW9A 2R8AA 4F4XA 2XTQA 3AN1A 2ISPA 2IOFA 4YD1A 5KFQA 4N74A 1DGSA 3PMLA 4GCSA 2HBJA 4DQRA 4A8EA 2Y2XA 4O3YA 4F5RA 3GV7B 2XE2A 4O3QA 3E58A 3N7RC 1PK3A 1QSSA 4DQPA 8ICVA 2K4PA 5DG9A 3T5KA 5AKXA 4K4GA 4JK1A 5AM5A 9ICGA 4GCPA 3PSPA 2OMFA 4EYHB 1MPFA 2RRDA 5ALTA 5AI9A 4PHAA 3POQA 3RR8A 1Q46A 5PRNA 4F91B 4C00A 2KEYA 3ORYA 3NUQA 1SV0C 3PNCA 1ZQLA 3ETLA 3UXOA 3C5FA 3V72A 1IIPA 2XE3A 2E8OA 3BS5A 4YP3A 3RB4A 2LHFA 4LSEA 1HUOA 4Y2SA 2QARB 2F1TA 2ISOA 3D6JA 3UXPA 7ICIA 4YFKA 4GXKA 1WWUA 4C8MA 4CF5A 1DXSA 1N2XA 2E3TA 4XQ8A 2FMSA 3ZDDA 2ZIUA 5F9LA 5B66U 2IHNA 2MA1A 4Q8EA 5ALFA 1MSWD 2PFPA 1K5OA 1NKBA 3D2SA 2WAQF 3BRZA 3NVWA 4M6WA 5CRXA 3Q8PB 3POXA 4D64A 4Y2YA 3V7KA 5KAFU 2HHSA 3NS1A 3QU2A 2ZIWA 1MQ3A 2W9AA 1BPYA 1JMSA 1ZQKA 1S8OA 4E1SA 3QU4A 3BZKA 5HMLA 1NK6A 2BCQA 4EX6A 1IXRA 4DLGA 4YXJA 1NI3A 5L1IA 4C8KA 2J6SA 4J9OA 1IG6A 3RH4A 2ZJ5A 4M2YA 4DQSA 3H8MA 1Z00A 5J2BA 4O0IA 4QQ1A 4RQ8A 7ICQA 4QZFA 4RT2A 4P2HA 2A1JA 4OJPA 5KL1B 5KFSA 1Q9FA 3DA3A 2K89A 3NRWA 4C4VB 3AMZA 7ICLA 4Q43A 2FPLA 1L7MA 4UBCA 4O3MA 4DOBA 3QRAA 5J0RA 2NRTA 4BUMX 2KKPA 1TV9A 2I9GA 2D8CA 3SAFA 1Q3UA 1SL2A 3OPXA 3IDWA 4F4WA 4Y2PA 1BGXT 3VC8A 1X9WA 2WAQC 2OEHA 4M9JA 4ECSA 4RPZA 3THVA 4F93B 2C2DA 3N28A 3HW8A 4OJLA 2W9BA 3H40A 2F77X 5AKEA 1JALA 1PVRA 2W54A 4UAYA 3B0YA 3M9MB 1LVHA 2V4QA 3RRHA 2KZZA 2ZUDA 4O9MA 3N7SC 1OPFA 4C80A 4FSOA 4DEZA 3PGSA 5EE2A 3WKDA 2DWQA 4XNLA 1QJPA 4UB2A 3ISCA 2BZFA 4AP9A 3DA4A 2ZIXA 2ZJAA 2YMLA 1ZQMA 5AK4A 1PVPA 4ECVA 5TISU 5AM3A 5J2CA 4PPXA 3TANA 2FLPA 4RQ4A 2ES6A 1X2IA 2JH1A 1ORMA 3MDAA 3F2DA 2N1RA 1ZQQA 3ETRA 4KX5A 2R89A 2R4PA 1GFMA 4ZOHC 4NM1A 1ZQYA 4D65A 2NRXA 4ED7A 2F76X 4UB6O 4F4ZA 1L3TA 2Y1JA 8ICCA 3Q8MA 3GIIA 2PFOA 3BS0A 8ICHA 2B0CA 4ED8A 4BUGA 2M07A 5IYUA 4PZNA 5ALJA 2WFAA 2E8PA 3UXNA 1QJ9A 1BT9A 3MFIA 3AAEA 5DLGA 1U45A 2UVWA 2XI9A 4KLFA 1SGGA 3TARA 4JWMA 2OYYA 3TZGA 8ICMA 4KLIA 4I2DA 3WKEA 3CRXA 2ATLA 3VE2A 1ZQVA 2Y0HA 4MFAA 1ZQIA 1ZQJA 3KKAA 4MFCA 3BDPA 5FVNA 2AU0A 2E1EA 3GQCA 4DFJA 3OJUA 1AQ6A 3BQ1A 2CPRA 4I2FA 2MRLA 5GTIU 3HWTA 5AIAA 4IQVA 5J8YA 5DBBA 4FZLA 3PX6A 3Q8LA 3UMBA 2VANA 1FO4A 1LKYB 1U47A 4R64A 5KL8B 2OXOA 4R8UA 4JV0A 3AU2A 4NV0A 5DB7A 2DFLA 3C2LA 2AQ0A 4U7CA 2P66A 5F9NA 3UPQA 4RNNA 3C5OA 3MR5A 2NO4A 4B9TA 1DK3A 7ICUA 4Z6EA 9ICWA 1TKDA 2IWVA 4PZOA 3K1ZA 2KMDA 2C2RA 1UA1A 4UB8U 2YMMA 1UCVA 4ECYA 4NLBA 2W03A 2VKQA 1YZ6A 3QEBZ 7ICGA 2ASDA 4G75A 3ISBA 1X9SA 4B9NA 1IZNB 4K4HA 2MHLA 1PRNA 1ZQOA 4B6JA 1X9XA 2BCRA 2XMXA 3WI5A 2AH5A 3BS5B 3WI4A 3PRNA 4KLTA 2UVVA 3H4DA 1LV5A 2N2LA 3BQ7A 5DDMA 5B5EO 4WJ3B 4CF3A 3OHBA 1S5LO 4HAIA 3PR5B 4O3ZA 2PRNA 3H8SA 4KLSA 1X42A 2AGPA 1THQA 3RJGA 4ACOA 1NKCA 4I2JA 1K1SA 2XC9A 4BJQA 4K3BA 2XY5A 4PL2A 3I28A 2NV3A 2NRVA 2VA2A 5D5DA 1SB3C 4OJOA 3QNMA 3E2EA 2BGWA 2ZIWB 4DL7A 3CNHA 1M6YA 4F2RA 1FFUA 1TAQA 4QZDA 3A0HU 1S0VA 3NVZA 4NJ8A 5J2FA 1WYGA 2R18A 2W9CA 2XY6A 2P6RA 3HILA 4UATA 8ICPA 3WK8A 2ASJA 4RQNA 4DF4A 2W3SA 3KZIO 5CWRA 1ZQRA 1DOQA 1T16A 5AKLA 5KFYA 1EXNA 4O3RA 5CP2A 3KHRA 4G3IA 1L7NA 1KFDA 5H2FU 3LK42 4O5EA 3EYZA 4KTQA 2YB4A 4QNLA 1PK1B 5ADXK 5CEHA 1S10A 4KLEA 1J2MA 5J0TA 2KHQA 4XNKA 2EZXA 2BPGA 2NYVA 5L1JA 5AKKA 2HHXA 5DKWA 1ZJMA 2G5HB 3DDHA 4BGDA 3G6YA 2HOIA 1NJYA 1VLBA 2WF5A 1CI4A 1WCNA 2EQYA 4I29A 2JMMA 1N48A 3KKAC 4KLUA 7ICOA 1QLNA 3N7PD 4J9LA 2KC0A 2YY6A 4AZLA 2WJRA 3SR6A 8ICBA 2F2AB 3SYSA 1V38A 4ED0A 2W9BB 3DZMA 2W7PA 1Z4NA 4AYID 4ZH4A 4RNOA 4RLBA 3RAXA 4C4RA 5CR0A 1ZHYA 2C2EA 5E79U 2BDPA 1ZQAA 1KL9A 1QH9A 3T5JA 2IA6A 5KG4A 3JCUO 2BCVA 3IHQB 1S0NA 3RB0A 3L5KA 3MDCA 3HKZF 4C7YA 2KP7A 4B61A 1SV0A 5AI8A 4C8LA 2JH7A 4CNQA 1XO0A 3JPSA 9ICIA 5EWFA 1ZD3A 4DS5A 2KDYA 5KT3A 1BNOA 5FP0A 3HPOA 4J9RA 4DO9A 4DSJA 1JI7A 4KN7A 2XGQA 3C21A 4NLNA 4C4SA 5JU5A 2G07A 3FC4A 1NJXA 1D8LA 4KLOA 3WK5A 2HSZA 4AYEC 4MHVA 1T8EA 1ZQDA 2LFUA 3AA1A 5KAIO 4B9UA 4ELTA 1NJZA 3KHLA 4YXMA 2DKZA 1T4GA 3SI8A 3FYXA 5DQIA 1OUQA 4C7ZA 2O4VA 5BOLA 3AUOA 4XRHA 1SKSA 1GFPA 3PQSA 5AKYA 5ALPA 2YN4A 3AAEB 2OCEA 5HHIA 1MA7A 2ZUBA 1XWLA 3AQEA 5J0QA 2XGPA 1ZHXA 2KFZA 3BQ0A 2M0NA 4FO6A 2QB1A 5D46A 1S0MA 2R8JA 3PORA 3KHHA 2PKEA 1YS5A 4UB5A 3PV8A 2Q0ZX 1SXEA 3T79A 2KHVA 2HCFA 2PMZF 1SIJA 3HKZC 4F8RA 5G26A 2LBOA 1JX4A 5AKGA 4C4TA 2HDOA 1NK8A 5CHGA 1Q3VA 2JEGA 3TAPA 3HRDD 3NJTA 1D8YA 1JRPA 4GFJA 4FSPA 2KVSA 2EAOA 2XE5A 4NLKA 5EWEA 4EZ9A 4IL6U 2DPJA 3IG8A 3LVVA 7ICJA 4FZNA 3N97B 3POUA 5ALIA 4IQTA 4YD2A 4DFKA 4RQ2A 1DRGA 2RHFA 5B66O 5KFPA 4NY8A 4AYMC 2JEIA 7ICSA 5KFJA 4YQWA 3ZDEA 3MFHA 4RLCA 3GFKB 2OHFA 4EEKA 1QQ6A 1G90A 4UAZA 3LWLA 2HHVA 1UT8A 2KN7A 3RJFA 5EE1A 4ECQA 4D5UA 1WG8A 2AQ4A 2DPIA 4GC6A 3RTVA 5J0WA 