4FZMA

Crystal structure of the bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzmA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzmA02
4G76A 4G75A 2XTQA 4N59A 3DA4A 2XMXA 4FZMA 4FZNA 4N58A 2XTRA 4FZLA 3DA3A
chains in the Genus database with same CATH superfamily
4O3QA 2QARB 1NI3A 2ZIUA 3SAHA 3AAEA 3F2CA 4EEKA 4PH5A 5KFSA 2BQUA 2ESEA 2HBLA 3M7DA 5J2BA 1QQ7A 4MF2A 4RQ7A 3GIJA 2YB1A 4RT2A 1XSPA 3AQEA 3QX7A 1KL9A 2XICA 4WJ3B 3EPIA 5L1IA 4O3YA 1RZTA 4I2EA 3V6JA 5J2DA 4ECTA 2JH7A 3PW4A 4YXMA 1D8BA 1JALA 5F9LA 4XNKA 1V97A 4F92B 3H7IA 3L3FX 4C4VA 5HMMA 3LVWA 2KJ9A 4N75A 4FO6A 2NRTA 9ICEA 2Y9UA 4AYID 1UT5A 2BPFA 1IV8A 1RYSA 1L3SA 1UCVA 5AI8A 3UPQA 3J81j 3WK7A 4EZ6A 5J0TA 4PJ0O 3O0FA 4J9SA 2R8GA 1LVHA 4OJLA 4F4ZA 3TAPA 4DL6A 2ODGA 2LHFA 5E79O 5DL5A 1WCNA 4O5EA 2F2AB 2GOLA 3QRAA 1MQ3A 3OPXA 3QEBZ 4MFFA 5J29A 1SXDA 3LK3A 3CYMA 2ZJ5A 3G6XA 4JWMA 3UM9A 1JMSA 1QJPA 4NWIA 8ICAA 4BXOA 3SMVA 1NNLA 5HP4A 3T24A 3M8SA 3G7GA 5IIOA 1A0PA 3C2MA 4ECRA 1S77D 2CXYA 2RRDA 2LMRA 3N7SC 2G06A 3C5FA 2AQ0A 3NSGA 2Y7SA 2EAOA 2LBOA 5KFLA 2KFNA 1THQA 4ACOA 4US9A 2R4NA 1BGXT 3T3FA 8PRNA 3M9NB 3K75D 2ERVA 3QRCA 3TAQA 3I1YA 9ICRA 3JCUO 1HJPA 2KHVA 3PQUA 4IQUA 9ICXA 4O3RA 3ZDAA 4JV1A 7ICUA 2E1EA 1T3NA 2FLPA 1C20A 1X66A 3NS1A 9ICJA 9ICAA 4YMNA 2XTRA 2ZIVB 4GCPA 4P4PA 5JU5A 4I2AA 4GXIA 2KVSA 3EYZA 4XNLA 4K4GA 4O3MA 1BPEA 3QUQA 3H8MA 2JMGA 2IWVA 1PK1B 2NRZA 2X9KA 3RBHA 5AIBA 4Z6DA 2G0AA 5CR0A 1ZQMA 4YFKA 1IM4A 3PV8A 3N7RC 1JUDA 2V9WA 2M07A 4AYBC 5T5FA 5ALGA 2NV3A 4FZLA 2KXPA 2C22A 2LI6A 5KG5A 1XNSA 3ISDA 3QXGA 2VJ5A 2KC0A 2KJ5A 3M9MB 2HBKA 2HHSA 2E3TA 3PW7A 1S10A 1JRPA 4GXJA 3WU2O 4DQQA 5DB7A 4UB1A 2Y0KA 3HILA 1ZQ1C 1T1LA 2KXPB 2H3FA 3BQ7A 3T5KA 1ZQPA 4UASA 4BUGA 4RQ2A 1Q3UA 2F44A 2H5XA 7PRNA 4D5UA 2HBMA 5DB6A 1D8LA 4TURA 1X2IA 3N7PD 2XO7A 1IZNB 2IOFK 3GQCA 5AI9A 3BS0A 3QUBA 3GIMA 1XO0A 1F5SA 4B9MA 2J6TA 2M0NA 1JX4A 4B9UA 4UB4A 4F3OA 2G5IB 5A0LA 5IILA 2I6XA 4TQRA 2Y0SC 2W9CB 1SWVA 1TK8A 5J0QA 3H8WA 2ATLA 2F1TA 4G3IA 5KFWA 2YMLA 1N5WA 5AKHA 4X5VA 2GE4A 5AM0A 4YR2A 2WF7A 1S5LU 3AU2A 2Y0HA 3PGRA 3PO4A 2P35A 2DBYA 4BDPA 3BDPA 3WKEA 5C0YA 4QZHA 5AFUL 2GLEA 2A3VA 2R4OA 1NK5A 1WG8A 5CRXA 5BPCA 2NRWA 2BZFA 1RXWA 1MM4A 2Y2XA 1SIJA 5KL8B 1L3TA 1GFQA 5ALNA 3SY7A 3NUQA 1WUDA 2JEFA 5JRTA 3L5KA 4UAZA 4M47A 4YP3A 1T3QA 2AHOB 9ICGA 1UPHA 2ISOA 1ZETA 4PGQA 4QZGA 2E8OA 2NRXA 4M9NA 1BPBA 4UAWA 1LV5A 4GF4A 3SAFA 1SKSA 5ALQA 1OSMA 4P4OA 2HOIA 4FOZA 1N60A 5EWGA 4RQ0A 3RH4A 4F5OA 4OCZA 2BCRA 1QSLA 2ASDA 4YR0A 1CEZA 2D3DA 3T0SA 4P0QA 3H0RB 1V38A 4B6JA 5DL8A 2PMZF 2W7PA 3KZXA 2W3SA 2QARA 4Y2TA 5ALPA 5ALVA 2J1NA 4DO9A 2DF4B 5J2AA 4KN4A 1ZRNA 1Q9FA 2ZIUB 1ZD5A 1D9FA 4J9KA 1PK1A 2LM1A 1S97A 4K3CA 4M9LA 4DL2A 4N59A 2HVHA 4C4SA 4DSIA 8ICJA 4HYKA 2MNHA 4J9OA 3FYXA 5KT2A 4AYBF 3KHRA 4EBDA 1TK5A 3WKCA 3DWNA 3VY9X 1T7PA 4MFAA 2XCAA 2E8PA 1QTMA 7ICPA 5L9XA 7ICNA 4F50A 4KR8A 1MN8A 1MC8A 4Q44A 8ICVA 7ICTA 2BR0A 4UB6U 4TUPA 5AK6A 3FM9A 2AQ4A 3TFSA 1GFOA 2DWQA 5AM4A 2F76X 2K4IA 1XWLA 1ZQVA 4AYEC 1ZQAA 2KSOA 4XUSA 3QU7A 3FAHA 5KFFA 2G5HB 2FDRA 3UQ2A 3RF9A 1RM6C 1L8OA 1X9WA 4YG2A 4DF4A 5AKLA 3QZ7A 2ZTEA 4FFDA 1Z00A 2ZG6A 3FC4A 4LVSA 5AM1A 3NVYA 4O9MA 2KKVA 1N5XA 4KLQA 7ICLA 5AKZA 2ODJA 1NK7A 4Y2XA 3QU4A 3ZD8A 2K0LA 2JZBB 3EPGA 9ICMA 5KFAA 3EUB2 5CB1A 4BX9C 4R8UB 2JHDA 4DL5A 5IINA 2XVTA 2D8CA 1ZQLA 3GILA 2AGQA 4KTQA 2JZBA 2ZUCA 1BPXA 1SZPA 5E79U 5KFHA 5L1LA 3E0FA 2VIXA 2WVPA 4M04A 8ICHA 2ZIXA 3LK2A 2HHWA 2WTFA 3RB0A 3NGDA 4Z3TA 2I9GA 1L8LA 6PRNA 3PO5A 4JK1A 5J2JA 1TAQA 9ICOA 3LVVA 3FDSA 1KLNA 3RJHA 3C1YA 2K4PA 5GV0A 2AGPA 1ZQWA 4TQSA 3MGHA 3PGUA 1XC9A 4KLFA 3HKZF 8ICRA 3JPNA 1TFRA 1ZJMA 1ZQRA 5G26A 5KFTA 2K89A 5D5DA 4IQWA 1URJA 3NVVA 5DQGA 4ED1A 3VZTX 4F5RA 1D8YA 5ALWA 9ICCA 1L7OA 4B9SA 4FUVA 5TISO 4R63A 4RQ3A 2I5HA 1N62A 1X42A 4DQRA 1RXVA 3ZDDA 3EZ5A 3PF1A 1TAMA 5DG8A 2A1AA 4FESA 3NRWA 3RAXA 1FEZA 3A2SX 4C80A 5KG3A 4Y2VA 2NRVA 2ZJ8A 5AICA 1UA1A 5KG4A 2JR5A 4QZIA 4NJ8A 3RJKA 5KFZA 1FO4A 1XSNA 4YMMA 4ECZA 3BS5B 4M6WA 5DL6A 5KT6A 8ICLA 2HI0A 3N97B 3GIKA 5KAFO 4J9MA 2JV3A 4RNOA 2A1JB 5EE9A 2KFZA 1H6S1 4K4HA 1LKYA 3TADA 3NVZA 2AXTU 5GTIO 3GV7B 4QZFA 2FGQX 4MF8A 1V9PA 1L5UA 5B66U 4OO1J 1DK2A 2A1JA 2R8KA 3NVWA 1PK3A 2BCVA 1ZQUA 4EX6A 2ZJAA 8ICUA 3WK4A 2MAXA 4YCXA 5IIMA 2QB1A 3WK5A 1U4BA 3C29A 7ICIA 4I2FA 4F4KA 3LK9A 2XGPA 5KFGA 1HXTA 4OD0A 2UVRA 1OW5A 2OWOA 3MFHA 4DS5A 5EE3A 4CNQA 2UVVA 4Y2RA 2KICA 1A77A 5G5HA 1NOMA 2HVIA 4DFMA 4JV0A 5AKIA 2N2LA 2UVWA 1SGGA 5D46A 7ICOA 2PKEA 8ICTA 2F3NA 1TVAA 4DSFA 2ZIVA 5AKYA 3QU5A 1PVQA 2PFPA 4KLUA 2FLNA 5J2CA 3BRZA 1SV4A 5TISU 2KIWA 2E1FA 3AA7B 1N63A 5DB8A 3HW9A 2NO5A 4ZOHC 2O6KA 1Z1BA 3BQ1A 5KFDA 1FFVA 4LZGA 2LFUA 3KHGA 3TADC 1ZQEA 8ICZA 4F4YA 4M9HA 3HT3A 2W03A 1Q46A 4ECQA 4NV0A 5DQIA 1SWWA 1QJ8A 3LK41 3UXPA 3AU6A 5CHGA 2QKQA 4Y2JA 2QB0A 2R4PA 4OJ6A 3IN5A 3M9OB 9ICPA 5KFVA 1P4TA 3AA0A 3L4PA 3BQ2A 4DLGA 1QH9A 4Q8FA 3IDWA 5KFCA 1TE2A 1ZQIA 3CRXA 1P7DA 7ICQA 4F8RA 5AI6A 2FMPA 1IIPA 3QEAZ 3IV6A 2YMPA 4B61A 4IRKA 5B5EU 4OJ5A 4I2CA 3POUA 1ZOLA 2F77X 5KFJA 4B9TA 3V7LA 2RQ5A 1SV0A 2BHNA 9ICBA 1D9DA 3JPSA 3UMGA 1BH3A 3ISBA 1NJYA 3Q8KA 1L6NA 5EE1A 3AL0B 1WWUA 3VZWX 2IOFA 4I28A 3UPGA 2ZLDA 4EYIB 2F1JA 2WAQC 1K1SA 2F8LA 4DSEA 5KG2A 1RDFA 