4FZMA

Crystal structure of the bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
b'PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Antimicrobial protein
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzmA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzmA02
4G76A 3DA3A 2XTQA 4FZLA 4G75A 4N59A 2XTRA 4FZNA 2XMXA 4N58A 3DA4A 4FZMA
chains in the Genus database with same CATH superfamily
1ZHWA 2KZ7A 3C1ZA 4K3CA 2HBJA 4XA5A 4Z6DA 4AP9A 2E8OA 2JMMA 2Y7SA 5J0YA 1XSPA 2NYVA 4EX6A 1ZQBA 1N63A 1B22A 1Q9FA 2NO4A 4C8KA 3C1YA 3OTQA 4KN4A 7ICIA 2H3FA 1PHOA 5PRNA 2DQNB 5DBCA 1WCNA 2RRDA 3CRXA 5AKEA 2E8NA 5DDYA 3PO5A 9ICEA 2XGQA 2R4OA 1IXRA 4Z6CA 1K1SA 9ICLA 2Z7JA 5ALGA 1SL1A 2XGPA 1ZHZA 2UVWA 2Y0LA 4IS7A 4ELVA 3PGSA 4J9LA 1D8YA 2UVUA 8ICKA 4Y2VA 2M0NA 2W9BB 1ZQMA 4XNKA 4ED6A 2JEJA 2IWWA 1U9LA 2K4PA 2KJ9A 2WF7A 5CRXA 3RJHA 2RQ5A 5GTIO 2AU0A 2W04A 4M9JA 1NK0A 5ALWA 2EZYA 4IL6U 5ALXA 3V7LA 5EWFA 5ALUA 5KFOA 4R63A 1IZNA 4OJLA 2PFNA 1NZPA 2QTKA 4QZ8A 1ZQEA 3JCUO 5DBAA 4O3PA 4KLOA 2PMZF 2HOQA 3S6JA 4QZ9A 3KVDD 4C69X 8ICBA 4GF4A 4F91B 5J2GA 5HNKA 3HW8A 4UARA 1J97A 3H8SA 5IIIA 3Q8KA 1K1QA 5GTHO 5B66U 5KFGA 2WJRA 2KTQA 4F4ZA 5L1IA 3ISDA 5KT5A 4YMOA 1ZQTA 4P0QB 3RBHA 4TUPA 4M9NA 1N61A 1TVAA 2BCSA 3O0FA 5AFUL 1BNOA 1T94A 2W11A 2FMPA 1S8OA 3VZUX 3HJEA 2FGRA 4PJ0U 5ALZA 4UB6U 1N5WA 4QZDA 4FS1A 2A1JA 4AFKA 4RQ7A 3DV9A 5KFXA 3SR6A 5G26A 2IHNA 3VCBA 4RQ8A 3N28A 1KFSA 4TUQA 2KFNA 4OJ6A 5AK3A 4FZNA 4NLGA 3PGRA 2BGWA 4J9NA 5AI0A 4AKMA 3MABA 3TACB 5KG7A 2KVCA 5J0TA 4BXOB 2O6KA 5F9LA 4RU9A 4PHAA 5KFYA 4FBUA 3UXPA 2B0CA 3N4MB 1V85A 2PMZC 3QU2A 4FQEA 2XY5A 2ODJA 3EWAA 4C4TA 3SI8A 4JWNA 4RQ4A 2G09A 3VZTX 3TKAA 1FO4A 2MHLA 4CNQA 1ZXIA 5KAIO 2I9GA 4RNMA 2C22A 4TQRA 1L8OA 1COKA 2KV2A 4BGDA 4MFFA 3RRGA 2BPFA 4ICAA 5A0LA 2YNKA 2JH7A 1H38A 5EWEA 2EAOA 2C2RA 1DGJA 4WJ3B 5J2IA 4KLUA 3OJUA 3OPXA 5E79O 4QZFA 5ALRA 3IM1A 4DFKA 2YX8A 2KVSA 3QU5A 2LYAA 5DG8A 1ZHYA 4LSEA 5KFHA 3QZ7A 3GIJA 4FFDA 1YT3A 4DOCA 8ICTA 2FLLA 2P35A 1QJPA 2I1QA 3GIIA 2WHEA 2KJ8A 5KL1B 7ICQA 1KRPA 3UM9A 4AZLA 4M9LA 3DWOX 2ZG6A 3TADA 1ZQQA 2RHFA 3DWNA 4DL7A 1Z1BA 3PW4A 3TADC 3BS5B 4N74A 5ALLA 4O3MA 1X42A 4GC7A 2H3VA 3PY8A 3QZ8A 4RLBA 4I28A 3KFUF 4AKRB 1XC9A 3OJSA 1HIWA 3V72A 1BVSA 4CCHA 4QNLA 3RJFA 4BX9C 5DL5A 5AKJA 2R88A 2F1TA 4IL6O 4R64A 4Q8FA 2RP5A 4F4KA 2V4RA 2PI5A 4XQ8A 4PR7A 4EBCA 1SXEA 4O3QA 3MGVA 3BQTA 2BQ3A 4JV1A 3H40A 3K1ZA 4ECVA 2B21A 1TKDA 2OM6A 1FFUA 1JIHA 3EYZA 3MFIA 2NRWA 4UB2A 2ZJ5A 2BCRA 3AQFA 4DQPA 4J03A 1FEZA 5EE0A 1NJYA 2F8LA 3DA4A 5B66O 5HMMA 1S0OA 