3M8SA 2YX8A 8ICXA 2AJQA 4LSHA 1ZHWA 4RL9A 5AK6A 4ED3A 4YMMA 1ZRNA 4QWEA 4DFPA 2W9MA 1ZQEA 1PVQA 3ZDCA 2R8IA 5ALQA 1U48A 2PMZC 5AK3A 2JQYA 3EW9A 4NXZA 3KBBA 5G39A 4O49A 1L7OA 5CA7A 2X9KA 2MUTB 5A0LA 3F5EA 2ZTEA 2H3FA 4QW8A 1IZNA 3VY9X 2WF6A 3PX4A 4O3OA 4J9MA 1Z1BA 2KZ3A 4BX9C 3QXGA 5AI6A 2K4TA 3UPGA 2LHTA 1Z4OA 3WKBA 3JPOA 4UQGA 4DWIA 4J9SA 4KLDA 2FDRA 5ALHA 2DBYA 3WU2O 5KFLA 3RH5A 8ICAA 4IR9A 1L8OA 4DFMA 5ALNA 3N4MB 7ICRA 5KFFA 2W9CB 1NK9A 1RQNA 1ZD2P 2LMRA 2ZXIA 2IBKA 1QSLA 2FJ6A 2KOBA 5KFAA 5C0YA 1SWWA 1TFRA 2R4LA 1SL1A 4UARA 1JROA 2WF8A 4IRKA 4QWBA 4JWNA 5J2EA 4RZRA 1F5SA 3BQTA 1XU4A 4TUQA 3C2KA 2V4RA 3I76A 5AFUL 3IM1A 2GOLA 4PGXA 3EPIA 4I2AA 5GTHU 5ALKA 1RZTA 3OTQA 2H3IA 3DEEA 4YN4A 4G9BA 4QWCA 3S6JA 1U4BA 8ICOA 4IR1A 1A77A 2Y9UA 2E8NA 4PJ0O 1LB2B 3PSIA 1ZQ1C 4P0QB 4NL9C 5KFRA 1BPDA 2XO7A 1BPXA 2K0LA 1CUKA 2KFNA 1KRPA 5L1LA 9ICOA 4I2IA 5AM2A 1NZPA 1PK1A 2ERVA 4DL5A 1F0MA 5ALXA 3NRZA 5DBAA 4UW9A 4E1TA 5K4LA 1GFNA 3UQ2A 5KFMA 5KTQA 4Y2QA 4AYNA 1SV4A 2XG6A 3VZWX 5J0UA 4O3SA 5IIOA 5ALUA 1TE2A 1U49A 4RQ3A 5J2DA 3H8WA 2YQEA 4I2CA 1V97A 5DGAA 9ICPA 3GIJA 3GIKA 2LPEA 4FT6A 1ZETA 3GV8B 4DCCA 1AROP 4OJ6A 2JEJA 1KDHA 4MEYA 4F4BA 3B9JA 3L3FX 4B9SA 1NKEA 4ELVA 2ZIVB 4M9NA 9ICUA 1S9FA 5HNKA 1SXDA 1N61A 4J9KA 3WKAA 1KKXA 4DQIA 3AA1B 3IN5A 3ICXA 3JPPA 4MF2A 1C20A 2OWOA 2BCUA 3SV3A 2GWSA 7ICKA 5HMMA 3MGVA 2FGRA 3EPGA 4GXJA 2RDIA 3QUTA 1BH3A 3KD3A 3WK7A 2P35A 4Z3TA 5KG1A 4P4PA 3SV4A 3GIMA 1ECWA 4I2HA 3K75D 5ALLA 2A1AA 1QCKA 5KFBA 1L7PA 2EANA 4F3OA 3MC1A 5G38A 5JTIA 5KT4A 5IINA 2KICA 8ICRA 4PGQA 3RJKA 4YMNA 5KFWA 2E5SA 3BQ2A 1ZYQA 5DGBA 4YVZA 4I28A 3NVYA 5GV0A 1XC9A 2W8LA 2BCSA 4G76A 3KVDD 5L9XA 2YNKA 4Y2RA 2XCPA 3DWNA 2HHQA 5KG5A 5IIIA 5J2IA 1UA0A 1BPZA 5KT5A 4GXIA 4GC7A 3SY7A 2F1IA 3RRGA 2BKEA 4J03A 3MR2A 3L4PA 4P4OA 2EAPA 1CRXA 3PW0A 5KFVA 3F2CA 2G08A 3T5LA 1WUDA 4O3NA 1YT3A 3ZD9A 4RQMA 2KIWA 1TVAA 3GP6A 9ICKA 3D2QA 4QIWF 2F1HA 1KW4A 3U26A 5KFHA 1SL0A 2R8HA 3HWBA 4DL6A 1HXUA 4CE6A 4LSFA 2KSOB 3PSTA 1T3QA 2YMPA 4M04A 4KN4A 5HP4A 3F5AA 5KT6A 4JV1A 1Z19A 2Y0KA 4ICAA 5ALRA 4F50A 4DSFA 2Q4TA 3H8JA 1KFSA 2UVRA 4F71A 1QQ7A 2C22A 1RQLA 3A2SX 1WWVA 4YG2A 3UU2A 2J6UA 3V6HA 1TAMA 3NVVA 5AICA 1SKWA 4QZEA 1JXEA 4Y2VA 5AI4A 3ED5A 2DGZA 1OSMA 3QU7A 5ALVA 4DLEA 3F2BA 3TFRA 3D2NA 9ICQA 2JMGA 2QB0A 4QWAA 2FPKA 4I2GA 4UB6U 3GZFA 2XIDA 4C8OA 4F4KA 5ALDA 2HOQA 4HYKA 2F8KA 1V9PA 3M6KA 1UT5A 1HEKA 5DL8A 4UB1A 2MSNA 2MAXA 3PO5A 4JCHA 2H3VA 8ICZA 1HUZA 2NRWA 3RB3A 1CEZA 7ICFA 2MUTA 4QIWC 2JXJA 2K8BB 1JN3A 3FM9A 1S0OA 2D3DA 5AM4A 3C1YA 3M1YA 2HHWA 3C1ZA 1NNLA 3RJIA 1B22A 3C28A 3PX0A 5E79O 3SAHA 3J81j 3OSNA 3EWAA 4Z6FA 3SD7A 1D9FA 2PXIA 2PI5A 4TURA 1X9MA 4EBDA 1WCLA 2W11A 2ZLDA 5IIJA 3MGIA 4O4UA 3WK9A 4Z6DA 1NK0A 2X27X 3PMNA 4O3XB 2BPCA 2DF4B 3SZVA 2I6XA 1URJA 4DF8A 2BHNA 3H4BA 5DG7A 2FMQA 3I1YA 2OM6A 9ICHA 5KFUA 1PHOA 1SWVA 2ZFGA 2H3ZA 3AA7B 2KXPA 8ICLA 4UB3A 3LVWA 2IHMA 8ICJA 2IWWA 4O3PA 1P7DA 3V7JA 1BNPA 2CXYA 4BDPA 3C2MA 4IRDA 2JV3A 3PR4A 3V6KA 1T3NA 4UASA 4F72A 1ZQTA 3PW5A 4FOZA 4USAA 3KZXA 4FBUA 4AYDC 5J29A 2WB1F 2ZJ8A 4RPXA 3V8UA 2ODJA 3LK3B 1ZQHA 5KFDA 3NASA 4RJXA 4P0QA 4EBEA 4B9VA 1N5WA 5KNIA 5DBCA 3A0BU 4KLGA 1BXWA 4BWMA 4RQ5A 4KMUA 3B0XA 3QUBA 5CJ7A 3RH6A 1KSPA 9ICBA 2YPVA 3G6VA 2Y0SF 1ZHTA 5B5EU 1ZD4A 1S5LU 2AXTU 2CRXA 3RFAA 4FESA 2FLNA 9ICJA 4UAWA 3QRCA 2ALZA 1D8BA 3KFUF 2K4EA 2A3VA 4FRTA 5ALMA 2R8KA 2Y0LA 4PH5A 5HR7A 3PSFA 8ICTA 5KT2A 4Q8FA 2BDUA 3TAQA 1ZQGA 4DOAA 4NM2A 2ODGA 9ICCA 2I5HA 5AKZA 4QZ9A 2ZIVA 3IRUA 4RQ1A 4FMSA 2P6UA 5AFUK 2XCAA 2WB1C 5KG6A 2ASLA 4MEXA 1KQQA 3OGUA 3RBHA 2K8AA 1Y88A 5KFTA 3SYZA 4C69X 1FFVA 4PHDA 2OH2A 1B43A 3WKCA 3SYBA 3HJEA 4FS2A 5KFGA 2Y0SC 4CDGA 7ICMA 2KZ7B 2XICA 1NK5A 2R8GA 4GCQA 5AKJA 5EWGA 1N56A 5J0SA 5AM0A
chains in the Genus database with same CATH topology
4RJWA 2W80C 5AFUL 1MM4A 1QJ9A 2GOLA 1BT9A 3AAEA 2G06A 4N58A 5DL7A 3VCBA 2XI9A 2H3IA 3DEEA 5HR6A 1Q9GA 2OYYA 3TZGA 3AL0B 4AYBC 1KBUA 3CRXA 3VE2A 3PSIA 3G7GA 1ZQ1C 2Y0HA 4P0QB 4FE3A 2K0LA 2ZXHA 1P4TA 2RP5A 5FVNA 4AFKA 4O4XA 2E1EA 4NLCA 2CPRA 2MRLA 2ERVA 4FZLA 1HXXA 4E1TA 1GFNA 2H3QA 5KL8B 2OXOA 2KV2A 4AYNA 4NV0A 3VE1A 2XG6A 4AKRA 4IC9A 3VZWX 3ONNA 3T0SA 4C0ZA 4KR8A 4U7CA 3AAAB 3C29A 3C5OA 2W04A 2HBKA 4U9CA 3HOEA 2K4HA 1F44A 2YB1A 3K1ZA 1ZHZA 3LK2B 4FT6A 4GF4A 3H0RB 5ADXL 3CP8A 3CYMA 4NLBA 2W03A 2VKQA 3SMVA 3O0FA 4OJ6A 2HOFA 4G75A 4F4BA 3AQFA 2PORA 3L3FX 4P0PB 2ZIVB 1MM5A 1HXTA 1IZNB 2MHLA 1PRNA 2XMXA 3WI5A 4CGZA 3SY9A 3AA1B 2FGQX 2ZIXB 2J1NA 3IN5A 2XE1A 3WI4A 3PRNA 2XVTA 2W7OA 1T94A 3ICXA 2N2LA 5DL6A 4NWIA 4KMOB 4QJFB 