5EWEA 4IL6O 5G38A 5KG0A 2EZZA 3A0BU 3AEVA 4FE3A 5F3XB 1L3UA 4CCHA 2BCSA 3C2KA 4RNMA 4LSHA 5IIKA 9ICVA 4QIWF 2BCUA 5C5JA 3ISCA 2ZIXB 4DCCA 2W04A 4KX5A 2FPKA 1S0OA 4XRHA 1RYRA 4K3BA 1ZJNA 5KFOA 3RJFA 1FFUA 4GCQA 2RDJA 3Q8QB 2KDYA 2IOHA 9ICTA 3BQ0A 2L5YA 3E58A 2XCPA 3UU2A 1KEJA 2KMDA 4EELA 4FSPA 2EZXA 1DRGA 4ECVA 4D65A 3JPPA 4KLGA 3HWTA 1XSLA 2HW3A 5ALZA 2J6SA 1QSYA 4FRTA 1YZ6A 4F4BA 3VCBA 1BPZA 7ICSA 4F71A 2NO4A 2KKPA 3Q8PB 1JIHA 1NK0A 3PNCA 4ED2A 2DL0A 3U26A 4RJWA 4FRXA 2ZIWB 4CF5A 4C4TA 3TQ1A 2KE7A 1UT8A 3RRHA 3AA6B 8ICPA 5FVNA 2OXOA 3ETRA 3AAAB 3WI5A 4NL9C 2PFOA 4FSOA 4PZOA 8ICCA 4BXOB 3LK42 5KAIO 5CJ7A 1YT3A 5H2FU 1IG6A 2OEHA 2AJQA 8ICOA 1J2NA 1HIWA 2KN7A 4AFKA 3V72A 3DV9A 5BOMA 4DSJA 2LKYA 2Y1IA 3ICXA 3SYSA 3JPOA 2DQNB 3KKAA 5ALUA 1E54A 1HXXA 2PI5A 2VANA 1ZD4A 1BPYA 2MUTB 1S0MA 3VC8A 2ASJA 2KV2A 4JCHA 3ZDCA 2JRZA 5J0OA 3SZ2A 5KL1B 1O08A 3PX0A 5DBBA 2W55A 3KOOA 2FE9A 4P0PB 1MSWD 2N1RA 2XE2A 1B0XA 4Y2QA 1L7PA 1QCKA 4BWMA 3ALRA 1BXWA 3D2SA 4DQSA 8ICFA 2QTKA 5ALIA 3H4BA 2EDUA 2VA8A 5ALOA 4RUCA 2W80C 4QZCA 1YZ7A 4JV2A 4EENA 4IR1A 1ZRMA 3HP6A 2VJ4A 4PR7A 4IC9A 5PRNA 3OTQA 3H8SA 5HHHA 3DA4A 1JXEA 4RLCA 1QLNA 1X6IA 5ALDA 3KHHA 5K4LA 2WAQF 1UA0A 3GZFA 4R64A 3QUCA 1Z4NA 8ICSA 3DZMA 4LSEA 1X9MA 1VLBA 1N61A 4Q8EA 4RQ4A 5EOZA 2V4QA 2W9CA 3WI4A 4ED3A 3BS5A 1OPFA 4CTDA 5D49A 3KFUF 2KTQA 3KKAC 4US8A 3KTQA 2ES6A 4RLBA 1XO1A 1HEKA 4C8LA 5KT7A 1LKYB 4CDGA 3H40A 4QIWC 4UBCA 1MM5A 4UB5A 4TUQA 2K8AA 3PX4A 4XA5A 2UVUA 3T5JA 3C28A 4O3ZA 2YPVA 4PHDA 4DQPA 2IMWP 4G75A 2CPRA 1IXRA 4KLLA 2PXIA 1KDHA 5ALTA 3OSPA 5IIIA 2DUYA 4DEZA 2DPIA 2E8MA 8ICQA 3T79A 3ZDBA 2Y0LA 5CA7A 3THVA 3GFKB 4RL9A 4I2HA 1ECWA 2W3RA 4I2IA 4Y2SA 3PMNA 7ICHA 2O4VA 4NL9A 1COOA 3SYBA 3D6JA 1A6SA 5JTIA 1TV9A 3RB3A 4JWNA 4O5CA 2F1VA 3V8UA 1TKDA 5BOLA 3F5AA 5EWFA 3VE2A 5DGAA 4UAUA 1NK9A 3LWMA 2VA2A 5DDYA 2BPGA 4EYHB 5J2GA 4C8MA 3PGSA 1K1QA 3SV4A 4J9NA 4B9NA 1HUZA 4FQEA 3TZGA 4Y2YA 3N28A 2JEJA 1ZQNA 1V85A 2MUTA 2C28A 3A0HU 5ALKA 2HDOA 2N2MA 5J2EA 2W81C 3JPRA 4UB3A 1S5LO 2YQEA 4G9BA 2ZTDA 4DOAA 4OJOA 2BQRA 4P0PA 4BWJA 2B0CA 5GTHU 2JEGA 4QJFB 2YTUA 1ZQXA 3S6JA 2LHTA 2Y1JA 1GFNA 1PZNA 3LDAA 3GV5B 4LJXA 4MEXA 5GTHO 1UHUA 5J0XA 2AU0A 1N2XA 5KFRA 1FIQA 4FZNA 1ZYQA 2JH1A 1B43A 3EMNX 9ICWA 1QQ6A 3AA0B 3HW8A 2WB1F 4LZDA 4UQGA 3IRUA 1PUZA 2FPLA 3OJSA 3POQA 5CP2A 4J9QA 4F5PA 1RQNA 1X9SA 4C8OA 4QZ9A 3E2EA 1RG6A 4CRXA 4NLZA 4MFCA 2IBKA 4U6PA 1IZNA 2GH1A 2OHFA 4RNNA 1BNOA 5KT3A 2P6UA 3V6HA 7ICVA 4DOBA 4MHVA 1PVPA 4DFDA 9ICHA 1Q9GA 3CW2C 4BGDA 4JMUA 4DFKA 2DKXA 1OXJA 2BPCA 5IIJA 5HR7A 1HXUA 3DEEA 4F72A 5KFPA 4AYDC 5B66O 3KBBA 1WCLA 1EXNA 3AQFA 2H3VA 2KVCA 2RP5A 1QJ9A 3D2QA 3T20A 2BGWA 1M6YA 3Q8MA 2BCQA 4J03A 4O4XA 3WKBA 2XE5A 3Q8RB 8ICEA 4FBUA 3A0BO 4F93B 3PMLA 1ZQHA 1PRNA 3BZKA 3NRZA 2W8KA 1BT9A 4GCSA 4ED0A 2K60A 3IHQB 3FYHA 2KZ7A 2W8LA 2F1HA 4QZ8A 1KFTA 1JROA 4DSLA 4BJQA 1KFDA 2HHUA 3Q8LA 3TKAA 2MSNA 3DA3A 2XY7A 1L7MA 2HOQA 5KFEA 1T94A 1SKWA 2MA1A 1MQ2A 4GHBA 2YN4A 4RQMA 4E1TA 8ICWA 4JFBA 2KK0A 2RLTA 3AN1A 3V7JA 1Z19A 1ZHZA 2XY5A 3I28A 1CUKA 1BNPA 1XS9D 5JDPA 2HHXA 4TUSA 1N48A 4KX3A 3PSTA 5KNIA 2W7OA 4PJ0U 1U45A 3HOLA 3KZIU 2A19A 2C2DA 3AA6A 5L1JA 1BPDA 3RBEA 3GU3A 1PVRA 1OUQA 2KIVA 1XU4A 1HUOA 5ALMA 1ZXIA 3QUTA 4AUIA 5HMLA 4ECXA 3F53A 5G39A 2HCFA 4RPZA 2LM4A 2R89A 1ZQTA 4JUZA 3SYZA 3RH6A 4RQNA 4NLGA 1DK3A 2EAMA 4QWCA 2M06A 2MRLA 3PSIA 1AROP 3SAGA 4IRDA 4EX7A 2WF5A 1Z3EB 1O03A 5KFNA 1F0MA 5J2IA 3HWBA 5DLGA 2KEYA 2WF8A 1S0NA 2G07A 4IS7A 5ALLA 3RFAA 4N58A 5KAIU 5KFKA 4DLEA 4PZNA 3EWAA 2J4UP 3PZPA 3WU2U 3RBDA 3WKDA 3SZVA 2KJ8A 3MDCA 4O3WA 4ED8A 4I2BA 2PORA 4DL7A 3IG8A 4I2JA 1NKCA 2JGAA 1CI4A 3PY8A 4F5NA 2P66A 5ALRA 1SZHA 3PX6A 4PHPA 4PHEA 4PL2A 1ZHXA 4PUXA 5L1MA 2YMQA 4Z6EA 2HBJA 4YD2A 3VY8X 3RJJA 5J0PA 2XE3A 3I76A 5AFUK 4NXZA 2H3ZA 4F2RA 1SL0A 2ZXHA 4KR4A 4AYNA 4E1SA 2Y0SF 1X40A 3IM1A 4AYMC 4C00A 2KP7A 2WFAA 2XY6A 4KLIA 4AKMA 7ICFA 3AA1A 1KTQA 2WJQA 3H8JA 4EBCA 4UB6O 1T16A 3QZ8A 3BZCA 1NK4A 3K4GA 4ECUA 3TARA 4I2GA 2OMFA 4Y2UA 3QNMA 3V6KA 3RTVA 4O49A 4CF3A 4QZAA 4ECWA 4DFJA 5GTIU 2AXTO 5HNKA 1RQLA 5ADXK 2YMMA 2B6GA 1JI7A 2W54A 4P0QB 3V7KA 5AKXA 2EH9A 3MC1A 4EEYA 1L3VA 4C8NA 5DGBA 9ICUA 1S8OA 4CF4A 2QB0B 1ZQYA 4NY8A 4O3SA 4GIBA 4C4RA 1YS5A 1KW4A 5KG7A 2W9MA 2FLLA 5AKEA 1JN3A 1U48A 5AM5A 4B9LA 8ICGA 5DL7A 4KITB 4F4WA 3G6YA 2F1IA 5B5EO 3TANA 1A76A 2YB4A 2HHQA 4R65A 4KLOA 4QWBA 5KFXA 2IWWA 2QLTA 3B9JA 5FP0A 5KT5A 5AM2A 4F5QA 3PW2A 1ZQSA 2ZUBA 5J2KA 3KHLA 3A0HO 2ZTCA 2HSZA 4FS2A 3ORYA 8ICBA 2EZYA 3C2LA 2PMZC 4UB8U 5AKJA 2EAPA 2R4LA 5DG7A 3OJUA 2HMXA 4KMOB 1SL1A 2AGOA 1SKRA 2FMSA 2R8AA 3RR8A 2PFQA 1T4GA 4QNLA 2HHTA 4FZMA 4EZ9A 1MPFA 4I27A 3RJEA 2R8HA 3GDXA 1QQ5A 5D4BA 5KFBA 3MABA 2XIDA 4RZRA 1F44A 3UQ0A 2JMMA 2B21A 1ZQKA 2K4EA 5KFQA 2E5SA 3B0XA 3C23A 2DKZA 3SI8A 5AKGA 9ICKA 3PSFA 1NJZA 3RR7A 2G09A 5H2FO 4XQ8A 2W43A 1U9LA 2FGRA 3GP6A 4EBEA 4QZDA 2WJRA 2MHLA 3WK6A 4GC6A 2X27X 7ICMA 2WHEA 1JXLA 4B9VA 4FT6A 4M9JA 3IP4B 5HR6A 3UAQA 2FPMA 3RJIA 2KZ7B 9ICSA 2XE1A 1ZQZA 2BDUA 5J0UA 3F2DA 3BRYA 8ICKA 3ETLA 4I29A 1ZQJA 5J8YA 3DWOX 1KFSA 4NLCA 1ZQDA 2RDIA 3JPTA 3UMCA 3C21A 2KOBA 4J9RA 2AH5A 1H38A 4GC7A 3R9KA 1ZQQA 4RUAA 3MR5A 5AK5A 4UB2A 4D64A 4QQ1A 1WWVA 4PPXA 2KZ3A 9ICQA 