3Q8MA 5KT2A 2BKEA 1QSSA 4M6WA 7ICVA 2XE5A 5G38A 1Z00B 5KFPA 1LV5A 4RPXA 3T3FA 3V8UA 1BPXA 4PJ0O 9ICMA 4UB6O 9ICBA 3H0RB 1GFPA 9ICRA 3BRYA 1L8LA 5EE9A 4U7CA 1D8LA 5AM1A 2ISOA 3MBYA 1F44A 1NKBA 3NTUA 1ZQZA 4B9UA 3AM9A 5AI5A 4F4WA 1AQ6A 7ICHA 1Z3EB 9ICAA 4DQQA 2JZBB 5KFQA 4C80A 1ZQSA 1QTMA 3WKEA 2QB0B 2ZIVB 3UU2A 3KHLA 2ZIXA 2XY7A 4B9VA 2XTQA 1ZRMA 1D8BA 4RQ1A 4C4SA 3RRHA 4F4YA 4O5EA 3AAEB 5ADXK 3JPSA 5ALJA 8ICPA 3BDPA 4KLIA 2K0LA 1AROP 2QLTA 2W3SA 4IRKA 1X9SA 5IIJA 2G08A 3ORYA 7ICFA 1L7MA 2W7PA 1X9WA 3EW9A 3QUQA 4P4MA 4OO1J 4O3SA 4P2HA 3T5HA 5L1LA 3I1YA 2XE3A 3HWBA 4QWCA 2K8CB 5D4BA 3TAQA 2PRNA 5JUMA 4KLEA 1ZD2P 4HAIA 3GV8B 1NI3A 2WFAA 3T24A 1SV4A 4M47A 5L1KA 4Y2QA 3T5LA 4P0PB 4EELA 3ISCA 2H3ZA 2QKQA 5ALVA 1KTQA 5AIAA 4RJXA 3TARA 2R8AA 3BRZA 4P4OA 2AHOB 5ALYA 1JRPA 4NLNA 4NY8A 3UMGA 1UQVA 3T20A 3HX0A 1BNPA 2C2EA 4MEXA 4UB1A 2WJQA 2L5YA 4GHBA 1Q46A 1UA1A 3F5EA 4RNNA 3AAAB 2YMLA 1NK6A 2ERVA 5J2FA 2BQRA 1KQQA 4QIWF 4FT6A 1HXTA 2FPLA 1TE2A 4DEZA 8ICXA 3UXNA 2KK0A 3AUOA 2FLPA 4F2RA 7ICTA 3UQ2A 7ICRA 4JV0A 4F71A 2WTFA 3ZDBA 5HHIA 1RQNA 1O03A 1ZQUA 2MU2A 5D49A 4B9MA 2G5IB 2XG6A 5TISU 3G7GA 2KXPB 3SAGA 5DLGA 9ICCA 2HHXA 5L1JA 5DGAA 1SGGA 3C5GA 2IOHA 7ICLA 4PL2A 5KG1A 3TFRA 7ICJA 5C5JA 9ICNA 5DB6A 2KICA 3NSGA 1XO1A 5ALSA 9ICGA 4BWMA 2LYHA 3SAHA 1X9XA 5F3XB 3CP8A 3GV5B 2MSNA 2K4TA 3ED5A 4B9TA 4DSIA 1S0NA 4KLLA 2HCFA 4EEYA 3VC8A 4MFAA 3TANA 3M1YA 2P6RA 3T5KA 1KBUA 2YMQA 9ICTA 4KLHA 1VJ5A 2ZUDA 4FBTA 3NASA 3NRWA 4GCSA 1RDFA 4GXJA 3CNHA 4C8LA 4ZOHC 3GIKA 3KHRA 4G76A 2ZIWB 3C29A 2F1HA 4X5VA 1QQ6A 1ZQJA 4PH5A 4B61A 5EE1A 4QIWC 2ZXHA 3SY7A 3BQ0A 4DSEA 1PRNA 4UBBA 2HBKA 2OMFA 3FM9A 2G06A 4DFJA 3IRUA 9ICFA 7ICKA 9ICVA 4Q43A 2W81C 2Y9TA 2W9CB 1RM6C 4GFJA 3IP4B 5AI6A 4DL6A 4IRCA 4O9MA 5AKYA 3SQIA 4G75A 3ZDCA 2W43A 3H8WA 4K4HA 1KN5A 1BXWA 3SD7A 1N2XA 5EE2A 3UQ0A 2HVIA 2ZIUA 3NVZA 3Q8QB 3MR5A 4ED3A 9ICIA 3B0YA 1PVQA 1MQ3A 5AK4A 2W54A 5KFZA 1BPDA 1GO3F 3IG5A 5EOZA 4R66A 4ED7A 5J0SA 1DK3A 2ASDA 3NRZA 4TQSA 5J2EA 2E1EA 4AKRA 9ICPA 2F3NA 4FZLA 3I76A 1ZJNA 1Z4NA 4A8EA 4R8UB 1EXNA 4KTQA 3H0LB 5KAIU 1NK8A 2A19A 4NV0A 3O0EA 2R8KA 4ACOA 3NGDA 3LK3A 1RPLA 2NRZA 1BPYA 5KAFU 4YG2A 3KZIO 3LK42 5JDPA 4PHDA 3PSPA 5KFMA 2EZXA 2GH1A 4DF4A 4J9OA 3C5OA 1T1LA 2FGQX 4M0AA 2MUTB 4YD2A 1CUKA 1KDHA 4B9LA 2Y0KA 4XUSA 3UMBA 4NLCA 4C4VA 4RQ3A 2YB4A 4FUVA 4KR8A 3WK4A 2HHSA 3EPGA 1H6S1 2W8LA 1SKSA 7ICPA 5C0YA 3LYSA 4XRHA 4I2CA 2HHVA 4Q8EA 3BS7A 2HOIA 7ICGA 2FLNA 4RQ2A 2KD1A 4D65A 3H4BA 1RZTA 1LKYB 3LVWA 3JPRA 2J6TA 5AM5A 3AA7B 1BT9A 3Q8RB 5HR7A 2KKPA 3LWMA 5ALMA 