4WJ3B 3MGVA 4LSIA 3HOLA 2FGRA 4O3ZA 2PRNA 1THQA 2Z7JA 1BH3A 4ACOA 4Z3TA 2GH1A 3M7DA 1ECWA 2VIXA 4BJQA 4CRXA 3AA6A 2F1VA 4PUXA 2KD1A 4PL2A 3VZUX 2NV3A 3ALRA 2KICA 5D5DA 4OJOA 2KXPB 2E5SA 2N2MA 2ZIWB 3T24A 1A0PA 5GV0A 1H6S1 2R18A 3UAQA 2D6FC 2W81C 2J4UP 1NZBA 4G76A 3AA0A 3KVDD 2YNKA 2VJ5A 2K8CB 4GHBA 2KJ9A 3IP4B 4FUVA 3SY7A 3AA7A 1CRXA 3LK42 5T14A 3H0MB 2M06A 2YB4A 4QNLA 3SAGA 3F2CA 2G08A 5ADXK 2HBLA 4JFBA 1WUDA 1YT3A 2KIWA 3GP6A 3D2QA 5T5FA 2KHQA 4XNKA 3M6ZA 4QIWF 2KJ8A 3H0LB 2G5HB 2HOIA 4AKRB 3HWBA 2KJ5A 1A6SA 2JMMA 1HXUA 4LSFA 3PSTA 3LK3A 3N7PD 4KR4A 3EMNX 2KC0A 3F5AA 2G09A 4AZLA 3T20A 1Z19A 2Y0KA 4ICAA 3SZDA 2F2AB 3SYSA 2Q4TA 2XTRA 4FZMA 3VZTX 2W7PA 3JTYA 4JMUA 3K19A 4AYID 3HW9A 2KVCA 3A2SX 4RLBA 3UU2A 2XTQA 1GFQA 1ZHYA 1TAMA 4GCSA 2HBJA 4A8EA 2Y2XA 4O3YA 2LYBA 2DGZA 2G0AA 1OSMA 3O0EA 3F2BA 3D2NA 2XE2A 2JMGA 3N7RC 2ZG6A 2E1FA 2LYAA 3HKZF 3GZFA 4B61A 3PQUA 2XIDA 2JH7A 1XO0A 2KDYA 2HOQA 4GCPA 3M6KA 3PSPA 2OMFA 1MPFA 1HEKA 2RRDA 3E0FA 1XNSA 5DL8A 3POQA 2G07A 2LKYA 5PRNA 4KX3A 4KRAA 5DL5A 2KEYA 4JCHA 3NUQA 4P0PA 2H3VA 4AYEC 4QIWC 1IIPA 2K8BB 2XE3A 3AA1A 2LFUA 4N59A 2LHFA 4LSEA 3SQIA 3FYXA 2F1TA 1OUQA 2O4VA 2F8LA 3C28A 3SAHA 1GFPA 3PQSA 1SZHA 4AKMA 3AAEB 1MA7A 2ZLDA 5JDPA 2ZIUA 3PZPA 4O4UA 2MA1A 3AQEA 1ZHXA 2X27X 1E54A 4O3XB 2DF4B 3SZVA 2M0NA 1URJA 3D2SA 2WAQF 1L6NA 2KZ7A 3PORA 5CRXA 2OM6A 3POXA 1YS5A 1PHOA 3VY8X 8PRNA 4D64A 2ZFGA 2H3ZA 3AA7B 2HMXA 3T79A 2KHVA 2KXPA 3LVWA 2ZIWA 2PMZF 3HKZC 5G26A 1P7DA 2LBOA 4E1SA 4FOZA 1Q3VA 3KZXA 2VJ4A 4GFJA 4AYDC 4FSPA 2WB1F 2XE5A 1QJ8A 3V8UA 2ODJA 3LK3B 3IG8A 3LVVA 4RJXA 4P0QA 4FZNA 4QQ1A 3POUA 1DRGA 2RHFA 1BXWA 1GFOA 2CN1A 4OJPA 4AYMC 4U6PA 5KL1B 1Q9FA 2YPVA 3DA3A 2K89A 3NRWA 2Y0SF 1ZHTA 4RLCA 4O3MA 3GU3A 3QRAA 4BUMX 1G90A 3RF9A 5IYUA 2KKPA 2CRXA 3SAFA 1Q3UA 7PRNA 3OPXA 3RFAA 4FESA 4D5UA 2HBMA 3AAAA 2KNJA 2G5IB 3QRCA 1ED1A 3VC8A 1D8BA 3KFUF 6PRNA 2WAQC 2K4EA 1GO3F 2YX8A 2A3VA 4LSHA 2K4IA 1ZHWA 4RL9A 4FRTA 2Y7SA 4OJLA 2F77X 2Y0LA 1PVQA 1PVRA 5HR7A 3LK2A 2QTKA 2PMZC 3PSFA 4O3WA 4AYBF 3F53A 2BDUA 4PL1A 3N7SC 1OPFA 4O49A 4FSOA 5EE2A 5A0LA 3IG5A 3F5EA 3AA6B 2ZIVA 2H3FA 1IZNA 3LYSA 3VY9X 4FMSA 4FRXA 5AFUK 4XNLA 1QJPA 1Z1BA 2WB1C 4OO1J 4BX9C 2K4TA 3DA4A 2ZIXA 3UPGA 2LHTA 2K8AA 1PVPA 3RBHA 2GE4A 2KKVA 4C69X 2OH2A 2JGAA 2JHDA 2JH1A 1ORMA 3F2DA 2MNHA 2N1RA 4OJ5A 3SYBA 4KX5A 2ZIUB 1GFMA 4D65A 2ZXIA 3AA0B 2Y0SC 2F76X 4CDGA 2KOBA 2DQNB 5C0YA 2KZ7B 2XICA 3LK41 1UPHA 4AUIA 4GCQA 1HIWA 4BUGA 2M07A 3NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMX A;  4FZL A;  4G76 A;  3DA3 A;  2XTR A;  2XTQ A;  4FZM A;  4G75 A;  4N58 A;  4N59 A;  4FZN A;  3DA4 A; 
#chains in the Genus database with same CATH topology
 1BPE A;  5DB9 A;  9ICS A;  4RJW A;  5JUM A;  4NL9 A;  2YTU A;  2HVH A;  1BPB A;  3MAB A;  5ALS A;  2ZTC A;  4M9L A;  4ED6 A;  5DL7 A;  4EX7 A;  4Y2T A;  3WK4 A;  1Q9G A;  1RG6 A;  3R9K A;  9ICT A;  3JPQ A;  2KIV A;  4QZG A;  8ICK A;  4RPY A;  1L3V A;  4QZI A;  3RBD A;  3LDA A;  2RP5 A;  3K4G A;  3G6X A;  3Q8R B;  1PUZ A;  3PY8 A;  4NLC A;  1XSN A;  5KG2 A;  4UAU A;  4QZ8 A;  2A19 A;  2NRZ A;  2H3Q A;  5CB1 A;  2BQ3 A;  3UMG A;  2PFQ A;  5ALW A;  4UB4 A;  2KV2 A;  1X6I A;  5KFN A;  3VE1 A;  4IC9 A;  3ONN A;  2WF7 A;  4FBT A;  5KAF O;  3T0S A;  4C0Z A;  4F5P A;  3AAA B;  3C29 A;  2QB0 B;  2KSO A;  4Y2U A;  4BXO A;  4IRC A;  2HVI A;  2B21 A;  2HBK A;  3M9O B;  1L5U A;  1ZQX A;  3HOE A;  1DGJ A;  1NK4 A;  2KZM A;  7ICV A;  2K4H A;  4XUS A;  5KAI U;  3NGD A;  2W8K A;  1F44 A;  2F3N A;  2YB1 A;  5HHH A;  8ICS A;  3CW2 C;  3LK2 B;  2FPM A;  3ZD8 A;  4GF4 A;  3H0R B;  5G5H A;  2Y9T A;  4O5C A;  5ADX L;  3CP8 A;  3CYM A;  3SMV A;  9ICE A;  2PI4 A;  9ICX A;  5BPC A;  4M0A A;  3QUQ A;  5DG8 A;  5ALE A;  5KFZ A;  2HOF A;  2DUY A;  1O08 A;  3AQF A;  4R63 A;  1MM5 A;  1HXT A;  4Y2J A;  2JZB B;  5DB8 A;  4B9L A;  3SY9 A;  3V7L A;  3ZI4 A;  4DSK A;  2PFN A;  4RU9 A;  1V85 A;  4KMO B;  4NWI A;  4QJF B;  4EEY A;  2FI1 A;  3HOL A;  1IV8 A;  4UAV A;  4BWJ A;  1X40 A;  1L3U A;  2O6K A;  2DKX A;  3RB6 A;  3ISD A;  2C28 A;  2KTQ A;  2GH1 A;  3M7D A;  2VIX A;  1ZXI A;  1JXL A;  3AA6 A;  4PUX A;  2KD1 A;  1IM4 A;  3VZU X;  3ALR A;  1BVS A;  1NJW A;  1RM6 C;  4ELU A;  3K1R B;  3Q8Q B;  5KFO A;  2KXP B;  2N2M A;  2HHU A;  3PF1 A;  4ECU A;  4EZ6 A;  4Q44 A;  4EBC A;  4RQ6 A;  3BJY A;  4RT3 A;  1A0P A;  1YZ7 A;  1RDF A;  5IIL A;  3RBE A;  1H6S 1;  3UAQ A;  2D6F C;  3MGH A;  1NZB A;  5JRT A;  3AA0 A;  3BS7 A;  2GO7 A;  5EE3 A;  3DV9 A;  4PGY A;  3GDX A;  4GHB A;  2I1Q A;  3PW2 A;  3IP4 B;  