4Q45A 1DGJA 2PFNA 1K5OA 1GO3F 4QWAA 5L1KA 4IL6U 4FS1A 4GLXA 4UARA 5J2FA 3MBYA 4M9GA 4KLDA 1S0VA 4AKRA 5J8YC 4CGZA 2Q0ZX 2ZFGA 5DQHA 2W9BB 4Z6CA 3CNHA 5AIAA 4UAYA 2WF9A 2I1QA 2PI4A 5EE2A 3M6ZA 5KFYA 1KN5A 5G3AA 4O3XB 1N56A 3N4MB 4BUMX 3QYPA 2ISPA 1RPLA 4RQ6A 3QU9A 4DL3A 4IR9A 3HX0A 1MA7A 2R8IA 3PW0A 1PHOA 4UATA 3ONNA 1Z00B 4RQ8A 4KLJA 2XGQA 5HHIA 1AQ6A 1ZQFA 3PRNA 1QSSA 5ALFA 2LYHA 3SEIA 1KQQA 3OSNA 3B0YA 3PW5A 2R18A 3SD7A 3CP8A 4A8EA 4USAA 3F2BA 8ICYA 4YVZA 4R8UA 2ALZA 3MR6A 4LSIA 4YN4A 4QZEA 3HPOA 2NYVA 3M6KA 2XMXA 4NLKA 3F5EA 3M8RA 3GV8B 3ED5A 4KN7A 3TACB 5J0RA 2C2EA 2KG5A 3DDHA 2MU2A 2P6RA 4P2HA 2BKEA 5AK3A 5KT4A 1NZBA 3NJTA 3KD3A 4YXJA 4DOCA 3UMBA 1SL2A 3LK2B 5ALYA 4F2SA 5DDMA 4RJXA 2RHFA 4Z6FA 1NKEA 1Z4OA 5J0WA 3AAEB 2DGZA 2ZXIA 1VDVA 2JXJA 1ED1A 1NJXA 3POXA 1B4FA 3PR5B 9ICNA 1RYUA 3BS7A 3NTUA 3TFRA 5DB9A 3IG5A 4E0DA 1ZQBA 5J0SA 2LPEA 3SQIA 4C69X 2E8NA 4RT3A 4C7ZA 1DXSA 4U9CA 3K1ZA 3NASA 1KRPA 2K8BB 3D2NA 3O0EA 1Q8KA 2FJ6A 4KRAA 4O3OA 5ALSA 1VJ5A 3ZI4A 1UQVA 3HOEA 4UB8O 2OH2A 4C7YA 1X9XA 4ECYA 1L7NA 2KNJA 3AM9A 3MDAA 4G76A 8ICIA 5F9NA 4KLMA 4AP9A 3M1YA 1NKBA 3C5GA 2EANA 3PQSA 2R8JA 2YNKA 2LYBA 4UW9A 1SXEA 4GFJA 5KFIA 5JUMA 2FMQA 4M2YA 4C0ZA 3BJYA 2CRXA 1COKA 4AKRB 2JEIA 5AKKA 5KG1A 1U49A 1ZQCA 1Q3VA 1Y88A 2ZIWA 4FBTA 5CWRA 3PR4A 3MFIA 3UXNA 3QE9Y 2WF6A 2C2RA 3MR3A 4J9LA 3ZDEA 1TAUA 3SY9A 4QWEA 1ZD3A 3LWLA 5ALHA 4PGXA 4RU9A 5AK4A 5ALXA 3AA1B 2D6FC 1TK0A 1ZHTA 4DWIA 5T14A 1U47A 4ELTA 3RJGA 7ICRA 2YX8A 3H4DA 3SENA 3SR6A 2F8KA 3AMZA 4AZLA 2W11A 5KFMA 4O4UA 5EE0A 2BDPA 5AM3A 3C1ZA 4F91B 2VKQA 1C7YA 4ELUA 3VZUX 4M6WB 4YR3A 1J97A 4O5KA 3PORA 1ZQOA 4DFPA 3BQTA 3JTYA 1SB3C 4FMSA 4QW9A 8ICMA 4NM2A 3T5LA 3UXOA 1DOQA 1J2MA 7ICGA 5IYUA 2F1CX 2Y9TA 2G08A 5KG6A 4OJPA 2ZUDA 4IQTA 4PL1A 4KLEA 3AUOA 2IHMA 4ED6A 4LSFA 4DS4A 4NM1A 4QW8A 2ASLA 2CN1A 2OCEA 4U7CA 2LYAA 3RRGA 1WYGA 4RPYA 3G6VA 7ICJA 4DL4A 3LYSA 1G90A 2JQYA 3H0LB 4PHAA 3OGUA 2OYYA 1B22A 4CE6A 4PGYA 4J9PA 3WK9A 4YD1A 4QWDA 2IA6A 4NLNA 4ED7A 4IRCA 2GWSA 4UAVA 3MGIA 5J2HA 3SZDA 1DGSA 3GIIA 3ZD9A 9ICIA 4GXKA 1KBUA 3RB6A 1ZD2P 5G5GA 1NK6A 2J6UA 4ZH4A 2VA3A 2KZZA 9ICLA 4C4VB 1ORMA 4IQVA 4MEYA 1T8EA 5TZVA 5AI0A 4JB3A 4DF8A 5DKWA 3QU2A 3HJEA 3WKAA 3SV3A 2V4RA 2XC9A 3PSPA 2K4TA 4O3PA 3AA7A 2YY6A 3JPQA 4N74A 2XI9A 1S76D 2WB1C 4YQWA 7ICKA 1GFMA 3LK3B 2KZMA 2GO7A 1SV0C 4I2DA 3RH5A 1KKXA 5AI4A 3RAQA 3KZIO 4Q43A 5KTQA 7ICEA 3KVDD 4NLBA 2W9BA 2PRNA 3MGVA 5DLFA 4P4MA 4ELVA 4K4IA 3AAAA 2H3IA 5KFUA 3K19A 2OM6A 4QZBA 1ZQGA 3Q8SB 1Z1VA 4DSKA 3WK8A 2FI1A 3H0MB 4KLHA 2H3QA 5ALJA 2W9AA 2Q4TA 3K1RB 2M9NA 1GFPA 5AHXA 4M0AA 3EW9A 2KHQA 4O0IA 3OHBA 3OHAA 4DQIA 4UBBA 4Y2PA 2R88A 2HHVA 4KLSA 4RQ1A 3C5OA 1KSPA 1LB2B 5ALEA 5AI5A 9ICFA 4C8KA 2KSOB 5DBCA 2DPJA 2DFLA 3T5HA 2Z7JA 1NZPA 4KLTA 1NJWA 1BVSA 4YMOA 2XTQA 4RPXA 2K8CB 5CEHA 3RB4A 5J0YA 8ICNA 5ADXL 1NK8A 4HAIA 2IHNA 4ECSA 3MR2A 1ZHYA 5DBAA 1CRXA 8ICXA 2EQYA 4O3NA 3HRDD 4ICAA 3HKZC 4RQ5A 2KD1A 1X6JA 3PVXA 4R66A 2XG6A 4KMUA 2HOFA 1ZHWA 2K4HA 5KAFU 2BQ3A 3TI0A 1S9FA 4F4XA 3VE1A 5DG9A
chains in the Genus database with same CATH topology
2FGRA 3GP6A 2ZIUA 3SAHA 3AAEA 3F2CA 2MHLA 2HBLA 3M7DA 2X27X 1TAMA 3T79A 2Y0LA 4FESA 3NRWA 4RL9A 2YB1A 3A2SX 1ECWA 3AQEA 4FT6A 3IP4B 2XICA 4WJ3B 5HR6A 3UAQA 2KZ7B 2O4VA 2XE1A 4O3YA 3SYBA 2BDUA 3F2DA 1A6SA 2F1VA 3V8UA 3F5AA 3VE2A 2JH7A 4NLCA 5DL6A 1D8BA 2KOBA 4XNKA 3L3FX 3LVWA 2KJ9A 3TZGA 4AYID 4D64A 1H6S1 4QQ1A 2FGQX 3O0FA 2N2MA 4OO1J 2W81C 1GO3F 4OJLA 2LHFA 5DL5A 3QRAA 2F2AB 2GOLA 3OPXA 4OJOA 4P0PA 4AKRA 4CGZA 4QJFB 3LK3A 3CYMA 1QJPA 4NWIA 2ZFGA 2LHTA 1GFNA 3SMVA 3C29A 3T24A 5EE2A 3G7GA 1A0PA 3M6ZA 1HXTA 2RRDA 3N7SC 4FZNA 4O3XB 2G06A 2JH1A 3NSGA 2Y7SA 3EMNX 2LBOA 4BUMX 3AA0B 2KICA 1THQA 2WB1F 4ACOA 2N2LA 8PRNA 3POQA 1MA7A 2ERVA 3QRCA 1PHOA 2ZIVA 2KHVA 1PVQA 3PQUA 3ONNA 4CRXA 2KIWA 2E1FA 4U6PA 1IZNA 3AA7B 2GH1A 3PRNA 2E1EA 3HW9A 1Z1BA 2XTRA 4GCPA 2ZIVB 2R18A 2LFUA 3CP8A 4A8EA 3F2BA 1PVPA 4XNLA 4O3MA 4LSIA 2JMGA 1Q9GA 2XMXA 3M6KA 2W03A 4JMUA 4NV0A 5HR7A 3F5EA 3RBHA 1HXUA 1QJ8A 3DEEA 3LK41 2G0AA 4AYDC 3N7RC 2M07A 4AYBC 5T5FA 2NV3A 4FZLA 1NZBA 2KXPA 3AQFA 2H3VA 2KVCA 2RP5A 4OJ6A 3IN5A 1QJ9A 3D2QA 3T20A 1XNSA 3LK2B 4RJXA 2RHFA 2VJ5A 2KC0A 2KJ5A 4O4XA 3AAEB 2HBKA 1P4TA 3AA0A 2DGZA 2XE5A 2ZXIA 3CRXA 1P7DA 2Y0KA 1ED1A 1ZQ1C 2KXPB 2H3FA 1PRNA 1IIPA 3POXA 4GCSA 1BT9A 2KZ7A 4BUGA 4B61A 3IG5A 1Q3UA 7PRNA 4D5UA 2HBMA 3SQIA 4OJ5A 4C69X 4BJQA 3POUA 3N7PD 2F77X 4U9CA 3K1ZA 1IZNB 2K8BB 3D2NA 3O0EA 3DA3A 4KRAA 1XO0A 1BH3A 2HOQA 2M0NA 3HOEA 1T94A 2G5IB 2OH2A 5A0LA 1L6NA 2KNJA 2MA1A 2Y0SC 3AL0B 4GHBA 4G76A 3VZWX 4E1TA 2F1TA 4JFBA 3UPGA 2ZLDA 1Z19A 1ZHZA 2WAQC 3PQSA 2F8LA 2YNKA 2GE4A 2LYBA 5JDPA 4GFJA 4C0ZA 4KX3A 2CRXA 2Y0HA 4FE3A 3PSTA 4AKRB 2W7OA 4LSHA 5C0YA 3HOLA 5AFUL 2A3VA 1Q3VA 2ZIWA 4QIWF 5CRXA 3AA6A 1MM4A 2Y2XA 3GU3A 5KL8B 1PVRA 2ZIXB 2W04A 1OUQA 1GFQA 3SY7A 4KX5A 3NUQA 1WUDA 3SY9A 4AUIA 3F53A 3AA1B 2D6FC 4GCQA 1ZHTA 5T14A 2M06A 2KDYA 2MRLA 2YX8A 3PSIA 1UPHA 3SAGA 3UU2A 4AZLA 4O4UA 3HWBA 4GF4A 2KEYA 3SAFA 4FSPA 2G07A 1DRGA 1OSMA 2HOIA 2VKQA 3RFAA 4FOZA 3VZUX 3PORA 4N58A 3JTYA 4FRTA 2J4UP 4F4BA 4FMSA 3PZPA 3T0SA 4P0QA 2KJ8A 3SZVA 3H0RB 4O3WA 3VCBA 5DL8A 2PMZF 2PORA 2W7PA 3KZXA 3IG8A 5IYUA 2JGAA 2G08A 