3QU7A 3PW2A 4KX3A 2JEGA 4OJ5A 5J0OA 4Y2JA 5KFLA 3PMLA 3MR3A 1KFDA 4GXIA 4DL4A 3VY9X 1MQ2A 1CRXA 4DQRA 2DKZA 1B0XA 5KFKA 4FMSA 1S76D 4CF4A 1SL0A 2HBMA 4UBCA 5TISO 5AKZA 2KEYA 1IM4A 4DFPA 4IQVA 4DLGA 2LYBA 2KHVA 5AKHA 3RB6A 8ICIA 5D5DA 1KSPA 2FMSA 2EH9A 2F44A 1JX4A 1HJPA 3L3FX 5ADXL 4RQ5A 4RJWA 4C7ZA 5B5EU 3AAEA 5G5GA 1TAUA 4AYID 2ES6A 8ICSA 4USAA 2DKXA 1ZQ1C 3QXGA 5DG7A 5KFBA 4C8OA 3SAFA 2XE1A 3C23A 4K4IA 4NLKA 8PRNA 4C8MA 4KLDA 3Q8PB 1A6SA 4OJOA 3K1RB 1WWUA 2ZUCA 5DQGA 2OCEA 4CTDA 3N7PD 1NK5A 2GE4A 3UPQA 2FI1A 4US9A 4PGXA 5ALQA 3NVVA 3ZDDA 2XC9A 5DBBA 4EENA 2ESEA 1TV9A 4Y2SA 4F5PA 4NLZA 1J2NA 4QWEA 2XTRA 5AK6A 1S5LO 3E0FA 4BJQA 4U6PA 2WF6A 2PI4A 2CXYA 9ICWA 1NJZA 2ZFGA 4EYHB 1C7YA 4DWIA 2P6UA 3WK6A 4N75A 2HHQA 2XVTA 2KSOB 1T3QA 1PZNA 5DL6A 1FFVA 1Q3VA 5ALHA 3JPOA 5AI8A 3GDXA 1DOQA 4K3BA 4RLCA 4B9SA 1TAQA 4AYEC 3OHBA 2NRXA 3V6HA 3ISBA 2EANA 2IOFK 3GQCA 1ZYQA 4YD1A 3K75D 1TFRA 4GCQA 5DQHA 2KXPA 4QZCA 1UA0A 2Y1JA 2H3QA 4YR3A 1XNSA 4O5KA 5KFWA 2CPRA 3PVXA 2KP7A 2HMXA 3C2KA 3HWTA 2YMPA 3ETLA 4I2DA 4KMOB 4DSFA 3DDHA 5KAFO 1KL9A 3WK8A 3RB0A 1XSLA 2MA1A 2N1RA 4ECSA 1ZQFA 3RF9A 4RQMA 4Z3TA 3H8MA 2MAXA 1N5XA 5J8YC 1NJXA 3T0SA 2JR5A 2JRZA 4DLEA 4AYMC 2CN1A 1ZQHA 3TAPA 3MC1A 3PR5B 1U48A 5BPCA 3GZFA 4OCZA 4DSJA 2YB1A 4YVZA 4RQ6A 2QARB 4Y2RA 4JFBA 5KFIA 4TURA 1ZHTA 2WVPA 5AI9A 3RJKA 4YR0A 2OH2A 2XMXA 3C28A 2ZUBA 1ZQRA 4F5RA 3MDCA 5DL8A 4QWDA 3JPTA 3AU2A 2BHNA 2AH5A 2CRXA 3JPQA 4UATA 2F1VA 3GU3A 2VA8A 1THQA 3PNCA 3ETRA 5DL7A 1JROA 1X40A 3WK7A 5JRTA 8ICMA 5IILA 4PPXA 2KN7A 3LDAA 1U47A 2BCUA 1HUZA 3NS1A 5AHXA 2XICA 2Y0HA 8ICYA 1PK3A 4NLBA 3PF1A 4BDPA 3UXOA 2ASJA 2K8BB 3G6VA 5H2FU 2R89A 7PRNA 4O3NA 3IN5A 3E2EA 3QNMA 8ICLA 5T5FA 1T7PA 3MGHA 1L7NA 2HDOA 4JCHA 1ZJMA 3SZDA 1L3VA 3GP6A 3LK2A 1PK1B 5KFVA 5B5EO 4YQWA 5AM2A 5CEHA 5AIBA 1NK7A 4K4GA 4DL2A 4LZGA 1ZQXA 2KC0A 4M04A 5KFAA 8ICVA 3ZDEA 3F5AA 4D64A 1IV8A 4E1TA 4UAUA 5IIMA 2Y0SF 3PW7A 3RJEA 2BZFA 8ICRA 4FE3A 1SKWA 1S97A 3HKZF 4QW8A 1ZD3A 3KTQA 3VZWX 4DOBA 3WKDA 2JEIA 3KOOA 4F3OA 5ALFA 1X9MA 5J2KA 3PX6A 3NJTA 1NK4A 3MFHA 4C0ZA 5KFEA 4ECXA 3RR8A 5KFRA 4R65A 2E8MA 4DL5A 4NM2A 4CF3A 1GFMA 2BDUA 4N59A 3IV6A 4RL9A 8ICCA 5DB7A 4NL9C 1ZQKA 4LSHA 5KNIA 1ZOLA 3VE1A 3C2MA 3ZDAA 4YN4A 3MGIA 1G90A 1LKYA 2ZTDA 4ECRA 4JV2A 2BCQA 5DQIA 3V6KA 2BQUA 2W03A 1ZD4A 2K4EA 2K8AA 2P66A 4ED1A 1S10A 2YPVA 2KZ3A 4LVSA 1OSMA 2G07A 3GILA 1NJWA 2W9BA 3N7RC 2M06A 2J6SA 3PRNA 5CA7A 4KITB 5CP2A 5KFUA 5AKGA 1Z19A 4J9PA 4AYBF 1BPBA 4I2IA 3KHGA 2R8GA 8ICGA 3D2SA 2Y0SC 3THVA 4YXJA 3VY8X 4EBEA 1NKCA 1IZNB 3HKZC 3KZIU 