1RXW A;  2BPF A;  2J6T A;  4EEL A;  3RR7 A;  5TIS O;  3PW7 A;  4FUV A;  3PO4 A;  8ICY A;  2IOF K;  4ECZ A;  4CCH A;  3AA7 A;  4DSL A;  2HI0 A;  4DSE A;  3H0M B;  4CTD A;  5G3A A;  2ZTD A;  3QZ8 A;  3SAG A;  2HBL A;  3TAC B;  4TQS A;  5D49 A;  1TK8 A;  1U9L A;  4M47 A;  2RDJ A;  5BOM A;  4ED1 A;  2KJ8 A;  4AKR B;  4X5V A;  1A6S A;  3KHG A;  5L1K A;  2R4O A;  2EZY A;  3LK3 A;  4YR2 A;  2IOH A;  1ZQZ A;  2AGQ A;  5ALZ A;  5F3X B;  4QZH A;  4O5K A;  3EMN X;  1ZRM A;  2G09 A;  3T20 A;  8ICW A;  3QU5 A;  4FZM A;  1KTQ A;  3HT3 A;  4QWD A;  1RXV A;  2KVC A;  4TUP A;  8ICQ A;  2F1C X;  1GFQ A;  3WU2 U;  1RYS A;  2B6G A;  3BZC A;  2LYB A;  2G0A A;  3O0E A;  4RQ7 A;  2M9N A;  9ICV A;  2DL0 A;  2ZG6 A;  2E1F A;  7ICH A;  2LYA A;  1X66 A;  5GTI O;  2BQU A;  9ICM A;  1ZQF A;  4J9P A;  3PQU A;  1ZQC A;  4UBB A;  2MU2 A;  4MFF A;  5KFK A;  1T7P A;  1NOM A;  4OCZ A;  5ALY A;  3E0F A;  1XNS A;  3QE9 Y;  1S76 D;  2LKY A;  3AM9 A;  4KX3 A;  4DSI A;  4KRA A;  5DL5 A;  3RAQ A;  3QX7 A;  2IMW P;  2UVU A;  1ZD5 A;  4P0P A;  1K1Q A;  5G5G A;  8ICN A;  2W55 A;  3QUC A;  4US8 A;  4N59 A;  4K4I A;  3Q8K A;  4PJ0 U;  3JPR A;  3SQI A;  1XO1 A;  4UB8 O;  1Q8K A;  4J9N A;  3GIL A;  2F8L A;  2VA8 A;  4QW9 A;  5KFI A;  1SZH A;  4AKM A;  2XY7 A;  3DWO X;  4OD0 A;  5JDP A;  5KT7 A;  3PZP A;  3PGR A;  1ZQP A;  4J9Q A;  3QEA Z;  1E54 A;  1N63 A;  3SZ2 A;  2QKQ A;  1L6N A;  2KZ7 A;  3VY8 X;  8PRN A;  3T5H A;  2HMX A;  3M9N B;  4IS7 A;  4KIT B;  5AHX A;  5EOZ A;  2R4N A;  4RUC A;  3TI0 A;  1JIH A;  4FS1 A;  5J0P A;  4R65 A;  1XSP A;  3LK9 A;  4IQW A;  3NTU A;  3ZDB A;  5ALO A;  5IIM A;  3RJJ A;  1SKR A;  5J0X A;  3MR3 A;  2VJ4 A;  5J2G A;  3C5G A;  5KG3 A;  5KFC A;  1XS9 D;  4PHE A;  1L8L A;  1KFT A;  1X6J A;  5EE0 A;  4XA5 A;  1ZQN A;  1QJ8 A;  3HP6 A;  4EYI B;  2Y1I A;  2H5X A;  2LM4 A;  1DK2 A;  4BXO B;  3OJS A;  4Z6C A;  3A0H O;  4KLH A;  4DS4 A;  1GFO A;  2CN1 A;  1PZN A;  2NO5 A;  5D4B A;  4NLZ A;  1JUD A;  4U6P A;  5C5J A;  4YMO A;  2EH9 A;  1H38 A;  1QSY A;  3GU3 A;  4LJX A;  3TAD A;  3TFS A;  1KLN A;  3RF9 A;  2ZUC A;  1ZQW A;  1KN5 A;  2WVP A;  5EE9 A;  5IIK A;  7PRN A;  4JV2 A;  4FFD A;  1RYU A;  4F5O A;  5H2F O;  4Q45 A;  2HBM A;  4F92 B;  5AI5 A;  3AAA A;  2KNJ A;  2G5I B;  4DQQ A;  1ED1 A;  2F1J A;  6PRN A;  2W3R A;  1GO3 F;  2K4I A;  2VA3 A;  2Y7S A;  4M9G A;  1VJ5 A;  1ZOL A;  2HHT A;  9ICL A;  3LK2 A;  2QTK A;  4O3W A;  4AYB F;  3F53 A;  1S77 D;  4YR0 A;  4PL1 A;  4ECW A;  2YMQ A;  3IG5 A;  1A76 A;  3AA6 B;  3A0B O;  2WJQ A;  3T3F A;  3LYS A;  4FRX A;  3AEV A;  2JZB A;  1TK0 A;  3SEI A;  4OO1 J;  2GE4 A;  2KKV A;  2JRZ A;  2LYH A;  3UMC A;  4DOC A;  4F4Y A;  3PVX A;  3JPT A;  3KOO A;  2AXT O;  5DDY A;  2JGA A;  2JHD A;  4PHP A;  3PW4 A;  3QZ7 A;  2MNH A;  4B9M A;  4OJ5 A;  1B0X A;  2ZIU B;  3FDS A;  8ICG A;  2EAM A;  2L5Y A;  2BQR A;  4KLQ A;  1KEJ A;  3AA0 B;  1TK5 A;  4RNM A;  3QYP A;  8ICE A;  2DQN B;  2HW3 A;  4JB3 A;  1N62 A;  4M6W B;  3LK4 1;  1UPH A;  7ICN A;  2RQ5 A;  3FAH A;  8ICF A;  4AUI A;  1HIW A;  4US9 A;  2JR5 A;  4I2B A;  3QU9 A;  2QAR A;  4DL3 A;  3NSG A;  4Y2X A;  4QZA A;  2W80 C;  2AHO B;  2K60 A;  1MM4 A;  3IV6 A;  1OW5 A;  2G06 A;  4N58 A;  7ICE A;  3VCB A;  7ICP A;  1S97 A;  2KE7 A;  5HR6 A;  8ICU A;  5KG7 A;  4P4M A;  3AL0 B;  4TQR A;  3KTQ A;  4AYB C;  3FYH A;  1KBU A;  3G7G A;  1Z00 B;  3UM9 A;  3TKA A;  3BRY A;  4FE3 A;  1ZQS A;  2ZXH A;  1P4T A;  4JUZ A;  4F5Q A;  5J0O A;  4AFK A;  4O4X A;  2V9W A;  9ICF A;  2EDU A;  2A1J B;  3Q8S B;  2JEF A;  4DL4 A;  1HXX A;  1COO A;  4KLJ A;  4ECR A;  4CF4 A;  1FEZ A;  1D9D A;  4KLL A;  5J2J A;  4AKR A;  5J2K A;  5L1M A;  4KR8 A;  2FMP A;  1MN8 A;  2W04 A;  1Z1V A;  5J8Y C;  3GV5 B;  2W43 A;  5DQG A;  4U9C A;  4LZD A;  4F5N A;  3RJE A;  4C8N A;  1ZHZ A;  3TAD C;  4C4V A;  5AKH A;  2LI6 A;  4E0D A;  3O0F A;  4IL6 O;  4F2S A;  5AIB A;  4R66 A;  1UHU A;  1RYR A;  2POR A;  2F44 A;  5DB6 A;  4P0P B;  4YR3 A;  4FQE A;  4PR7 A;  1N5X A;  4CGZ A;  2FGQ X;  2ZIX B;  2J1N A;  2XE1 A;  2R88 A;  2XVT A;  2KG5 A;  3KZI U;  2W7O A;  1UQV A;  1T94 A;  1ZQU A;  5DL6 A;  5AI0 A;  3OSP A;  4LSI A;  2RLT A;  5AK5 A;  4KLM A;  1VDV A;  3UQ0 A;  4GLX A;  4K3C A;  2EZZ A;  2Z7J A;  3C23 A;  3OHA A;  4DFD A;  5ALG A;  3HX0 A;  3PGU A;  4CRX A;  8ICI A;  5TZV A;  2F1V A;  4ED2 A;  4GIB A;  2WHE A;  2QLT A;  2KK0 A;  4I2E A;  3AU6 A;  1XSL A;  5AM1 A;  9ICN A;  2AGO A;  1RPL A;  1Z3E B;  3T24 A;  4ECT A;  1QTM A;  1MQ2 A;  2E8M A;  4RUA A;  1O03 A;  4MF8 A;  1COK A;  