2KKPA 2J1NA 4OJPA 2DF4B 1Q9FA 2ZIUB 1SZHA 4PL1A 1ZHXA 4PL2A 4PUXA 4RJWA 4LSFA 4FRXA 2ZIWB 2HBJA 3VY8X 3AA6B 4N59A 2XE3A 2CN1A 5FVNA 2OXOA 3AAAB 5AFUK 3WI5A 2H3ZA 4U7CA 2MNHA 2LYAA 4FSOA 2ZXHA 3FYXA 4KR4A 4AYNA 4AYBF 2Y0SF 4E1SA 3LYSA 1G90A 4AYMC 3H0LB 3LK42 3VY9X 2OYYA 4AKMA 1YT3A 3AA1A 4KR8A 1HIWA 4AFKA 3SZDA 2OMFA 1KBUA 1GFOA 2LKYA 2F76X 3ICXA 2K4IA 1ORMA 3SYSA 4O49A 2DQNB 4AYEC 1E54A 2G5HB 1HXXA 3RF9A 5ADXK 3VC8A 2KV2A 4JCHA 4P0QB 3PSPA 2ZG6A 2K4TA 5KL1B 2KKVA 4P0PB 2XE2A 2N1RA 3AA7A 2ODJA 2XI9A 2WB1C 3ALRA 1GFMA 3LK3B 1BXWA 3D2SA 2K0LA 1YS5A 2QTKA 3KVDD 4NLBA 2PRNA 4BX9C 3MGVA 2W80C 2JHDA 3AAAA 2XVTA 2H3IA 3K19A 5DL7A 2OM6A 2VJ4A 3H0MB 2H3QA 2YB4A 2Q4TA 4IC9A 5PRNA 1GFPA 3DA4A 2KHQA 3E0FA 2VIXA 4RLCA 2ZIXA 2WAQF 3GZFA 3LK2A 2PMZC 3C5OA 4LSEA 4Z3TA 6PRNA 2HMXA 3LVVA 4KMOB 2Z7JA 3WI4A 5GV0A 1OPFA 3KFUF 4QNLA 2XTQA 4FZMA 1MPFA 2K8CB 4RLBA 3HKZF 5ADXL 1HEKA 5G26A 2K89A 1ZHYA 1F44A 1CRXA 2XIDA 5D5DA 4CDGA 4QIWC 1URJA 1MM5A 4ICAA 3HKZC 2JMMA 2KD1A 2K4EA 2K8AA 2E5SA 3VZTX 2XG6A 3C28A 4O3ZA 2YPVA 2HOFA 1ZHWA 2K4HA 3PSFA 4FUVA 4G75A 2CPRA 2G09A 3VE1A 4D65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  4G75 A;  2XTQ A;  4N59 A;  3DA4 A;  2XMX A;  4FZM A;  4FZN A;  4N58 A;  2XTR A;  4FZL A;  3DA3 A; 
#chains in the Genus database with same CATH topology
 4O3Q A;  2QAR B;  1NI3 A;  2ZIU A;  3SAH A;  3AAE A;  3F2C A;  4EEK A;  4PH5 A;  5KFS A;  2BQU A;  2ESE A;  2HBL A;  3M7D A;  5J2B A;  1QQ7 A;  4MF2 A;  4RQ7 A;  3GIJ A;  2YB1 A;  4RT2 A;  1XSP A;  3AQE A;  3QX7 A;  1KL9 A;  2XIC A;  4WJ3 B;  3EPI A;  5L1I A;  4O3Y A;  1RZT A;  4I2E A;  3V6J A;  5J2D A;  4ECT A;  2JH7 A;  3PW4 A;  4YXM A;  1D8B A;  1JAL A;  5F9L A;  4XNK A;  1V97 A;  4F92 B;  3H7I A;  3L3F X;  4C4V A;  5HMM A;  3LVW A;  2KJ9 A;  4N75 A;  4FO6 A;  2NRT A;  9ICE A;  2Y9U A;  4AYI D;  1UT5 A;  2BPF A;  1IV8 A;  1RYS A;  1L3S A;  1UCV A;  5AI8 A;  3UPQ A;  3J81 j;  3WK7 A;  4EZ6 A;  5J0T A;  4PJ0 O;  3O0F A;  4J9S A;  2R8G A;  1LVH A;  4OJL A;  4F4Z A;  3TAP A;  4DL6 A;  2ODG A;  2LHF A;  5E79 O;  5DL5 A;  1WCN A;  4O5E A;  2F2A B;  2GOL A;  3QRA A;  1MQ3 A;  3OPX A;  3QEB Z;  4MFF A;  5J29 A;  1SXD A;  3LK3 A;  3CYM A;  2ZJ5 A;  3G6X A;  4JWM A;  3UM9 A;  1JMS A;  1QJP A;  4NWI A;  8ICA A;  4BXO A;  3SMV A;  1NNL A;  5HP4 A;  3T24 A;  3M8S A;  3G7G A;  5IIO A;  1A0P A;  3C2M A;  4ECR A;  1S77 D;  2CXY A;  2RRD A;  2LMR A;  3N7S C;  2G06 A;  3C5F A;  2AQ0 A;  3NSG A;  2Y7S A;  2EAO A;  2LBO A;  5KFL A;  2KFN A;  1THQ A;  4ACO A;  4US9 A;  2R4N A;  1BGX T;  3T3F A;  8PRN A;  3M9N B;  3K75 D;  2ERV A;  3QRC A;  3TAQ A;  3I1Y A;  9ICR A;  3JCU O;  1HJP A;  2KHV A;  3PQU A;  4IQU A;  9ICX A;  4O3R A;  3ZDA A;  4JV1 A;  7ICU A;  2E1E A;  1T3N A;  2FLP A;  1C20 A;  1X66 A;  3NS1 A;  9ICJ A;  9ICA A;  4YMN A;  2XTR A;  2ZIV B;  4GCP A;  4P4P A;  5JU5 A;  4I2A A;  4GXI A;  2KVS A;  3EYZ A;  4XNL A;  4K4G A;  4O3M A;  1BPE A;  3QUQ A;  3H8M A;  2JMG A;  2IWV A;  1PK1 B;  2NRZ A;  2X9K A;  3RBH A;  5AIB A;  4Z6D A;  2G0A A;  5CR0 A;  1ZQM A;  4YFK A;  1IM4 A;  3PV8 A;  3N7R C;  1JUD A;  2V9W A;  2M07 A;  4AYB C;  5T5F A;  5ALG A;  2NV3 A;  4FZL A;  2KXP A;  2C22 A;  2LI6 A;  5KG5 A;  1XNS A;  3ISD A;  3QXG A;  2VJ5 A;  2KC0 A;  2KJ5 A;  3M9M B;  2HBK A;  2HHS A;  2E3T A;  3PW7 A;  1S10 A;  1JRP A;  4GXJ A;  3WU2 O;  4DQQ A;  5DB7 A;  4UB1 A;  2Y0K A;  3HIL A;  1ZQ1 C;  1T1L A;  2KXP B;  2H3F A;  3BQ7 A;  3T5K A;  1ZQP A;  4UAS A;  4BUG A;  4RQ2 A;  1Q3U A;  2F44 A;  2H5X A;  7PRN A;  4D5U A;  2HBM A;  5DB6 A;  1D8L A;  4TUR A;  1X2I A;  3N7P D;  2XO7 A;  1IZN B;  2IOF K;  3GQC A;  5AI9 A;  3BS0 A;  3QUB A;  3GIM A;  1XO0 A;  1F5S A;  4B9M A;  2J6T A;  2M0N A;  1JX4 A;  4B9U A;  4UB4 A;  4F3O A;  2G5I B;  5A0L A;  5IIL A;  2I6X A;  4TQR A;  2Y0S C;  2W9C B;  1SWV A;  1TK8 A;  5J0Q A;  3H8W A;  2ATL A;  2F1T A;  4G3I A;  5KFW A;  2YML A;  1N5W A;  5AKH A;  4X5V A;  2GE4 A;  5AM0 A;  4YR2 A;  2WF7 A;  1S5L U;  3AU2 A;  2Y0H A;  3PGR A;  3PO4 A;  2P35 A;  2DBY A;  4BDP A;  3BDP A;  3WKE A;  5C0Y A;  4QZH A;  5AFU L;  2GLE A;  2A3V A;  2R4O A;  1NK5 A;  1WG8 A;  5CRX A;  5BPC A;  2NRW A;  2BZF A;  1RXW A;  1MM4 A;  2Y2X A;  1SIJ A;  5KL8 B;  1L3T A;  1GFQ A;  5ALN A;  3SY7 A;  3NUQ A;  1WUD A;  2JEF A;  5JRT A;  3L5K A;  4UAZ A;  4M47 A;  4YP3 A;  1T3Q A;  2AHO B;  9ICG A;  1UPH A;  2ISO A;  1ZET A;  4PGQ A;  4QZG A;  2E8O A;  2NRX A;  4M9N A;  1BPB A;  4UAW A;  1LV5 A;  4GF4 A;  3SAF A;  1SKS A;  5ALQ A;  1OSM A;  4P4O A;  2HOI A;  4FOZ A;  1N60 A;  5EWG A;  4RQ0 A;  3RH4 A;  4F5O A;  4OCZ A;  2BCR A;  1QSL A;  2ASD A;  4YR0 A;  1CEZ A;  2D3D A;  3T0S A;  4P0Q A;  3H0R B;  1V38 A;  4B6J A;  5DL8 A;  2PMZ F;  2W7P A;  3KZX A;  2W3S A;  2QAR A;  4Y2T A;  5ALP A;  5ALV A;  2J1N A;  4DO9 A;  2DF4 B;  5J2A A;  4KN4 A;  1ZRN A;  1Q9F A;  2ZIU B;  1ZD5 A;  1D9F A;  4J9K A;  1PK1 A;  2LM1 A;  1S97 A;  4K3C A;  4M9L A;  4DL2 A;  4N59 A;  2HVH A;  4C4S A;  4DSI A;  8ICJ A;  4HYK A;  2MNH A;  4J9O A;  3FYX A;  5KT2 A;  4AYB F;  3KHR A;  4EBD A;  1TK5 A;  3WKC A;  3DWN A;  3VY9 X;  1T7P A;  4MFA A;  2XCA A;  2E8P A;  1QTM A;  7ICP A;  5L9X A;  7ICN