3QE9Y 1ZQCA 1VDVA 3RJJA 2F76X 4YXMA 9ICOA 3TZGA 3PSIA 4O5CA 5ALNA 4J9KA 1P7DA 1L5UA 2OXOA 4ECTA 1KFTA 1SB3C 2PFOA 2XE2A 4Q44A 4KLSA 2A1AA 1RYSA 2O4VA 3HP6A 1SXDA 4F4BA 2DPJA 2K4IA 4I2BA 1ZETA 3QUCA 3M9OB 7ICMA 1SZHA 3QUBA 5D46A 5DLFA 4IRDA 3AA0B 2VJ5A 1URJA 5IIOA 9ICHA 3TFSA 2DUYA 2E3TA 5KFCA 4P0QA 2R8HA 2ALZA 5T14A 1XWLA 2HHWA 3AMZA 2VA3A 4UQGA 4I2JA 1F0MA 2KOBA 3HPOA 2D8CA 1B43A 1PUZA 1NK9A 1JUDA 4BUMX 4US8A 4IQTA 4UB8O 2ASLA 4Y2PA 2IHMA 5TZVA 2W80C 1Y88A 4AYBC 2OHFA 1DRGA 2A3VA 5H2FO 3BQ1A 2YQEA 3A2SX 1N48A 3D2QA 3F2BA 4P4PA 3RR7A 4BXOA 2DWQA 3MR2A 4KLJA 2GWSA 4M9GA 2EZZA 4QZGA 1ZQGA 1QCKA 2KNJA 2NRVA 8ICFA 1X66A 4LZDA 3Q8LA 9ICQA 4J9QA 4RUAA 1M6YA 2WAQF 1WYGA 1DK2A 1JXLA 2KIVA 1RXVA 3SY9A 2QB1A 1RYUA 4UAVA 4U9CA 1XSNA 2RDJA 5DB9A 5J2AA 2BR0A 4UW9A 2E1FA 3JPPA 4PHPA 3TI0A 3V7JA 2MNHA 2PORA 2LFUA 1BPEA 3M6KA 1XU4A 1S5LU 5CHGA 2KFZA 5DB8A 1NKEA 7ICNA 2ZTEA 3PX0A 3EUB2 4G3IA 4KRAA 3K4GA 1L6NA 3J81j 2JHDA 4EYIB 2IA6A 1MPFA 1X6JA 2QARA 4QZBA 1HXXA 2VIXA 3AQEA 8ICNA 2KMDA 1E54A 1O08A 1DXSA 1TK5A 3OGUA 3NVWA 2KE7A 2DBYA 2ISPA 4O3ZA 4DO9A 1QSLA 3A0HU 4MFCA 1S0VA 3RTVA 4IQWA 1ORMA 4YFKA 3WKBA 1A0PA 1ZQIA 4UB4A 4Z6EA 3RAXA 2J1NA 3H0MB 3BS5A 4EEKA 3RJIA 1SZPA 1L3TA 3ALRA 5L9XA 3AA6B 4EX7A 5KT7A 5KG4A 5KG5A 2R4NA 4I27A 4JB3A 2ZJAA 2FPKA 5KG2A 4ED0A 2LMRA 1S0MA 1Q8KA 3N7SC 4J9MA 3AL0B 4O49A 3SYSA 2R8IA 5AKXA 2WAQC 1HXUA 2VANA 4M9HA 3M8RA 2JEFA 2GO7A 4QZIA 4B9NA 3WKCA 3UPGA 2DF4B 1VLBA 2B6GA 4LSIA 1ZQYA 2XY6A 2YMMA 5HP4A 1X6IA 2HOFA 1PK1A 4RQNA 2F8KA 5IIKA 3C2LA 4G9BA 1V97A 3N97B 1MM5A 4F2SA 4PGYA 4ELTA 1T4GA 2KIWA 3CYMA 3G6YA 5J29A 1KEJA 2I6XA 4UB5A 3RH4A 2M07A 3WKAA 1KLNA 2JGAA 4FOZA 5ALTA 4B6JA 3WK9A 3HW9A 3C21A 5KTQA 5AI4A 2HI0A 1KW4A 5J0XA 5ALOA 3UMCA 4UAWA 5AKIA 4OD0A 4F92B 4M6WB 3KZXA 8ICAA 3PSTA 4RT3A 1Z00A 3MDAA 5F9NA 4UASA 4KR4A 1RXWA 3Q8SB 3D2NA 3POQA 4QZEA 1LB2B 3SYBA 5BOMA 3EZ5A 2VA2A 7ICUA 1PVPA 8ICEA 2XCAA 5J2CA 5J2JA 2IBKA 1C20A 1SKRA 2WF9A 1ED1A 2N2LA 1TAMA 2JZBA 4Y2YA 3ICXA 5G5HA 2KKVA 2QB0A 2ZIVA 2ZIXB 2YN4A 2OEHA 3RB4A 2J4UP 4C7YA 8ICOA 3SV3A 2K4HA 4QQ1A 1YZ7A 1ZQDA 3AU6A 1L3UA 2VKQA 1X2IA 3PO4A 2ZLDA 4O3WA 2KHQA 2Q4TA 3BQ2A 2KZZA 1WCLA 5DG9A 3RH5A 2V9WA 1MA7A 5AKKA 3SZVA 4NM1A 2R4LA 2KG5A 2YTUA 4IR1A 1Q9GA 3PMNA 3EPIA 3PW5A 1ZQOA 3GV7B 2FMQA 1COOA 1A76A 4YMNA 3PW0A 4P0PA 4JK1A 1ZQPA 1RYRA 3T5JA 5GV0A 1RG6A 1QLNA 2HHUA 1A77A 2FDRA 3NUQA 4O0IA 3PV8A 1JN3A 4QJFB 3OSNA 2VJ4A 2UVRA 5AM3A 2V4QA 2G0AA 5HHHA 2H5XA 5J2HA 4NXZA 3AA0A 3FC4A 4IC9A 3SV4A 1BPZA 2PXIA 3JTYA 1V38A 4GIBA 4Z6FA 2ATLA 3AAAA 5KL8B 5JU5A 