1J2N A;  5J2H A;  3ZDA A;  2W81 C;  2J4U P;  1J97 A;  2ESE A;  1MC8 A;  1L3S A;  3V6J A;  2WF9 A;  1SZP A;  5J0Y A;  2VJ5 A;  2K8C B;  3TQ1 A;  2LM1 A;  1QQ5 A;  2KJ9 A;  3RJH A;  3SEN A;  4I27 A;  3JPN A;  5KFX A;  1B4F A;  1ZJN A;  2GLE A;  4M9H A;  4NLG A;  1OXJ A;  3M8R A;  3EUB 2;  5T14 A;  3EZ5 A;  2M06 A;  4IQU A;  9ICR A;  4JFB A;  1FIQ A;  3LWM A;  3MBY A;  3WK6 A;  9ICA A;  5DQH A;  4TUS A;  5DLF A;  1HJP A;  4YCX A;  5T5F A;  3M6Z A;  2BR0 A;  7ICT A;  4R8U B;  2FLL A;  3H0L B;  4QZC A;  4LVS A;  1NK7 A;  2KJ5 A;  2WTF A;  5AKI A;  5KG0 A;  4DL2 A;  4LZG A;  4ECX A;  4RQ0 A;  1TAU A;  4QZB A;  4KR4 A;  3H7I A;  1ZQB A;  1N60 A;  4N75 A;  1T1L A;  5J2A A;  2FE9 A;  3SZD A;  5GTH O;  2XTR A;  5KFE A;  3MR6 A;  3VZT X;  3JTY A;  4EEN A;  4JMU A;  3K19 A;  1C7Y A;  1LKY A;  3HW9 A;  2R8A A;  4F4X A;  2XTQ A;  3AN1 A;  2ISP A;  2IOF A;  4YD1 A;  5KFQ A;  4N74 A;  1DGS A;  3PML A;  4GCS A;  2HBJ A;  4DQR A;  4A8E A;  2Y2X A;  4O3Y A;  4F5R A;  3GV7 B;  2XE2 A;  4O3Q A;  3E58 A;  3N7R C;  1PK3 A;  1QSS A;  4DQP A;  8ICV A;  2K4P A;  5DG9 A;  3T5K A;  5AKX A;  4K4G A;  4JK1 A;  5AM5 A;  9ICG A;  4GCP A;  3PSP A;  2OMF A;  4EYH B;  1MPF A;  2RRD A;  5ALT A;  5AI9 A;  4PHA A;  3POQ A;  3RR8 A;  1Q46 A;  5PRN A;  4F91 B;  4C00 A;  2KEY A;  3ORY A;  3NUQ A;  1SV0 C;  3PNC A;  1ZQL A;  3ETL A;  3UXO A;  3C5F A;  3V72 A;  1IIP A;  2XE3 A;  2E8O A;  3BS5 A;  4YP3 A;  3RB4 A;  2LHF A;  4LSE A;  1HUO A;  4Y2S A;  2QAR B;  2F1T A;  2ISO A;  3D6J A;  3UXP A;  7ICI A;  4YFK A;  4GXK A;  1WWU A;  4C8M A;  4CF5 A;  1DXS A;  1N2X A;  2E3T A;  4XQ8 A;  2FMS A;  3ZDD A;  2ZIU A;  5F9L A;  5B66 U;  2IHN A;  2MA1 A;  4Q8E A;  5ALF A;  1MSW D;  2PFP A;  1K5O A;  1NKB A;  3D2S A;  2WAQ F;  3BRZ A;  3NVW A;  4M6W A;  5CRX A;  3Q8P B;  3POX A;  4D64 A;  4Y2Y A;  3V7K A;  5KAF U;  2HHS A;  3NS1 A;  3QU2 A;  2ZIW A;  1MQ3 A;  2W9A A;  1BPY A;  1JMS A;  1ZQK A;  1S8O A;  4E1S A;  3QU4 A;  3BZK A;  5HML A;  1NK6 A;  2BCQ A;  4EX6 A;  1IXR A;  4DLG A;  4YXJ A;  1NI3 A;  5L1I A;  4C8K A;  2J6S A;  4J9O A;  1IG6 A;  3RH4 A;  2ZJ5 A;  4M2Y A;  4DQS A;  3H8M A;  1Z00 A;  5J2B A;  4O0I A;  4QQ1 A;  4RQ8 A;  7ICQ A;  4QZF A;  4RT2 A;  4P2H A;  2A1J A;  4OJP A;  5KL1 B;  5KFS A;  1Q9F A;  3DA3 A;  2K89 A;  3NRW A;  4C4V B;  3AMZ A;  7ICL A;  4Q43 A;  2FPL A;  1L7M A;  4UBC A;  4O3M A;  4DOB A;  3QRA A;  5J0R A;  2NRT A;  4BUM X;  2KKP A;  1TV9 A;  2I9G A;  2D8C A;  3SAF A;  1Q3U A;  1SL2 A;  3OPX A;  3IDW A;  4F4W A;  4Y2P A;  1BGX T;  3VC8 A;  1X9W A;  2WAQ C;  2OEH A;  4M9J A;  4ECS A;  4RPZ A;  3THV A;  4F93 B;  2C2D A;  3N28 A;  3HW8 A;  4OJL A;  2W9B A;  3H40 A;  2F77 X;  5AKE A;  1JAL A;  1PVR A;  2W54 A;  4UAY A;  3B0Y A;  3M9M B;  1LVH A;  2V4Q A;  3RRH A;  2KZZ A;  2ZUD A;  4O9M A;  3N7S C;  1OPF A;  4C80 A;  4FSO A;  4DEZ A;  3PGS A;  5EE2 A;  3WKD A;  2DWQ A;  4XNL A;  1QJP A;  4UB2 A;  3ISC A;  2BZF A;  4AP9 A;  3DA4 A;  2ZIX A;  2ZJA A;  2YML A;  1ZQM A;  5AK4 A;  1PVP A;  4ECV A;  5TIS U;  5AM3 A;  5J2C A;  4PPX A;  3TAN A;  2FLP A;  4RQ4 A;  2ES6 A;  1X2I A;  2JH1 A;  1ORM A;  3MDA A;  3F2D A;  2N1R A;  1ZQQ A;  3ETR A;  4KX5 A;  2R89 A;  2R4P A;  1GFM A;  4ZOH C;  4NM1 A;  1ZQY A;  4D65 A;  2NRX A;  4ED7 A;  2F76 X;  4UB6 O;  4F4Z A;  1L3T A;  2Y1J A;  8ICC A;  3Q8M A;  3GII A;  2PFO A;  3BS0 A;  8ICH A;  2B0C A;  4ED8 A;  4BUG A;  2M07 A;  5IYU A;  4PZN A;  5ALJ A;  2WFA A;  2E8P A;  3UXN A;  1QJ9 A;  1BT9 A;  3MFI A;  3AAE A;  5DLG A;  1U45 A;  2UVW A;  2XI9 A;  4KLF A;  1SGG A;  3TAR A;  4JWM A;  2OYY A;  3TZG A;  8ICM A;  4KLI A;  4I2D A;  3WKE A;  3CRX A;  2ATL A;  3VE2 A;  1ZQV A;  2Y0H A;  4MFA A;  1ZQI A;  1ZQJ A;  3KKA A;  4MFC A;  3BDP A;  5FVN A;  2AU0 A;  2E1E A;  3GQC A;  4DFJ A;  3OJU A;  1AQ6 A;  3BQ1 A;  2CPR A;  4I2F A;  2MRL A;  5GTI U;  3HWT A;  5AIA A;  4IQV A;  5J8Y A;  5DBB A;  4FZL A;  3PX6 A;  3Q8L A;  3UMB A;  2VAN A;  1FO4 A;  1LKY B;  1U47 A;  4R64 A;  5KL8 B;  2OXO A;  4R8U A;  4JV0 A;  3AU2 A;  4NV0 A;  5DB7 A;  2DFL A;  3C2L A;  2AQ0 A;  4U7C A;  2P66 A;  5F9N A;  3UPQ A;  4RNN A;  3C5O A;  3MR5 A;  2NO4 A;  4B9T A;  1DK3 A;  7ICU A;  4Z6E A;  9ICW A;  1TKD A;  2IWV A;  4PZO A;  3K1Z A;  2KMD A;  2C2R A;  1UA1 A;  4UB8 U;  2YMM A;  1UCV A;  4ECY A;  4NLB A;  2W03 A;  2VKQ A;  1YZ6 A;  3QEB Z;  7ICG A;  2ASD A;  4G75 A;  3ISB A;  1X9S A;  4B9N A;  1IZN B;  4K4H A;  2MHL A;  1PRN A;  1ZQO A;  4B6J A;  1X9X A;  2BCR A;  2XMX A;  3WI5 A;  2AH5 A;  3BS5 B;  3WI4 A;  3PRN A;  