A;  4F50 A;  4KR8 A;  1MN8 A;  1MC8 A;  4Q44 A;  8ICV A;  7ICT A;  2BR0 A;  4UB6 U;  4TUP A;  5AK6 A;  3FM9 A;  2AQ4 A;  3TFS A;  1GFO A;  2DWQ A;  5AM4 A;  2F76 X;  2K4I A;  1XWL A;  1ZQV A;  4AYE C;  1ZQA A;  2KSO A;  4XUS A;  3QU7 A;  3FAH A;  5KFF A;  2G5H B;  2FDR A;  3UQ2 A;  3RF9 A;  1RM6 C;  1L8O A;  1X9W A;  4YG2 A;  4DF4 A;  5AKL A;  3QZ7 A;  2ZTE A;  4FFD A;  1Z00 A;  2ZG6 A;  3FC4 A;  4LVS A;  5AM1 A;  3NVY A;  4O9M A;  2KKV A;  1N5X A;  4KLQ A;  7ICL A;  5AKZ A;  2ODJ A;  1NK7 A;  4Y2X A;  3QU4 A;  3ZD8 A;  2K0L A;  2JZB B;  3EPG A;  9ICM A;  5KFA A;  3EUB 2;  5CB1 A;  4BX9 C;  4R8U B;  2JHD A;  4DL5 A;  5IIN A;  2XVT A;  2D8C A;  1ZQL A;  3GIL A;  2AGQ A;  4KTQ A;  2JZB A;  2ZUC A;  1BPX A;  1SZP A;  5E79 U;  5KFH A;  5L1L A;  3E0F A;  2VIX A;  2WVP A;  4M04 A;  8ICH A;  2ZIX A;  3LK2 A;  2HHW A;  2WTF A;  3RB0 A;  3NGD A;  4Z3T A;  2I9G A;  1L8L A;  6PRN A;  3PO5 A;  4JK1 A;  5J2J A;  1TAQ A;  9ICO A;  3LVV A;  3FDS A;  1KLN A;  3RJH A;  3C1Y A;  2K4P A;  5GV0 A;  2AGP A;  1ZQW A;  4TQS A;  3MGH A;  3PGU A;  1XC9 A;  4KLF A;  3HKZ F;  8ICR A;  3JPN A;  1TFR A;  1ZJM A;  1ZQR A;  5G26 A;  5KFT A;  2K89 A;  5D5D A;  4IQW A;  1URJ A;  3NVV A;  5DQG A;  4ED1 A;  3VZT X;  4F5R A;  1D8Y A;  5ALW A;  9ICC A;  1L7O A;  4B9S A;  4FUV A;  5TIS O;  4R63 A;  4RQ3 A;  2I5H A;  1N62 A;  1X42 A;  4DQR A;  1RXV A;  3ZDD A;  3EZ5 A;  3PF1 A;  1TAM A;  5DG8 A;  2A1A A;  4FES A;  3NRW A;  3RAX A;  1FEZ A;  3A2S X;  4C80 A;  5KG3 A;  4Y2V A;  2NRV A;  2ZJ8 A;  5AIC A;  1UA1 A;  5KG4 A;  2JR5 A;  4QZI A;  4NJ8 A;  3RJK A;  5KFZ A;  1FO4 A;  1XSN A;  4YMM A;  4ECZ A;  3BS5 B;  4M6W A;  5DL6 A;  5KT6 A;  8ICL A;  2HI0 A;  3N97 B;  3GIK A;  5KAF O;  4J9M A;  2JV3 A;  4RNO A;  2A1J B;  5EE9 A;  2KFZ A;  1H6S 1;  4K4H A;  1LKY A;  3TAD A;  3NVZ A;  2AXT U;  5GTI O;  3GV7 B;  4QZF A;  2FGQ X;  4MF8 A;  1V9P A;  1L5U A;  5B66 U;  4OO1 J;  1DK2 A;  2A1J A;  2R8K A;  3NVW A;  1PK3 A;  2BCV A;  1ZQU A;  4EX6 A;  2ZJA A;  8ICU A;  3WK4 A;  2MAX A;  4YCX A;  5IIM A;  2QB1 A;  3WK5 A;  1U4B A;  3C29 A;  7ICI A;  4I2F A;  4F4K A;  3LK9 A;  2XGP A;  5KFG A;  1HXT A;  4OD0 A;  2UVR A;  1OW5 A;  2OWO A;  3MFH A;  4DS5 A;  5EE3 A;  4CNQ A;  2UVV A;  4Y2R A;  2KIC A;  1A77 A;  5G5H A;  1NOM A;  2HVI A;  4DFM A;  4JV0 A;  5AKI A;  2N2L A;  2UVW A;  1SGG A;  5D46 A;  7ICO A;  2PKE A;  8ICT A;  2F3N A;  1TVA A;  4DSF A;  2ZIV A;  5AKY A;  3QU5 A;  1PVQ A;  2PFP A;  4KLU A;  2FLN A;  5J2C A;  3BRZ A;  1SV4 A;  5TIS U;  2KIW A;  2E1F A;  3AA7 B;  1N63 A;  5DB8 A;  3HW9 A;  2NO5 A;  4ZOH C;  2O6K A;  1Z1B A;  3BQ1 A;  5KFD A;  1FFV A;  4LZG A;  2LFU A;  3KHG A;  3TAD C;  1ZQE A;  8ICZ A;  4F4Y A;  4M9H A;  3HT3 A;  2W03 A;  1Q46 A;  4ECQ A;  4NV0 A;  5DQI A;  1SWW A;  1QJ8 A;  3LK4 1;  3UXP A;  3AU6 A;  5CHG A;  2QKQ A;  4Y2J A;  2QB0 A;  2R4P A;  4OJ6 A;  3IN5 A;  3M9O B;  9ICP A;  5KFV A;  1P4T A;  3AA0 A;  3L4P A;  3BQ2 A;  4DLG A;  1QH9 A;  4Q8F A;  3IDW A;  5KFC A;  1TE2 A;  1ZQI A;  3CRX A;  1P7D A;  7ICQ A;  4F8R A;  5AI6 A;  2FMP A;  1IIP A;  3QEA Z;  3IV6 A;  2YMP A;  4B61 A;  4IRK A;  5B5E U;  4OJ5 A;  4I2C A;  3POU A;  1ZOL A;  2F77 X;  5KFJ A;  4B9T A;  3V7L A;  2RQ5 A;  1SV0 A;  2BHN A;  9ICB A;  1D9D A;  3JPS A;  3UMG A;  1BH3 A;  3ISB A;  1NJY A;  3Q8K A;  1L6N A;  5EE1 A;  3AL0 B;  1WWU A;  3VZW X;  2IOF A;  4I28 A;  3UPG A;  2ZLD A;  4EYI B;  2F1J A;  2WAQ C;  1K1S A;  2F8L A;  4DSE A;  5KG2 A;  1RDF A;  5EWE A;  4IL6 O;  5G38 A;  5KG0 A;  2EZZ A;  3A0B U;  3AEV A;  4FE3 A;  5F3X B;  1L3U A;  4CCH A;  2BCS A;  3C2K A;  4RNM A;  4LSH A;  5IIK A;  9ICV A;  4QIW F;  2BCU A;  5C5J A;  3ISC A;  2ZIX B;  4DCC A;  2W04 A;  4KX5 A;  2FPK A;  1S0O A;  4XRH A;  1RYR A;  4K3B A;  1ZJN A;  5KFO A;  3RJF A;  1FFU A;  4GCQ A;  2RDJ A;  3Q8Q B;  2KDY A;  2IOH A;  9ICT A;  3BQ0 A;  2L5Y A;  3E58 A;  2XCP A;  3UU2 A;  1KEJ A;  2KMD A;  4EEL A;  4FSP A;  2EZX A;  1DRG A;  4ECV A;  4D65 A;  3JPP A;  4KLG A;  3HWT A;  1XSL A;  2HW3 A;  5ALZ A;  2J6S A;  1QSY A;  4FRT A;  1YZ6 A;  4F4B A;  3VCB A;  1BPZ A;  7ICS A;  4F71 A;  2NO4 A;  2KKP A;  3Q8P B;  1JIH A;  1NK0 A;  3PNC A;  4ED2 A;  2DL0 A;  3U26 A;  4RJW A;  4FRX A;  2ZIW B;  4CF5 A;  4C4T A;  3TQ1 A;  2KE7 A;  1UT8 A;  3RRH A;  3AA6 B;  8ICP A;  5FVN A;  2OXO A;  3ETR A;  3AAA B;  3WI5 A;  4NL9 C;  2PFO A;  4FSO A;  4PZO A;  8ICC A;  4BXO B;  3LK4 2;  5KAI O;  5CJ7 A;  1YT3 A;  5H2F U;  1IG6 A;  2OEH A;  2AJQ A;  8ICO A;  1J2N A;  1HIW A;  2KN7 A;  4AFK A;  3V72 A;  3DV9 A;  5BOM A;  4DSJ A;  2LKY A;  2Y1I A;  3ICX A;  3SYS A;  3JPO A;  2DQN B;  3KKA A;  5ALU A;  1E54 A;  1HXX A;  2PI5 A;  2VAN A;  1ZD4 A;  1BPY A;  2MUT B;  1S0M A;  3VC8 A;  2ASJ A;  2KV2 A;  4JCH A;  3ZDC A;  2JRZ A;  5J0O A;  3SZ2 A;  5KL1 B;  1O08 A;  3PX0 A;  5DBB A;  2W55 A;  3KOO A;  2FE9 A;  4P0P B;  1MSW D;  2N1R A;  2XE2 A;  1B0X A;  4Y2Q A;  1L7P A;  1QCK A;  4BWM A;  3ALR A;  1BXW A;  3D2S A;  4DQS A;  8ICF A;  2QTK A;  5ALI A;  3H4B A;  2EDU A;  2VA8 A;  5ALO A;  4RUC A;  2W80 C;  4QZC A;  1YZ7 A;  4JV2 A;  4EEN A;  4IR1 A;  1ZRM A;  3HP6 A;  2VJ4 A;  4PR7 A;  4IC9 A;  5PRN A;  3OTQ A;  3H8S A;  5HHH A;  3DA4 A;  1JXE A;  4RLC A;  1QLN A;  1X6I A;  5ALD A;  3KHH A;  5K4L A;  2WAQ F;  1UA0 A;  3GZF A;  4R64 A;  3QUC A;  1Z4N A;  8ICS A;  3DZM A;  4LSE A;  1X9M A;  1VLB A;  1N61 A;  4Q8E A;  4RQ4 A;  5EOZ A;  2V4Q A;  2W9C A;  3WI4 A;  4ED3 A;  3BS5 A;  1OPF A;  4CTD A;  5D49 A;  3KFU F;  2KTQ A;  3KKA C;  4US8 A;  3KTQ A;  2ES6 A;  4RLB A;  1XO1 A;  1HEK A;  4C8L A;  5KT7 A;  1LKY B;  4CDG A;  3H40 A;  4QIW C;  4UBC A;  1MM5 A;  4UB5 A;  4TUQ A;  2K8A A;  3PX4 A;  4XA5 A;  2UVU A;  3T5J A;  3C28 A;  4O3Z A;  2YPV A;  4PHD A;  4DQP A;  2IMW P;  4G75 A;  2CPR A;  1IXR A;  4KLL A;  2PXI A;  1KDH A;  5ALT A;  3OSP A;  5III A;  2DUY A;  4DEZ A;  2DPI A;  2E8M A;  8ICQ A;  3T79 A;  3ZDB A;  2Y0L A;  5CA7 A;  3THV A;  3GFK B;  4RL9 A;  4I2H A;  1ECW A;  2W3R A;  4I2I A;  4Y2S A;  3PMN A;  7ICH A;  2O4V A;  4NL9 A;  1COO A;  3SYB A;  3D6J A;  1A6S A;  5JTI A;  1TV9 A;  3RB3 A;  4JWN A;  4O5C A;  2F1V A;  3V8U A;  1TKD A;  5BOL A;  3F5A A;  5EWF A;  3VE2 A;  5DGA A;  4UAU A;  1NK9 A;  3LWM A;  2VA2 A;  5DDY A;  2BPG A;  4EYH B;  5J2G A;  4C8M A;  3PGS A;  1K1Q A;  3SV4 A;  4J9N A;  4B9N A;  1HUZ A;  4FQE A;  3TZG A;  4Y2Y A;  3N28 A;  2JEJ A;  1ZQN A;  1V85 A;  2MUT A;  2C28 A;  3A0H U;  5ALK A;  2HDO A;  2N2M A;  5J2E A;  2W81 C;  3JPR A;  4UB3 A;  1S5L O;  2YQE A;  4G9B A;  2ZTD A;  4DOA A;  4OJO A;  2BQR A;  4P0P A;  4BWJ A;  2B0C A;  5GTH U;  2JEG A;  4QJF B;  2YTU A;  1ZQX A;  3S6J A;  2LHT A;  2Y1J A;  1GFN A;  1PZN A;  3LDA A;  3GV5 B;  4LJX A;  4MEX A;  5GTH O;  1UHU A;  5J0X A;  2AU0 A;  1N2X A;  5KFR A;  1FIQ A;  4FZN A;  1ZYQ A;  2JH1 A;  1B43 A;  3EMN X;  9ICW A;  1QQ6 A;  3AA0 B;  3HW8 A;  2WB1 F;  4LZD A;  4UQG A;  3IRU A;  1PUZ A;  2FPL A;  3OJS A;  3POQ A;  5CP2 A;  4J9Q A;  4F5P A;  1RQN A;  1X9S A;  4C8O A;  4QZ9 A;  3E2E A;  1RG6 A;  4CRX A;  4NLZ A;  4MFC A;  2IBK A;  4U6P A;  1IZN A;  2GH1 A;  2OHF A;  4RNN A;  1BNO A;  5KT3 A;  2P6U A;  3V6H A;  7ICV A;  4DOB A;  4MHV A;  1PVP A;  4DFD A;  9ICH A;  1Q9G A;  3CW2 C;  4BGD A;  4JMU A;  4DFK A;  2DKX A;  1OXJ A;  2BPC A;  5IIJ A;  5HR7 A;  1HXU A;  3DEE A;  4F72 A;  5KFP A;  4AYD C;  5B66 O;  3KBB A;  1WCL A;  1EXN A;  3AQF A;  2H3V A;  2KVC A;  2RP5 A;  1QJ9 A;  3D2Q A;  3T20 A;  2BGW A;  1M6Y A;  3Q8M A;  2BCQ A;  4J03 A;  4O4X A;  3WKB A;  2XE5 A;  3Q8R B;  8ICE A;  4FBU A;  3A0B O;  4F93 B;  3PML A;  1ZQH A;  1PRN A;  3BZK A;  3NRZ A;  2W8K A;  1BT9 A;  4GCS A;  4ED0 A;  2K60 A;  3IHQ B;  3FYH A;  2KZ7 A;  2W8L A;  2F1H A;  4QZ8 A;  1KFT A;  1JRO A;  4DSL A;  4BJQ A;  1KFD A;  2HHU A;  3Q8L A;  3TKA A;  2MSN A;  3DA3 A;  2XY7 A;  1L7M A;  2HOQ A;  5KFE A;  1T94 A;  1SKW A;  2MA1 A;  1MQ2 A;  4GHB A;  2YN4 A;  4RQM A;  4E1T A;  8ICW A;  4JFB A;  2KK0 A;  2RLT A;  3AN1 A;  3V7J A;  1Z19 A;  1ZHZ A;  2XY5 A;  3I28 A;  1CUK A;  1BNP A;  1XS9 D;  5JDP A;  2HHX A;  4TUS A;  1N48 A;  4KX3 A;  3PST A;  5KNI A;  2W7O A;  4PJ0 U;  1U45 A;  3HOL A;  3KZI U;  2A19 A;  2C2D A;  3AA6 A;  5L1J A;  1BPD A;  3RBE A;  3GU3 A;  1PVR A;  1OUQ A;  2KIV A;  1XU4 A;  1HUO A;  5ALM A;  1ZXI A;  3QUT A;  4AUI A;  5HML A;  4ECX A;  3F53 A;  5G39 A;  2HCF A;  4RPZ A;  2LM4 A;  2R89 A;  1ZQT A;  4JUZ A;  3SYZ A;  3RH6 A;  4RQN A;  4NLG A;  1DK3 A;  2EAM A;  4QWC A;  2M06 A;  2MRL A;  3PSI A;  1ARO P;  3SAG A;  4IRD A;  4EX7 A;  2WF5 A;  1Z3E B;  1O03 A;  5KFN A;  1F0M A;  5J2I A;  3HWB A;  5DLG A;  2KEY A;  2WF8 A;  1S0N A;  2G07 A;  4IS7 A;  5ALL A;  3RFA A;  4N58 A;  5KAI U;  5KFK A;  4DLE A;  4PZN A;  3EWA A;  2J4U P;  3PZP A;  3WU2 U;  3RBD A;  3WKD A;  3SZV A;  2KJ8 A;  3MDC A;  4O3W A;  4ED8 A;  4I2B A;  2POR A;  4DL7 A;  3IG8 A;  4I2J A;  1NKC A;  2JGA A;  1CI4 A;  3PY8 A;  4F5N A;  2P66 A;  5ALR A;  1SZH A;  3PX6 A;  4PHP A;  4PHE A;  4PL2 A;  1ZHX A;  4PUX A;  5L1M A;  2YMQ A;  4Z6E A;  2HBJ A;  4YD2 A;  3VY8 X;  3RJJ A;  5J0P A;  2XE3 A;  3I76 A;  5AFU K;  4NXZ A;  2H3Z A;  4F2R A;  1SL0 A;  2ZXH A;  4KR4 A;  4AYN A;  4E1S A;  2Y0S F;  1X40 A;  3IM1 A;  4AYM C;  4C00 A;  2KP7 A;  2WFA A;  2XY6 A;  4KLI A;  4AKM A;  7ICF A;  3AA1 A;  1KTQ A;  2WJQ A;  3H8J A;  4EBC A;  4UB6 O;  1T16 A;  3QZ8 A;  3BZC A;  1NK4 A;  3K4G A;  4ECU A;  3TAR A;  4I2G A;  2OMF A;  4Y2U A;  3QNM A;  3V6K A;  3RTV A;  4O49 A;  4CF3 A;  4QZA A;  4ECW A;  4DFJ A;  5GTI U;  2AXT O;  5HNK A;  1RQL A;  5ADX K;  2YMM A;  2B6G A;  1JI7 A;  2W54 A;  4P0Q B;  3V7K A;  5AKX A;  2EH9 A;  3MC1 A;  4EEY A;  1L3V A;  4C8N A;  5DGB A;  9ICU A;  1S8O A;  4CF4 A;  2QB0 B;  1ZQY A;  4NY8 A;  4O3S A;  4GIB A;  4C4R A;  1YS5 A;  1KW4 A;  5KG7 A;  2W9M A;  2FLL A;  5AKE A;  1JN3 A;  1U48 A;  5AM5 A;  4B9L A;  8ICG A;  5DL7 A;  4KIT B;  4F4W A;  3G6Y A;  2F1I A;  5B5E O;  3TAN A;  1A76 A;  2YB4 A;  2HHQ A;  4R65 A;  4KLO A;  4QWB A;  5KFX A;  2IWW A;  2QLT A;  3B9J A;  5FP0 A;  5KT5 A;  5AM2 A;  4F5Q A;  3PW2 A;  1ZQS A;  2ZUB A;  5J2K A;  3KHL A;  3A0H O;  2ZTC A;  2HSZ A;  4FS2 A;  3ORY A;  8ICB A;  2EZY A;  3C2L A;  2PMZ C;  4UB8 U;  5AKJ A;  2EAP A;  2R4L A;  5DG7 A;  3OJU A;  2HMX A;  4KMO B;  1SL1 A;  2AGO A;  1SKR A;  2FMS A;  2R8A A;  3RR8 A;  2PFQ A;  1T4G