1S9FA 1P4TA 1SWVA 3QU4A 3WU2U 3VE2A 4RPZA 2EQYA 5J2DA 2JV3A 1N56A 3A0HO 3JPNA 1J2MA 4CF5A 4KMUA 4GCPA 4Y2XA 1ZD5A 9ICUA 4I29A 4Y2UA 2DL0A 4QZAA 1UHUA 3AA1B 4BUGA 3TQ1A 3DEEA 1UT8A 3KKAA 3WI4A 1WG8A 4XNLA 3KKAC 2F2AB 3ZI4A 4F5NA 1GFOA 1L7OA 1SWWA 4I2GA 5KG3A 4UAYA 2KZMA 5CJ7A 4C4RA 4RQ0A 1IG6A 5AM4A 3LVVA 1JXEA 2AXTO 3F2CA 4GC6A 1D9FA 4GXKA 2WF8A 3QUTA 5J8YA 1YS5A 8ICQA 2FE9A 4F50A 1L3SA 3IG8A 1SV0A 5J0RA 3HOEA 4F72A 5EWGA 3G6XA 1ECWA 3RJGA 1SV0C 8ICHA 4LSFA 8ICWA 3AN1A 1TK8A 1QSYA 2IWVA 5G39A 5AKLA 2HVHA 3GIMA 1BH3A 1Z4OA 4O3OA 2NO5A 8ICJA 3BZKA 1CI4A 1WWVA 4AYDC 5KFJA 2ZIWA 3T79A 1OUQA 3RB3A 1BGXT 2HHTA 1KKXA 7ICOA 3KHHA 2RDIA 2UVVA 4I2HA 5DDMA 3UAQA 2RLTA 4PZOA 2LI6A 5FP0A 4KLQA 1HEKA 2W9CA 4DSLA 2N2MA 3PGUA 1UPHA 5DKWA 3AEVA 4RNOA 3QRCA 3SENA 2C2DA 4IR9A 4UB8U 5KT3A 2BCVA 4I2EA 5L1MA 2IOFA 4J9RA 4ZH4A 4ELUA 5CR0A 4YCXA 9ICJA 3NVYA 2ZIUB 5ALPA 3RAQA 2D6FC 2AGQA 1V9PA 2AGOA 1GFNA 4PHEA 2LHFA 5KG0A 3POXA 1QQ7A 4RPYA 3F2DA 2KJ5A 4FS2A 1ZQWA 2Q0ZX 1JALA 3AA6A 2R4PA 5G3AA 3KD3A 5AM0A 4DOAA 5JTIA 2JQYA 4KLFA 4DCCA 3E58A 2R8JA 4KLMA 1XS9D 2NRTA 4R8UA 4D5UA 5AICA 1UT5A 4FRTA 3LK3B 4IQUA 5DGBA 4DFMA 7ICEA 2XO7A 5CB1A 4QW9A 3PQUA 1NZBA 2F77X 4KN7A 4DFDA 2AGPA 3FYXA 2MUTA 2HBLA 5KFNA 5KT6A 4C4VB 3PSFA 4N58A 4QZHA 4PZNA 1ZHXA 4JMUA 2KZ7B 4KLGA 2ZTCA 2XIDA 2W9MA 4NL9A 4O3RA 3DZMA 3RBEA 2ZJ8A 4DQIA 3B0XA 3PZPA 2LHTA 1L7PA 3FYHA 2PKEA 3LWLA 2JXJA 3L4PA 4AUIA 1XO0A 3V6JA 1TK0A 3QU9A 5CWRA 5K4LA 1ZQLA 2LKYA 2EAPA 2JH1A 4MEYA 5J2BA 4ECQA 3RH6A 3WU2O 5HR6A 3AA7A 2X9KA 4EBDA 5J0PA 2AJQA 1WUDA 2G5HB 2JMGA 4O4UA 4CRXA 3D6JA 4MF2A 3GFKB 3QEAZ 2W55A 1MM4A 4F5QA 4ED2A 1QJ9A 5J0QA 4DQSA 2EAMA 4F93B 1CEZA 3PR4A 1NNLA 3C5FA 4QWBA 5IYUA 3HILA 2WF5A 1ZRNA 4F8RA 2BPGA 3A0BU 4C00A 4FSPA 2PFQA 5ALEA 2Y1IA 2Y2XA 4DS5A 1N62A 4ECUA 1QJ8A 1ZQAA 1T16A 1MN8A 1OW5A 4F5OA 2M9NA 5IINA 2ODGA 9ICSA 2DGZA 3K19A 4FO6A 1QQ5A 1ZQNA 3L5KA 4NWIA 9ICXA 3BQ7A 4KLTA 2GLEA 4NJ8A 3HT3A 1K5OA 3V7KA 2H3IA 3LK9A 1Z1VA 2GOLA 4Y2TA 2BDPA 4I2FA 3QYPA 4JWMA 2BPCA 5J0WA 2I5HA 4FESA 2E8PA 4YR2A 1SIJA 5AFUK 4RUCA 2WB1F 2W7OA 1JMSA 4DF8A 2AQ0A 2A1JB 1ZQVA 2KSOA 3RFAA 4KX5A 2OYYA 4UB3A 1NOMA 4I2AA 1LVHA 3WK5A 4YP3A 2W9AA 3POUA 2Y9UA 4JUZA 2HSZA 3FDSA 2KDYA 2D3DA 3SMVA 3BS0A 3DA3A 2F1JA 5KFDA 1OPFA 2C28A 3H7IA 2K60A 3IDWA 2W8KA 1MC8A 5KFTA 1QH9A 3AA1A 2E5SA 5GTIU 3QEBZ 3H8JA 4Q45A 3PX4A 4DS4A 4CDGA 4DL3A 2EDUA 3M7DA 3OHAA 2DFLA 5KT4A 3M9MB 7ICSA 4FRXA 1Q3UA 2YY6A 3WI5A 3CW2C 3H4DA 4O3XB 4ECYA 1N60A 3ZD9A 8ICZA 2WB1C 3M9NB 4O4XA 4AYNA 2PFPA 3QRAA 4ECWA 5GTHU 3B9JA 5BOLA 1UCVA 3R9KA 1U45A 5KG6A 9ICKA 3EMNX 4MHVA 4PGQA 2XCPA 5ALDA 1HUOA 2FPMA 1OXJA 3PORA 1F5SA 1T3NA 3PQSA 4J9SA 2F1CX 2LM1A 4DSKA 2NV3A 3U26A 5KFFA 4GLXA 1DGSA 1PVRA 3ONNA 4EZ9A 2XI9A 2LBOA 4PUXA 3M8SA 3F53A 1RQLA 2J6UA 4F4XA 1MSWD 4C8NA 3OSPA 2X27X 2AQ4A 4OJPA 2OWOA 2K89A 3I28A 5ALIA 4CE6A 2IMWP 4HYKA 5KFSA 4MF8A 6PRNA 2LM4A 3QX7A 1YZ6A 5ALKA 4FZMA 2ZXIA 3BZCA 1GFQA 2FJ6A 8ICUA 1SL2A 4BWJA 1U49A 2MRLA 1FIQA 2R18A 3HOLA 1JI7A 3A0BO 2AXTU 3RBDA 5EE3A 4ECZA 3LK2B 3BJYA 3SZ2A 2F1IA 4FSOA 3IHQB 4YMMA 1U4BA 4RT2A 4RZRA 4UAZA 3MR6A 3SEIA 2DPIA 3HRDD 1B4FA 3LK41 3FAHA 1T8EA 4M2YA 1D9DA 1IIPA 3ZD8A 3KBBA 5FVNA 4E0DA 5J0UA 4QWAA 4CGZA 4TUSA 2LPEA 3SYZA 5AK5A 4PL1A 4ED8A 2W3RA 5E79U 4EZ6A 3M6ZA 4E1SA 4O3YA 5HMLA 1S77D 4LJXA 2HW3A
chains in the Genus database with same CATH topology
1GFOA 4C0ZA 1ZHWA 2KZ7A 2HBJA 2JMMA 2KICA 2Y7SA 3NSGA 1GFMA 2BDUA 4N59A 4RL9A 3LVVA 3F2CA 1Q9FA 3SAHA 4LSHA 3CP8A 2K4TA 2H3FA 1YS5A 1PHOA 3VE1A 5PRNA 3IG8A 2DQNB 1G90A 3CRXA 3HOEA 2RRDA 3VC8A 1ECWA 1KBUA 4LSFA 2Z7JA 1ZHZA 3NRWA 2Y0LA 4GCSA 1BH3A 2W03A 2K4EA 2K8AA 2YPVA 2M0NA 1OSMA 2G07A 4AYDC 4G76A 2ZIWB 4XNKA 3C29A 3N7RC 2M06A 2ZIWA 3PRNA 3T79A 4B61A 1OUQA 2KJ9A 4QIWC 2ZXHA 1Z19A 5CRXA 3SY7A 4AYBF 1PRNA 3D2SA 2HBKA 2Y0SC 2OMFA 2W04A 2G06A 3VY8X 1IZNB 2W81C 3UAQA 3HKZC 1IZNA 4GFJA 4OJLA 1HEKA 2F76X 2N2MA 3IP4B 3TZGA 1UPHA 2QTKA 3PSIA 3QRCA 3SQIA 4G75A 1P7DA 2PMZF 2HOQA 2OXOA 1BXWA 3KVDD 5EE2A 2XE2A 2ZIUB 4C69X 2O4VA 2ZIUA 4GF4A 2D6FC 1GFNA 4F4BA 2K4IA 1PVQA 2LHFA 3POXA 3F2DA 2KJ5A 1SZHA 1GO3F 3IG5A 2VJ5A 3AA0B 1URJA 3AA6A 4P0QB 3RBHA 4P0QA 2E1EA 4AKRA 4FZLA 4A8EA 3O0FA 5AFUL 1T94A 3H0LB 4D5UA 3VZUX 5T14A 4NV0A 3O0EA 4FRTA 3LK3B 4ACOA 2FGRA 3LK3A 3PQUA 3LK42 2KOBA 4AFKA 5JDPA 1NZBA 2F77X 3PSPA 2GH1A 5G26A 4BUMX 3VCBA 3C5OA 3FYXA 2FGQX 2HBLA 4OJ6A 2Y0KA 2W80C 4AYBC 3PSFA 4FZNA 4NLCA 4N58A 1DRGA 2A3VA 4AKMA 2YB4A 1ZHXA 4FUVA 4KR8A 4JMUA 2KZ7B 1H6S1 3A2SX 2KVCA 2XIDA 3D2QA 3F2BA 5C0YA 3LYSA 3PZPA 2LHTA 2HOIA 2PMZC 4AUIA 2KD1A 1XO0A 4D65A 2ODJA 2KNJA 2LKYA 2JH1A 2G09A 3LVWA 3VZTX 2MHLA 3AA7B 5HR6A 1BT9A 3AA7A 5HR7A 2KKPA 1WUDA 2WAQF 4KX3A 4OJ5A 2G5HB 2JMGA 3VY9X 4O4UA 4CRXA 2KV2A 3SY9A 1CRXA 4ICAA 4FMSA 5A0LA 2YNKA 4U9CA 2JH7A 1MM4A 2HBMA 2E1FA 4WJ3B 2KEYA 2LYBA 3OPXA 1QJ9A 2KHVA 2MNHA 2PORA 2LFUA 3M6KA 5IYUA 2YX8A 5D5DA 4KRAA 1L6NA 2LYAA 1ZHYA 4LSEA 2JHDA 4FSPA 1MPFA 1HXXA 3L3FX 5ADXL 2VIXA 3AQEA 4RJWA 1YT3A 1E54A 2Y2XA 3AAEA 4AYID 1QJPA 2KJ8A 5KL1B 1QJ8A 4O3ZA 1ZQ1C 2DGZA 3K19A 3SAFA 4NWIA 2XE1A 4AZLA 8PRNA 2ZG6A 1A6SA 4OJOA 1ORMA 1A0PA 2RHFA 1Z1BA 2H3IA 3N7PD 