4KLT A;  2UVV A;  3H4D A;  1LV5 A;  2N2L A;  3BQ7 A;  5DDM A;  5B5E O;  4WJ3 B;  4CF3 A;  3OHB A;  1S5L O;  4HAI A;  3PR5 B;  4O3Z A;  2PRN A;  3H8S A;  4KLS A;  1X42 A;  2AGP A;  1THQ A;  3RJG A;  4ACO A;  1NKC A;  4I2J A;  1K1S A;  2XC9 A;  4BJQ A;  4K3B A;  2XY5 A;  4PL2 A;  3I28 A;  2NV3 A;  2NRV A;  2VA2 A;  5D5D A;  1SB3 C;  4OJO A;  3QNM A;  3E2E A;  2BGW A;  2ZIW B;  4DL7 A;  3CNH A;  1M6Y A;  4F2R A;  1FFU A;  1TAQ A;  4QZD A;  3A0H U;  1S0V A;  3NVZ A;  4NJ8 A;  5J2F A;  1WYG A;  2R18 A;  2W9C A;  2XY6 A;  2P6R A;  3HIL A;  4UAT A;  8ICP A;  3WK8 A;  2ASJ A;  4RQN A;  4DF4 A;  2W3S A;  3KZI O;  5CWR A;  1ZQR A;  1DOQ A;  1T16 A;  5AKL A;  5KFY A;  1EXN A;  4O3R A;  5CP2 A;  3KHR A;  4G3I A;  1L7N A;  1KFD A;  5H2F U;  3LK4 2;  4O5E A;  3EYZ A;  4KTQ A;  2YB4 A;  4QNL A;  1PK1 B;  5ADX K;  5CEH A;  1S10 A;  4KLE A;  1J2M A;  5J0T A;  2KHQ A;  4XNK A;  2EZX A;  2BPG A;  2NYV A;  5L1J A;  5AKK A;  2HHX A;  5DKW A;  1ZJM A;  2G5H B;  3DDH A;  4BGD A;  3G6Y A;  2HOI A;  1NJY A;  1VLB A;  2WF5 A;  1CI4 A;  1WCN A;  2EQY A;  4I29 A;  2JMM A;  1N48 A;  3KKA C;  4KLU A;  7ICO A;  1QLN A;  3N7P D;  4J9L A;  2KC0 A;  2YY6 A;  4AZL A;  2WJR A;  3SR6 A;  8ICB A;  2F2A B;  3SYS A;  1V38 A;  4ED0 A;  2W9B B;  3DZM A;  2W7P A;  1Z4N A;  4AYI D;  4ZH4 A;  4RNO A;  4RLB A;  3RAX A;  4C4R A;  5CR0 A;  1ZHY A;  2C2E A;  5E79 U;  2BDP A;  1ZQA A;  1KL9 A;  1QH9 A;  3T5J A;  2IA6 A;  5KG4 A;  3JCU O;  2BCV A;  3IHQ B;  1S0N A;  3RB0 A;  3L5K A;  3MDC A;  3HKZ F;  4C7Y A;  2KP7 A;  4B61 A;  1SV0 A;  5AI8 A;  4C8L A;  2JH7 A;  4CNQ A;  1XO0 A;  3JPS A;  9ICI A;  5EWF A;  1ZD3 A;  4DS5 A;  2KDY A;  5KT3 A;  1BNO A;  5FP0 A;  3HPO A;  4J9R A;  4DO9 A;  4DSJ A;  1JI7 A;  4KN7 A;  2XGQ A;  3C21 A;  4NLN A;  4C4S A;  5JU5 A;  2G07 A;  3FC4 A;  1NJX A;  1D8L A;  4KLO A;  3WK5 A;  2HSZ A;  4AYE C;  4MHV A;  1T8E A;  1ZQD A;  2LFU A;  3AA1 A;  5KAI O;  4B9U A;  4ELT A;  1NJZ A;  3KHL A;  4YXM A;  2DKZ A;  1T4G A;  3SI8 A;  3FYX A;  5DQI A;  1OUQ A;  4C7Z A;  2O4V A;  5BOL A;  3AUO A;  4XRH A;  1SKS A;  1GFP A;  3PQS A;  5AKY A;  5ALP A;  2YN4 A;  3AAE B;  2OCE A;  5HHI A;  1MA7 A;  2ZUB A;  1XWL A;  3AQE A;  5J0Q A;  2XGP A;  1ZHX A;  2KFZ A;  3BQ0 A;  2M0N A;  4FO6 A;  2QB1 A;  5D46 A;  1S0M A;  2R8J A;  3POR A;  3KHH A;  2PKE A;  1YS5 A;  4UB5 A;  3PV8 A;  2Q0Z X;  1SXE A;  3T79 A;  2KHV A;  2HCF A;  2PMZ F;  1SIJ A;  3HKZ C;  4F8R A;  5G26 A;  2LBO A;  1JX4 A;  5AKG A;  4C4T A;  2HDO A;  1NK8 A;  5CHG A;  1Q3V A;  2JEG A;  3TAP A;  3HRD D;  3NJT A;  1D8Y A;  1JRP A;  4GFJ A;  4FSP A;  2KVS A;  2EAO A;  2XE5 A;  4NLK A;  5EWE A;  4EZ9 A;  4IL6 U;  2DPJ A;  3IG8 A;  3LVV A;  7ICJ A;  4FZN A;  3N97 B;  3POU A;  5ALI A;  4IQT A;  4YD2 A;  4DFK A;  4RQ2 A;  1DRG A;  2RHF A;  5B66 O;  5KFP A;  4NY8 A;  4AYM C;  2JEI A;  7ICS A;  5KFJ A;  4YQW A;  3ZDE A;  3MFH A;  4RLC A;  3GFK B;  2OHF A;  4EEK A;  1QQ6 A;  1G90 A;  4UAZ A;  3LWL A;  2HHV A;  1UT8 A;  2KN7 A;  3RJF A;  5EE1 A;  4ECQ A;  4D5U A;  1WG8 A;  2AQ4 A;  2DPI A;  4GC6 A;  3RTV A;  5J0W A;  3M8S A;  2YX8 A;  8ICX A;  2AJQ A;  4LSH A;  1ZHW A;  4RL9 A;  5AK6 A;  4ED3 A;  4YMM A;  1ZRN A;  4QWE A;  4DFP A;  2W9M A;  1ZQE A;  1PVQ A;  3ZDC A;  2R8I A;  5ALQ A;  1U48 A;  2PMZ C;  5AK3 A;  2JQY A;  3EW9 A;  4NXZ A;  3KBB A;  5G39 A;  4O49 A;  1L7O A;  5CA7 A;  2X9K A;  2MUT B;  5A0L A;  3F5E A;  2ZTE A;  2H3F A;  4QW8 A;  1IZN A;  3VY9 X;  2WF6 A;  3PX4 A;  4O3O A;  4J9M A;  1Z1B A;  2KZ3 A;  4BX9 C;  3QXG A;  5AI6 A;  2K4T A;  3UPG A;  2LHT A;  1Z4O A;  3WKB A;  3JPO A;  4UQG A;  4DWI A;  4J9S A;  4KLD A;  2FDR A;  5ALH A;  2DBY A;  3WU2 O;  5KFL A;  3RH5 A;  8ICA A;  4IR9 A;  1L8O A;  4DFM A;  5ALN A;  3N4M B;  7ICR A;  5KFF A;  2W9C B;  1NK9 A;  1RQN A;  1ZD2 P;  2LMR A;  2ZXI A;  2IBK A;  1QSL A;  2FJ6 A;  2KOB A;  5KFA A;  5C0Y A;  1SWW A;  1TFR A;  2R4L A;  1SL1 A;  4UAR A;  1JRO A;  2WF8 A;  4IRK A;  4QWB A;  4JWN A;  5J2E A;  4RZR A;  1F5S A;  3BQT A;  1XU4 A;  4TUQ A;  3C2K A;  2V4R A;  3I76 A;  5AFU L;  3IM1 A;  2GOL A;  4PGX A;  3EPI A;  4I2A A;  5GTH U;  5ALK A;  1RZT A;  3OTQ A;  2H3I A;  3DEE A;  4YN4 A;  4G9B A;  4QWC A;  3S6J A;  1U4B A;  8ICO A;  4IR1 A;  1A77 A;  2Y9U A;  2E8N A;  4PJ0 O;  1LB2 B;  3PSI A;  1ZQ1 C;  4P0Q B;  4NL9 C;  5KFR A;  1BPD A;  2XO7 A;  1BPX A;  2K0L A;  1CUK A;  2KFN A;  1KRP A;  5L1L A;  9ICO A;  4I2I A;  5AM2 A;  1NZP A;  1PK1 A;  2ERV A;  4DL5 A;  1F0M A;  5ALX A;  3NRZ A;  5DBA A;  4UW9 A;  4E1T A;  5K4L