A;  4QNL A;  2HHT A;  4FZM A;  4EZ9 A;  1MPF A;  4I27 A;  3RJE A;  2R8H A;  3GDX A;  1QQ5 A;  5D4B A;  5KFB A;  3MAB A;  2XID A;  4RZR A;  1F44 A;  3UQ0 A;  2JMM A;  2B21 A;  1ZQK A;  2K4E A;  5KFQ A;  2E5S A;  3B0X A;  3C23 A;  2DKZ A;  3SI8 A;  5AKG A;  9ICK A;  3PSF A;  1NJZ A;  3RR7 A;  2G09 A;  5H2F O;  4XQ8 A;  2W43 A;  1U9L A;  2FGR A;  3GP6 A;  4EBE A;  4QZD A;  2WJR A;  2MHL A;  3WK6 A;  4GC6 A;  2X27 X;  7ICM A;  2WHE A;  1JXL A;  4B9V A;  4FT6 A;  4M9J A;  3IP4 B;  5HR6 A;  3UAQ A;  2FPM A;  3RJI A;  2KZ7 B;  9ICS A;  2XE1 A;  1ZQZ A;  2BDU A;  5J0U A;  3F2D A;  3BRY A;  8ICK A;  3ETL A;  4I29 A;  1ZQJ A;  5J8Y A;  3DWO X;  1KFS A;  4NLC A;  1ZQD A;  2RDI A;  3JPT A;  3UMC A;  3C21 A;  2KOB A;  4J9R A;  2AH5 A;  1H38 A;  4GC7 A;  3R9K A;  1ZQQ A;  4RUA A;  3MR5 A;  5AK5 A;  4UB2 A;  4D64 A;  4QQ1 A;  1WWV A;  4PPX A;  2KZ3 A;  9ICQ A;  4Q45 A;  1DGJ A;  2PFN A;  1K5O A;  1GO3 F;  4QWA A;  5L1K A;  4IL6 U;  4FS1 A;  4GLX A;  4UAR A;  5J2F A;  3MBY A;  4M9G A;  4KLD A;  1S0V A;  4AKR A;  5J8Y C;  4CGZ A;  2Q0Z X;  2ZFG A;  5DQH A;  2W9B B;  4Z6C A;  3CNH A;  5AIA A;  4UAY A;  2WF9 A;  2I1Q A;  2PI4 A;  5EE2 A;  3M6Z A;  5KFY A;  1KN5 A;  5G3A A;  4O3X B;  1N56 A;  3N4M B;  4BUM X;  3QYP A;  2ISP A;  1RPL A;  4RQ6 A;  3QU9 A;  4DL3 A;  4IR9 A;  3HX0 A;  1MA7 A;  2R8I A;  3PW0 A;  1PHO A;  4UAT A;  3ONN A;  1Z00 B;  4RQ8 A;  4KLJ A;  2XGQ A;  5HHI A;  1AQ6 A;  1ZQF A;  3PRN A;  1QSS A;  5ALF A;  2LYH A;  3SEI A;  1KQQ A;  3OSN A;  3B0Y A;  3PW5 A;  2R18 A;  3SD7 A;  3CP8 A;  4A8E A;  4USA A;  3F2B A;  8ICY A;  4YVZ A;  4R8U A;  2ALZ A;  3MR6 A;  4LSI A;  4YN4 A;  4QZE A;  3HPO A;  2NYV A;  3M6K A;  2XMX A;  4NLK A;  3F5E A;  3M8R A;  3GV8 B;  3ED5 A;  4KN7 A;  3TAC B;  5J0R A;  2C2E A;  2KG5 A;  3DDH A;  2MU2 A;  2P6R A;  4P2H A;  2BKE A;  5AK3 A;  5KT4 A;  1NZB A;  3NJT A;  3KD3 A;  4YXJ A;  4DOC A;  3UMB A;  1SL2 A;  3LK2 B;  5ALY A;  4F2S A;  5DDM A;  4RJX A;  2RHF A;  4Z6F A;  1NKE A;  1Z4O A;  5J0W A;  3AAE B;  2DGZ A;  2ZXI A;  1VDV A;  2JXJ A;  1ED1 A;  1NJX A;  3POX A;  1B4F A;  3PR5 B;  9ICN A;  1RYU A;  3BS7 A;  3NTU A;  3TFR A;  5DB9 A;  3IG5 A;  4E0D A;  1ZQB A;  5J0S A;  2LPE A;  3SQI A;  4C69 X;  2E8N A;  4RT3 A;  4C7Z A;  1DXS A;  4U9C A;  3K1Z A;  3NAS A;  1KRP A;  2K8B B;  3D2N A;  3O0E A;  1Q8K A;  2FJ6 A;  4KRA A;  4O3O A;  5ALS A;  1VJ5 A;  3ZI4 A;  1UQV A;  3HOE A;  4UB8 O;  2OH2 A;  4C7Y A;  1X9X A;  4ECY A;  1L7N A;  2KNJ A;  3AM9 A;  3MDA A;  4G76 A;  8ICI A;  5F9N A;  4KLM A;  4AP9 A;  3M1Y A;  1NKB A;  3C5G A;  2EAN A;  3PQS A;  2R8J A;  2YNK A;  2LYB A;  4UW9 A;  1SXE A;  4GFJ A;  5KFI A;  5JUM A;  2FMQ A;  4M2Y A;  4C0Z A;  3BJY A;  2CRX A;  1COK A;  4AKR B;  2JEI A;  5AKK A;  5KG1 A;  1U49 A;  1ZQC A;  1Q3V A;  1Y88 A;  2ZIW A;  4FBT A;  5CWR A;  3PR4 A;  3MFI A;  3UXN A;  3QE9 Y;  2WF6 A;  2C2R A;  3MR3 A;  4J9L A;  3ZDE A;  1TAU A;  3SY9 A;  4QWE A;  1ZD3 A;  3LWL A;  5ALH A;  4PGX A;  4RU9 A;  5AK4 A;  5ALX A;  3AA1 B;  2D6F C;  1TK0 A;  1ZHT A;  4DWI A;  5T14 A;  1U47 A;  4ELT A;  3RJG A;  7ICR A;  2YX8 A;  3H4D A;  3SEN A;  3SR6 A;  2F8K A;  3AMZ A;  4AZL A;  2W11 A;  5KFM A;  4O4U A;  5EE0 A;  2BDP A;  5AM3 A;  3C1Z A;  4F91 B;  2VKQ A;  1C7Y A;  4ELU A;  3VZU X;  4M6W B;  4YR3 A;  1J97 A;  4O5K A;  3POR A;  1ZQO A;  4DFP A;  3BQT A;  3JTY A;  1SB3 C;  4FMS A;  4QW9 A;  8ICM A;  4NM2 A;  3T5L A;  3UXO A;  1DOQ A;  1J2M A;  7ICG A;  5IYU A;  2F1C X;  2Y9T A;  2G08 A;  5KG6 A;  4OJP A;  2ZUD A;  4IQT A;  4PL1 A;  4KLE A;  3AUO A;  2IHM A;  4ED6 A;  4LSF A;  4DS4 A;  4NM1 A;  4QW8 A;  2ASL A;  2CN1 A;  2OCE A;  4U7C A;  2LYA A;  3RRG A;  1WYG A;  4RPY A;  3G6V A;  7ICJ A;  4DL4 A;  3LYS A;  1G90 A;  2JQY A;  3H0L B;  4PHA A;  3OGU A;  2OYY A;  1B22 A;  4CE6 A;  4PGY A;  4J9P A;  3WK9 A;  4YD1 A;  4QWD A;  2IA6 A;  4NLN A;  4ED7 A;  4IRC A;  2GWS A;  4UAV A;  3MGI A;  5J2H A;  3SZD A;  1DGS A;  3GII A;  3ZD9 A;  9ICI A;  4GXK A;  1KBU A;  3RB6 A;  1ZD2 P;  5G5G A;  1NK6 A;  2J6U A;  4ZH4 A;  2VA3 A;  2KZZ A;  9ICL A;  4C4V B;  1ORM A;  4IQV A;  4MEY A;  1T8E A;  5TZV A;  5AI0 A;  4JB3 A;  4DF8 A;  5DKW A;  3QU2 A;  3HJE A;  3WKA A;  3SV3 A;  2V4R A;  2XC9 A;  3PSP A;  2K4T A;  4O3P A;  3AA7 A;  2YY6 A;  3JPQ A;  4N74 A;  2XI9 A;  1S76 D;  2WB1 C;  4YQW A;  7ICK A;  1GFM A;  3LK3 B;  2KZM A;  2GO7 A;  1SV0 C;  4I2D A;  3RH5 A;  1KKX A;  5AI4 A;  3RAQ A;  3KZI O;  4Q43 A;  5KTQ A;  7ICE A;  3KVD D;  4NLB A;  2W9B A;  2PRN A;  3MGV A;  5DLF A;  4P4M A;  4ELV A;  4K4I A;  3AAA A;  2H3I A;  5KFU A;  3K19 A;  2OM6 A;  4QZB A;  1ZQG A;  3Q8S B;  1Z1V A;  4DSK A;  3WK8 A;  2FI1 A;  3H0M B;  4KLH A;  2H3Q A;  5ALJ A;  2W9A A;  2Q4T A;  3K1R B;  2M9N A;  1GFP A;  5AHX A;  4M0A A;  3EW9 A;  2KHQ A;  4O0I A;  3OHB A;  3OHA A;  4DQI A;  4UBB A;  4Y2P A;  2R88 A;  2HHV A;  4KLS A;  4RQ1 A;  3C5O A;  1KSP A;  1LB2 B;  5ALE A;  5AI5 A;  9ICF A;  4C8K A;  2KSO B;  5DBC A;  2DPJ A;  2DFL A;  3T5H A;  2Z7J A;  1NZP A;  4KLT A;  1NJW A;  1BVS A;  4YMO A;  2XTQ A;  4RPX A;  2K8C B;  5CEH A;  3RB4 A;  5J0Y A;  8ICN A;  5ADX L;  1NK8 A;  4HAI A;  2IHN A;  4ECS A;  3MR2 A;  1ZHY A;  5DBA A;  1CRX A;  8ICX A;  2EQY A;  4O3N A;  3HRD D;  4ICA A;  3HKZ C;  4RQ5 A;  2KD1 A;  1X6J A;  3PVX A;  4R66 A;  2XG6 A;  4KMU A;  2HOF A;  1ZHW A;  2K4H A;  5KAF U;  2BQ3 A;  3TI0 A;  1S9F A;  4F4X A;  3VE1 A;  5DG9 A; 