2GE4A 2J1NA 2GOLA 4O3MA 3H0MB 3ALRA 3AA6B 2H3VA 4RLBA 3KFUF 4AKRB 2XTRA 4FESA 1HIWA 3N7SC 3AL0B 3E0FA 4O49A 4QNLA 3SYSA 4BJQA 2WAQC 5AFUK 4U6PA 4BX9C 1HXUA 5DL5A 2WB1F 2W7OA 2ZFGA 2F1TA 3UPGA 2RP5A 2DF4B 4LSIA 2HOFA 2XVTA 3RFAA 3MGVA 4KX5A 5DL6A 2OYYA 3K1ZA 1MM5A 1Q3VA 3POUA 2KIWA 2OM6A 3CYMA 4RLCA 2KDYA 2M07A 4AYEC 2JGAA 4FOZA 3AQFA 3SMVA 3DA3A 3HW9A 4GCQA 2F8LA 1OPFA 3DA4A 2KXPA 3AA1A 3KZXA 3PSTA 2E5SA 2XE5A 2H3QA 1XNSA 2CPRA 3V8UA 2HMXA 4KR4A 4CDGA 3H0RB 4KMOB 1GFPA 3M7DA 4FRXA 3D2NA 3POQA 2MA1A 4U7CA 1Q3UA 2N1RA 3RF9A 4Z3TA 1F44A 3SYBA 1PVPA 3WI5A 3T0SA 4O3XB 4AYMC 2CN1A 1ED1A 2N2LA 2WB1C 1TAMA 2ZIVB 3GZFA 4O4XA 3UU2A 4AYNA 3ICXA 3QRAA 2KKVA 2ZIXB 2ZIVA 2YB1A 2ZIXA 2XTQA 2J4UP 1D8BA 2K4HA 4JFBA 4QQ1A 3EMNX 1ZHTA 3AAEB 2VKQA 5ADXK 3PORA 2OH2A 2XMXA 3PQSA 3C28A 2ZLDA 4O3WA 2K0LA 2KHQA 5DL8A 2NV3A 2Q4TA 1PVRA 2G08A 3ONNA 1MA7A 2XI9A 2W7PA 2CRXA 2F1VA 3GU3A 4OO1J 2LBOA 1THQA 4PUXA 3SZVA 3F53A 2XE3A 5DL7A 2X27X 4OJPA 3HWBA 2K8CB 2PRNA 2K89A 1Q9GA 3T24A 2XICA 2Y0HA 4NLBA 6PRNA 4P0PB 4P0PA 2H3ZA 2K8BB 4RJXA 5GV0A 4FZMA 2ZXIA 1GFQA 7PRNA 3NUQA 3IN5A 4QJFB 2VJ4A 5T5FA 2G0AA 3T20A 2MRLA 2R18A 3HOLA 4JCHA 3AA0A 3LK2B 3SZDA 4GHBA 4IC9A 3F5EA 3GP6A 3LK2A 3JTYA 3AAAB 4FSOA 2ERVA 3AAAA 5KL8B 2KC0A 1P4TA 4QIWF 4FT6A 1HXTA 3F5AA 4D64A 4E1TA 3VE2A 2Y0SF 3LK41 4FE3A 1IIPA 3HKZF 5FVNA 3VZWX 2XG6A 2G5IB 4GCPA 4CGZA 4PL1A 3G7GA 2KXPB 3SAGA 3AA1B 4BUGA 3DEEA 3M6ZA 3WI4A 4E1SA 4O3YA 4XNLA 4PL2A 2F2AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  3DA3 A;  2XTQ A;  4FZL A;  4G75 A;  4N59 A;  2XTR A;  4FZN A;  2XMX A;  4N58 A;  3DA4 A;  4FZM A; 
#chains in the Genus database with same CATH topology
 1ZHW A;  2KZ7 A;  3C1Z A;  4K3C A;  2HBJ A;  4XA5 A;  4Z6D A;  4AP9 A;  2E8O A;  2JMM A;  2Y7S A;  5J0Y A;  1XSP A;  2NYV A;  4EX6 A;  1ZQB A;  1N63 A;  1B22 A;  1Q9F A;  2NO4 A;  4C8K A;  3C1Y A;  3OTQ A;  4KN4 A;  7ICI A;  2H3F A;  1PHO A;  5PRN A;  2DQN B;  5DBC A;  1WCN A;  2RRD A;  3CRX A;  5AKE A;  2E8N A;  5DDY A;  3PO5 A;  9ICE A;  2XGQ A;  2R4O A;  1IXR A;  4Z6C A;  1K1S A;  9ICL A;  2Z7J A;  5ALG A;  1SL1 A;  2XGP A;  1ZHZ A;  2UVW A;  2Y0L A;  4IS7 A;  4ELV A;  3PGS A;  4J9L A;  1D8Y A;  2UVU A;  8ICK A;  4Y2V A;  2M0N A;  2W9B B;  1ZQM A;  4XNK A;  4ED6 A;  2JEJ A;  2IWW A;  1U9L A;  2K4P A;  2KJ9 A;  2WF7 A;  5CRX A;  3RJH A;  2RQ5 A;  5GTI O;  2AU0 A;  2W04 A;  4M9J A;  1NK0 A;  5ALW A;  2EZY A;  4IL6 U;  5ALX A;  3V7L A;  5EWF A;  5ALU A;  5KFO A;  4R63 A;  1IZN A;  4OJL A;  2PFN A;  1NZP A;  2QTK A;  4QZ8 A;  1ZQE