A;  1GFN A;  3UQ2 A;  5KFM A;  5KTQ A;  4Y2Q A;  4AYN A;  1SV4 A;  2XG6 A;  3VZW X;  5J0U A;  4O3S A;  5IIO A;  5ALU A;  1TE2 A;  1U49 A;  4RQ3 A;  5J2D A;  3H8W A;  2YQE A;  4I2C A;  1V97 A;  5DGA A;  9ICP A;  3GIJ A;  3GIK A;  2LPE A;  4FT6 A;  1ZET A;  3GV8 B;  4DCC A;  1ARO P;  4OJ6 A;  2JEJ A;  1KDH A;  4MEY A;  4F4B A;  3B9J A;  3L3F X;  4B9S A;  1NKE A;  4ELV A;  2ZIV B;  4M9N A;  9ICU A;  1S9F A;  5HNK A;  1SXD A;  1N61 A;  4J9K A;  3WKA A;  1KKX A;  4DQI A;  3AA1 B;  3IN5 A;  3ICX A;  3JPP A;  4MF2 A;  1C20 A;  2OWO A;  2BCU A;  3SV3 A;  2GWS A;  7ICK A;  5HMM A;  3MGV A;  2FGR A;  3EPG A;  4GXJ A;  2RDI A;  3QUT A;  1BH3 A;  3KD3 A;  3WK7 A;  2P35 A;  4Z3T A;  5KG1 A;  4P4P A;  3SV4 A;  3GIM A;  1ECW A;  4I2H A;  3K75 D;  5ALL A;  2A1A A;  1QCK A;  5KFB A;  1L7P A;  2EAN A;  4F3O A;  3MC1 A;  5G38 A;  5JTI A;  5KT4 A;  5IIN A;  2KIC A;  8ICR A;  4PGQ A;  3RJK A;  4YMN A;  5KFW A;  2E5S A;  3BQ2 A;  1ZYQ A;  5DGB A;  4YVZ A;  4I28 A;  3NVY A;  5GV0 A;  1XC9 A;  2W8L A;  2BCS A;  4G76 A;  3KVD D;  5L9X A;  2YNK A;  4Y2R A;  2XCP A;  3DWN A;  2HHQ A;  5KG5 A;  5III A;  5J2I A;  1UA0 A;  1BPZ A;  5KT5 A;  4GXI A;  4GC7 A;  3SY7 A;  2F1I A;  3RRG A;  2BKE A;  4J03 A;  3MR2 A;  3L4P A;  4P4O A;  2EAP A;  1CRX A;  3PW0 A;  5KFV A;  3F2C A;  2G08 A;  3T5L A;  1WUD A;  4O3N A;  1YT3 A;  3ZD9 A;  4RQM A;  2KIW A;  1TVA A;  3GP6 A;  9ICK A;  3D2Q A;  4QIW F;  2F1H A;  1KW4 A;  3U26 A;  5KFH A;  1SL0 A;  2R8H A;  3HWB A;  4DL6 A;  1HXU A;  4CE6 A;  4LSF A;  2KSO B;  3PST A;  1T3Q A;  2YMP A;  4M04 A;  4KN4 A;  5HP4 A;  3F5A A;  5KT6 A;  4JV1 A;  1Z19 A;  2Y0K A;  4ICA A;  5ALR A;  4F50 A;  4DSF A;  2Q4T A;  3H8J A;  1KFS A;  2UVR A;  4F71 A;  1QQ7 A;  2C22 A;  1RQL A;  3A2S X;  1WWV A;  4YG2 A;  3UU2 A;  2J6U A;  3V6H A;  1TAM A;  3NVV A;  5AIC A;  1SKW A;  4QZE A;  1JXE A;  4Y2V A;  5AI4 A;  3ED5 A;  2DGZ A;  1OSM A;  3QU7 A;  5ALV A;  4DLE A;  3F2B A;  3TFR A;  3D2N A;  9ICQ A;  2JMG A;  2QB0 A;  4QWA A;  2FPK A;  4I2G A;  4UB6 U;  3GZF A;  2XID A;  4C8O A;  4F4K A;  5ALD A;  2HOQ A;  4HYK A;  2F8K A;  1V9P A;  3M6K A;  1UT5 A;  1HEK A;  5DL8 A;  4UB1 A;  2MSN A;  2MAX A;  3PO5 A;  4JCH A;  2H3V A;  8ICZ A;  1HUZ A;  2NRW A;  3RB3 A;  1CEZ A;  7ICF A;  2MUT A;  4QIW C;  2JXJ A;  2K8B B;  1JN3 A;  3FM9 A;  1S0O A;  2D3D A;  5AM4 A;  3C1Y A;  3M1Y A;  2HHW A;  3C1Z A;  1NNL A;  3RJI A;  1B22 A;  3C28 A;  3PX0 A;  5E79 O;  3SAH A;  3J81 j;  3OSN A;  3EWA A;  4Z6F A;  3SD7 A;  1D9F A;  2PXI A;  2PI5 A;  4TUR A;  1X9M A;  4EBD A;  1WCL A;  2W11 A;  2ZLD A;  5IIJ A;  3MGI A;  4O4U A;  3WK9 A;  4Z6D A;  1NK0 A;  2X27 X;  3PMN A;  4O3X B;  2BPC A;  2DF4 B;  3SZV A;  2I6X A;  1URJ A;  4DF8 A;  2BHN A;  3H4B A;  5DG7 A;  2FMQ A;  3I1Y A;  2OM6 A;  9ICH A;  5KFU A;  1PHO A;  1SWV A;  2ZFG A;  2H3Z A;  3AA7 B;  2KXP A;  8ICL A;  4UB3 A;  3LVW A;  2IHM A;  8ICJ A;  2IWW A;  4O3P A;  1P7D A;  3V7J A;  1BNP A;  2CXY A;  4BDP A;  3C2M A;  4IRD A;  2JV3 A;  3PR4 A;  3V6K A;  1T3N A;  4UAS A;  4F72 A;  1ZQT A;  3PW5 A;  4FOZ A;  4USA A;  3KZX A;  4FBU A;  4AYD C;  5J29 A;  2WB1 F;  2ZJ8 A;  4RPX A;  3V8U A;  2ODJ A;  3LK3 B;  1ZQH A;  5KFD A;  3NAS A;  4RJX A;  4P0Q A;  4EBE A;  4B9V A;  1N5W A;  5KNI A;  5DBC A;  3A0B U;  4KLG A;  1BXW A;  4BWM A;  4RQ5 A;  4KMU A;  3B0X A;  3QUB A;  5CJ7 A;  3RH6 A;  1KSP A;  9ICB A;  2YPV A;  3G6V A;  2Y0S F;  1ZHT A;  5B5E U;  1ZD4 A;  1S5L U;  2AXT U;  2CRX A;  3RFA A;  4FES A;  2FLN A;  9ICJ A;  4UAW A;  3QRC A;  2ALZ A;  1D8B A;  3KFU F;  2K4E A;  2A3V A;  4FRT A;  5ALM A;  2R8K A;  2Y0L A;  4PH5 A;  5HR7 A;  3PSF A;  8ICT A;  5KT2 A;  4Q8F A;  2BDU A;  3TAQ A;  1ZQG A;  4DOA A;  4NM2 A;  2ODG A;  9ICC A;  2I5H A;  5AKZ A;  4QZ9 A;  2ZIV A;  3IRU A;  4RQ1 A;  4FMS A;  2P6U A;  5AFU K;  2XCA A;  2WB1 C;  5KG6 A;  2ASL A;  4MEX A;  1KQQ A;  3OGU A;  3RBH A;  2K8A A;  1Y88 A;  5KFT A;  3SYZ A;  4C69 X;  1FFV A;  4PHD A;  2OH2 A;  1B43 A;  3WKC A;  3SYB A;  3HJE A;  4FS2 A;  5KFG A;  2Y0S C;  4CDG A;  7ICM A;  2KZ7 B;  2XIC A;  1NK5 A;  2R8G A;  4GCQ A;  5AKJ A;  5EWG A;  1N56 A;  5J0S A;  5AM0 A; 
#chains in the Genus database with same CATH homology