#chains in the Genus database with same CATH homology
 2FGR A;  3GP6 A;  2ZIU A;  3SAH A;  3AAE A;  3F2C A;  2MHL A;  2HBL A;  3M7D A;  2X27 X;  1TAM A;  3T79 A;  2Y0L A;  4FES A;  3NRW A;  4RL9 A;  2YB1 A;  3A2S X;  1ECW A;  3AQE A;  4FT6 A;  3IP4 B;  2XIC A;  4WJ3 B;  5HR6 A;  3UAQ A;  2KZ7 B;  2O4V A;  2XE1 A;  4O3Y A;  3SYB A;  2BDU A;  3F2D A;  1A6S A;  2F1V A;  3V8U A;  3F5A A;  3VE2 A;  2JH7 A;  4NLC A;  5DL6 A;  1D8B A;  2KOB A;  4XNK A;  3L3F X;  3LVW A;  2KJ9 A;  3TZG A;  4AYI D;  4D64 A;  1H6S 1;  4QQ1 A;  2FGQ X;  3O0F A;  2N2M A;  4OO1 J;  2W81 C;  1GO3 F;  4OJL A;  2LHF A;  5DL5 A;  3QRA A;  2F2A B;  2GOL A;  3OPX A;  4OJO A;  4P0P A;  4AKR A;  4CGZ A;  4QJF B;  3LK3 A;  3CYM A;  1QJP A;  4NWI A;  2ZFG A;  2LHT A;  1GFN A;  3SMV A;  3C29 A;  3T24 A;  5EE2 A;  3G7G A;  1A0P A;  3M6Z A;  1HXT A;  2RRD A;  3N7S C;  4FZN A;  4O3X B;  2G06 A;  2JH1 A;  3NSG A;  2Y7S A;  3EMN X;  2LBO A;  4BUM X;  3AA0 B;  2KIC A;  1THQ A;  2WB1 F;  4ACO A;  2N2L A;  8PRN A;  3POQ A;  1MA7 A;  2ERV A;  3QRC A;  1PHO A;  2ZIV A;  2KHV A;  1PVQ A;  3PQU A;  3ONN A;  4CRX A;  2KIW A;  2E1F A;  4U6P A;  1IZN A;  3AA7 B;  2GH1 A;  3PRN A;  2E1E A;  3HW9 A;  1Z1B A;  2XTR A;  4GCP A;  2ZIV B;  2R18 A;  2LFU A;  3CP8 A;  4A8E A;  3F2B A;  1PVP A;  4XNL A;  4O3M A;  4LSI A;  2JMG A;  1Q9G A;  2XMX A;  3M6K A;  2W03 A;  4JMU A;  4NV0 A;  5HR7 A;  3F5E A;  3RBH A;  1HXU A;  1QJ8 A;  3DEE A;  3LK4 1;  2G0A A;  4AYD C;  3N7R C;  2M07 A;  4AYB C;  5T5F A;  2NV3 A;  4FZL A;  1NZB A;  2KXP A;  3AQF A;  2H3V A;  2KVC A;  2RP5 A;  4OJ6 A;  3IN5 A;  1QJ9 A;  3D2Q A;  3T20 A;  1XNS A;  3LK2 B;  4RJX A;  2RHF A;  2VJ5 A;  2KC0 A;  2KJ5 A;  4O4X A;  3AAE B;  2HBK A;  1P4T A;  3AA0 A;  2DGZ A;  2XE5 A;  2ZXI A;  3CRX A;  1P7D A;  2Y0K A;  1ED1 A;  1ZQ1 C;  2KXP B;  2H3F A;  1PRN A;  1IIP A;  3POX A;  4GCS A;  1BT9 A;  2KZ7 A;  4BUG A;  4B61 A;  3IG5 A;  1Q3U A;  7PRN A;  4D5U A;  2HBM A;  3SQI A;  4OJ5 A;  4C69 X;  4BJQ A;  3POU A;  3N7P D;  2F77 X;  4U9C A;  3K1Z A;  1IZN B;  2K8B B;  3D2N A;  3O0E A;  3DA3 A;  4KRA A;  1XO0 A;  1BH3 A;  2HOQ A;  2M0N A;  3HOE A;  1T94 A;  2G5I B;  2OH2 A;  5A0L A;  1L6N A;  2KNJ A;  2MA1 A;  2Y0S C;  3AL0 B;  4GHB A;  4G76 A;  3VZW X;  4E1T A;  2F1T A;  4JFB A;  3UPG A;  2ZLD A;  1Z19 A;  1ZHZ A;  2WAQ C;  3PQS A;  2F8L A;  2YNK A;  2GE4 A;  2LYB A;  5JDP A;  4GFJ A;  4C0Z A;  4KX3 A;  2CRX A;  2Y0H A;  4FE3 A;  3PST A;  4AKR B;  2W7O A;  4LSH A;  5C0Y A;  3HOL A;  5AFU L;  2A3V A;  1Q3V A;  2ZIW A;  4QIW F;  5CRX A;  3AA6 A;  1MM4 A;  2Y2X A;  3GU3 A;  5KL8 B;  1PVR A;  2ZIX B;  2W04 A;  1OUQ A;  1GFQ A;  3SY7 A;  4KX5 A;  3NUQ A;  1WUD A;  3SY9 A;  4AUI A;  3F53 A;  3AA1 B;  2D6F C;  4GCQ A;  1ZHT A;  5T14 A;  2M06 A;  2KDY A;  2MRL A;  2YX8 A;  3PSI A;  1UPH A;  3SAG A;  3UU2 A;  4AZL A;  4O4U A;  3HWB A;  4GF4 A;  2KEY A;  3SAF A;  4FSP A;  2G07 A;  1DRG A;  1OSM A;  2HOI A;  2VKQ A;  3RFA A;  4FOZ A;  3VZU X;  3POR A;  4N58 A;  3JTY A;  4FRT A;  2J4U P;  4F4B A;  4FMS A;  3PZP A;  3T0S A;  4P0Q A;  2KJ8 A;  3SZV A;  3H0R B;  4O3W A;  3VCB A;  5DL8 A;  2PMZ F;  2POR A;  2W7P A;  3KZX A;  3IG8 A;  5IYU A;  2JGA A;  2G08 A;  2KKP A;  2J1N A;  4OJP A;  2DF4 B;  1Q9F A;  2ZIU B;  1SZH A;  4PL1 A;  1ZHX A;  4PL2 A;  4PUX A;  4RJW A;  4LSF A;  4FRX A;  2ZIW B;  2HBJ A;  3VY8 X;  3AA6 B;  4N59 A;  2XE3 A;  2CN1 A;  5FVN A;  2OXO A;  3AAA B;  5AFU K;  3WI5 A;  2H3Z A;  4U7C A;  2MNH A;  2LYA A;  4FSO A;  2ZXH A;  3FYX A;  4KR4 A;  4AYN A;  4AYB F;  2Y0S F;  4E1S A;  3LYS A;  1G90 A;  4AYM C;  3H0L B;  3LK4 2;  3VY9 X;  2OYY A;  4AKM A;  1YT3 A;  3AA1 A;  4KR8 A;  1HIW A;  4AFK A;  3SZD A;  2OMF A;  1KBU A;  1GFO A;  2LKY A;  2F76 X;  3ICX A;  2K4I A;  1ORM A;  3SYS A;  4O49 A;  2DQN B;  4AYE C;  1E54 A;  2G5H B;  1HXX A;  3RF9 A;  5ADX K;  3VC8 A;  2KV2 A;  4JCH A;  4P0Q B;  3PSP A;  2ZG6 A;  2K4T A;  5KL1 B;  2KKV A;  4P0P B;  2XE2 A;  2N1R A;  3AA7 A;  2ODJ A;  2XI9 A;  2WB1 C;  3ALR A;  1GFM A;  3LK3 B;  1BXW A;  3D2S A;  2K0L A;  1YS5 A;  2QTK A;  3KVD D;  4NLB A;  2PRN A;  4BX9 C;  3MGV A;  2W80 C;  2JHD A;  3AAA A;  2XVT A;  2H3I A;  3K19 A;  5DL7 A;  2OM6 A;  2VJ4 A;  3H0M B;  2H3Q A;  2YB4 A;  2Q4T A;  4IC9 A;  5PRN A;  1GFP A;  3DA4 A;  2KHQ A;  3E0F A;  2VIX A;  4RLC A;  2ZIX A;  2WAQ F;  3GZF A;  3LK2 A;  2PMZ C;  3C5O A;  4LSE A;  4Z3T A;  6PRN A;  2HMX A;  3LVV A;  4KMO B;  2Z7J A;  3WI4 A;  5GV0 A;  1OPF A;  3KFU F;  4QNL A;  2XTQ A;  4FZM A;  1MPF A;  2K8C B;  4RLB A;  3HKZ F;  5ADX L;  1HEK A;  5G26 A;  2K89 A;  1ZHY A;  1F44 A;  1CRX A;  2XID A;  5D5D A;  4CDG A;  4QIW C;  1URJ A;  1MM5 A;  4ICA A;  3HKZ C;  2JMM A;  2KD1 A;  2K4E A;  2K8A A;  2E5S A;  3VZT X;  2XG6 A;  3C28 A;  4O3Z A;  2YPV A;  2HOF A;  1ZHW A;  2K4H A;  3PSF A;  4FUV A;  4G75 A;  2CPR A;  2G09 A;  3VE1 A;  4D65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...