 4RJW A;  2W80 C;  5AFU L;  1MM4 A;  1QJ9 A;  2GOL A;  1BT9 A;  3AAE A;  2G06 A;  4N58 A;  5DL7 A;  3VCB A;  2XI9 A;  2H3I A;  3DEE A;  5HR6 A;  1Q9G A;  2OYY A;  3TZG A;  3AL0 B;  4AYB C;  1KBU A;  3CRX A;  3VE2 A;  3PSI A;  3G7G A;  1ZQ1 C;  2Y0H A;  4P0Q B;  4FE3 A;  2K0L A;  2ZXH A;  1P4T A;  2RP5 A;  5FVN A;  4AFK A;  4O4X A;  2E1E A;  4NLC A;  2CPR A;  2MRL A;  2ERV A;  4FZL A;  1HXX A;  4E1T A;  1GFN A;  2H3Q A;  5KL8 B;  2OXO A;  2KV2 A;  4AYN A;  4NV0 A;  3VE1 A;  2XG6 A;  4AKR A;  4IC9 A;  3VZW X;  3ONN A;  3T0S A;  4C0Z A;  4KR8 A;  4U7C A;  3AAA B;  3C29 A;  3C5O A;  2W04 A;  2HBK A;  4U9C A;  3HOE A;  2K4H A;  1F44 A;  2YB1 A;  3K1Z A;  1ZHZ A;  3LK2 B;  4FT6 A;  4GF4 A;  3H0R B;  5ADX L;  3CP8 A;  3CYM A;  4NLB A;  2W03 A;  2VKQ A;  3SMV A;  3O0F A;  4OJ6 A;  2HOF A;  4G75 A;  4F4B A;  3AQF A;  2POR A;  3L3F X;  4P0P B;  2ZIV B;  1MM5 A;  1HXT A;  1IZN B;  2MHL A;  1PRN A;  2XMX A;  3WI5 A;  4CGZ A;  3SY9 A;  3AA1 B;  2FGQ X;  2ZIX B;  2J1N A;  3IN5 A;  2XE1 A;  3WI4 A;  3PRN A;  2XVT A;  2W7O A;  1T94 A;  3ICX A;  2N2L A;  5DL6 A;  4NWI A;  4KMO B;  4QJF B;  4WJ3 B;  3MGV A;  4LSI A;  3HOL A;  2FGR A;  4O3Z A;  2PRN A;  1THQ A;  2Z7J A;  1BH3 A;  4ACO A;  4Z3T A;  2GH1 A;  3M7D A;  1ECW A;  2VIX A;  4BJQ A;  4CRX A;  3AA6 A;  2F1V A;  4PUX A;  2KD1 A;  4PL2 A;  3VZU X;  2NV3 A;  3ALR A;  2KIC A;  5D5D A;  4OJO A;  2KXP B;  2E5S A;  2N2M A;  2ZIW B;  3T24 A;  1A0P A;  5GV0 A;  1H6S 1;  2R18 A;  3UAQ A;  2D6F C;  2W81 C;  2J4U P;  1NZB A;  4G76 A;  3AA0 A;  3KVD D;  2YNK A;  2VJ5 A;  2K8C B;  4GHB A;  2KJ9 A;  3IP4 B;  4FUV A;  3SY7 A;  3AA7 A;  1CRX A;  3LK4 2;  5T14 A;  3H0M B;  2M06 A;  2YB4 A;  4QNL A;  3SAG A;  3F2C A;  2G08 A;  5ADX K;  2HBL A;  4JFB A;  1WUD A;  1YT3 A;  2KIW A;  3GP6 A;  3D2Q A;  5T5F A;  2KHQ A;  4XNK A;  3M6Z A;  4QIW F;  2KJ8 A;  3H0L B;  2G5H B;  2HOI A;  4AKR B;  3HWB A;  2KJ5 A;  1A6S A;  2JMM A;  1HXU A;  4LSF A;  3PST A;  3LK3 A;  3N7P D;  4KR4 A;  3EMN X;  2KC0 A;  3F5A A;  2G09 A;  4AZL A;  3T20 A;  1Z19 A;  2Y0K A;  4ICA A;  3SZD A;  2F2A B;  3SYS A;  2Q4T A;  2XTR A;  4FZM A;  3VZT X;  2W7P A;  3JTY A;  4JMU A;  3K19 A;  4AYI D;  3HW9 A;  2KVC A;  3A2S X;  4RLB A;  3UU2 A;  2XTQ A;  1GFQ A;  1ZHY A;  1TAM A;  4GCS A;  2HBJ A;  4A8E A;  2Y2X A;  4O3Y A;  2LYB A;  2DGZ A;  2G0A A;  1OSM A;  3O0E A;  3F2B A;  3D2N A;  2XE2 A;  2JMG A;  3N7R C;  2ZG6 A;  2E1F A;  2LYA A;  3HKZ F;  3GZF A;  4B61 A;  3PQU A;  2XID A;  2JH7 A;  1XO0 A;  2KDY A;  2HOQ A;  4GCP A;  3M6K A;  3PSP A;  2OMF A;  1MPF A;  1HEK A;  2RRD A;  3E0F A;  1XNS A;  5DL8 A;  3POQ A;  2G07 A;  2LKY A;  5PRN A;  4KX3 A;  4KRA A;  5DL5 A;  2KEY A;  4JCH A;  3NUQ A;  4P0P A;  2H3V A;  4AYE C;  4QIW C;  1IIP A;  2K8B B;  2XE3 A;  3AA1 A;  2LFU A;  4N59 A;  2LHF A;  4LSE A;  3SQI A;  3FYX A;  2F1T A;  1OUQ A;  2O4V A;  2F8L A;  3C28 A;  3SAH A;  1GFP A;  3PQS A;  1SZH A;  4AKM A;  3AAE B;  1MA7 A;  2ZLD A;  5JDP A;  2ZIU A;  3PZP A;  4O4U A;  2MA1 A;  3AQE A;  1ZHX A;  2X27 X;  1E54 A;  4O3X B;  2DF4 B;  3SZV A;  2M0N A;  1URJ A;  3D2S A;  2WAQ F;  1L6N A;  2KZ7 A;  3POR A;  5CRX A;  2OM6 A;  3POX A;  1YS5 A;  1PHO A;  3VY8 X;  8PRN A;  4D64 A;  2ZFG A;  2H3Z A;  3AA7 B;  2HMX A;  3T79 A;  2KHV A;  2KXP A;  3LVW A;  2ZIW A;  2PMZ F;  3HKZ C;  5G26 A;  1P7D A;  2LBO A;  4E1S A;  4FOZ A;  1Q3V A;  3KZX A;  2VJ4 A;  4GFJ A;  4AYD C;  4FSP A;  2WB1 F;  2XE5 A;  1QJ8 A;  3V8U A;  2ODJ A;  3LK3 B;  3IG8 A;  3LVV A;  4RJX A;  4P0Q A;  4FZN A;  4QQ1 A;  3POU A;  1DRG A;  2RHF A;  1BXW A;  1GFO A;  2CN1 A;  4OJP A;  4AYM C;  4U6P A;  5KL1 B;  1Q9F A;  2YPV A;  3DA3 A;  2K89 A;  3NRW A;  2Y0S F;  1ZHT A;  4RLC A;  4O3M A;  3GU3 A;  3QRA A;  4BUM X;  1G90 A;  3RF9 A;  5IYU A;  2KKP A;  2CRX A;  3SAF A;  1Q3U A;  7PRN A;  3OPX A;  3RFA A;  4FES A;  4D5U A;  2HBM A;  3AAA A;  2KNJ A;  2G5I B;  3QRC A;  1ED1 A;  3VC8 A;  1D8B A;  3KFU F;  6PRN A;  2WAQ C;  2K4E A;  1GO3 F;  2YX8 A;  2A3V A;  4LSH A;  2K4I A;  1ZHW A;  4RL9 A;  4FRT A;  2Y7S A;  4OJL A;  2F77 X;  2Y0L A;  1PVQ A;  1PVR A;  5HR7 A;  3LK2 A;  2QTK A;  2PMZ C;  3PSF A;  4O3W A;  4AYB F;  3F53 A;  2BDU A;  4PL1 A;  3N7S C;  1OPF A;  4O49 A;  4FSO A;  5EE2 A;  5A0L A;  3IG5 A;  3F5E A;  3AA6 B;  2ZIV A;  2H3F A;  1IZN A;  3LYS A;  3VY9 X;  4FMS A;  4FRX A;  5AFU K;  4XNL A;  1QJP A;  1Z1B A;  2WB1 C;  4OO1 J;  4BX9 C;  2K4T A;  3DA4 A;  2ZIX A;  3UPG A;  2LHT A;  2K8A A;  1PVP A;  3RBH A;  2GE4 A;  2KKV A;  4C69 X;  2OH2 A;  2JGA A;  2JHD A;  2JH1 A;  1ORM A;  3F2D A;  2MNH A;  2N1R A;  4OJ5 A;  3SYB A;  4KX5 A;  2ZIU B;  1GFM A;  4D65 A;  2ZXI A;  3AA0 B;  2Y0S C;  2F76 X;  4CDG A;  2KOB A;  2DQN B;  5C0Y A;  2KZ7 B;  2XIC A;  3LK4 1;  1UPH A;  4AUI A;  4GCQ A;  1HIW A;  4BUG A;  2M07 A;  3NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...