A;  3JCU O;  5DBA A;  4O3P A;  4KLO A;  2PMZ F;  2HOQ A;  3S6J A;  4QZ9 A;  3KVD D;  4C69 X;  8ICB A;  4GF4 A;  4F91 B;  5J2G A;  5HNK A;  3HW8 A;  4UAR A;  1J97 A;  3H8S A;  5III A;  3Q8K A;  1K1Q A;  5GTH O;  5B66 U;  5KFG A;  2WJR A;  2KTQ A;  4F4Z A;  5L1I A;  3ISD A;  5KT5 A;  4YMO A;  1ZQT A;  4P0Q B;  3RBH A;  4TUP A;  4M9N A;  1N61 A;  1TVA A;  2BCS A;  3O0F A;  5AFU L;  1BNO A;  1T94 A;  2W11 A;  2FMP A;  1S8O A;  3VZU X;  3HJE A;  2FGR A;  4PJ0 U;  5ALZ A;  4UB6 U;  1N5W A;  4QZD A;  4FS1 A;  2A1J A;  4AFK A;  4RQ7 A;  3DV9 A;  5KFX A;  3SR6 A;  5G26 A;  2IHN A;  3VCB A;  4RQ8 A;  3N28 A;  1KFS A;  4TUQ A;  2KFN A;  4OJ6 A;  5AK3 A;  4FZN A;  4NLG A;  3PGR A;  2BGW A;  4J9N A;  5AI0 A;  4AKM A;  3MAB A;  3TAC B;  5KG7 A;  2KVC A;  5J0T A;  4BXO B;  2O6K A;  5F9L A;  4RU9 A;  4PHA A;  5KFY A;  4FBU A;  3UXP A;  2B0C A;  3N4M B;  1V85 A;  2PMZ C;  3QU2 A;  4FQE A;  2XY5 A;  2ODJ A;  3EWA A;  4C4T A;  3SI8 A;  4JWN A;  4RQ4 A;  2G09 A;  3VZT X;  3TKA A;  1FO4 A;  2MHL A;  4CNQ A;  1ZXI A;  5KAI O;  2I9G A;  4RNM A;  2C22 A;  4TQR A;  1L8O A;  1COK A;  2KV2 A;  4BGD A;  4MFF A;  3RRG A;  2BPF A;  4ICA A;  5A0L A;  2YNK A;  2JH7 A;  1H38 A;  5EWE A;  2EAO A;  2C2R A;  1DGJ A;  4WJ3 B;  5J2I A;  4KLU A;  3OJU A;  3OPX A;  5E79 O;  4QZF A;  5ALR A;  3IM1 A;  4DFK A;  2YX8 A;  2KVS A;  3QU5 A;  2LYA A;  5DG8 A;  1ZHY A;  4LSE A;  5KFH A;  3QZ7 A;  3GIJ A;  4FFD A;  1YT3 A;  4DOC A;  8ICT A;  2FLL A;  2P35 A;  1QJP A;  2I1Q A;  3GII A;  2WHE A;  2KJ8 A;  5KL1 B;  7ICQ A;  1KRP A;  3UM9 A;  4AZL A;  4M9L A;  3DWO X;  2ZG6 A;  3TAD A;  1ZQQ A;  2RHF A;  3DWN A;  4DL7 A;  1Z1B A;  3PW4 A;  3TAD C;  3BS5 B;  4N74 A;  5ALL A;  4O3M A;  1X42 A;  4GC7 A;  2H3V A;  3PY8 A;  3QZ8 A;  4RLB A;  4I28 A;  3KFU F;  4AKR B;  1XC9 A;  3OJS A;  1HIW A;  3V72 A;  1BVS A;  4CCH A;  4QNL A;  3RJF A;  4BX9 C;  5DL5 A;  5AKJ A;  2R88 A;  2F1T A;  4IL6 O;  4R64 A;  4Q8F A;  2RP5 A;  4F4K A;  2V4R A;  2PI5 A;  4XQ8 A;  4PR7 A;  4EBC A;  1SXE A;  4O3Q A;  3MGV A;  3BQT A;  2BQ3 A;  4JV1 A;  3H40 A;  3K1Z A;  4ECV A;  2B21 A;  1TKD A;  2OM6 A;  1FFU A;  1JIH A;  3EYZ A;  3MFI A;  2NRW A;  4UB2 A;  2ZJ5 A;  2BCR A;  3AQF A;  4DQP A;  4J03 A;  1FEZ A;  5EE0 A;  1NJY A;  2F8L A;  3DA4 A;  5B66 O;  5HMM A;  1S0O A;  3Q8M A;  5KT2 A;  2BKE A;  1QSS A;  4M6W A;  7ICV A;  2XE5 A;  5G38 A;  1Z00 B;  5KFP A;  1LV5 A;  4RPX A;  3T3F A;  3V8U A;  1BPX A;  4PJ0 O;  9ICM A;  4UB6 O;  9ICB A;  3H0R B;  1GFP A;  9ICR A;  3BRY A;  1L8L A;  5EE9 A;  4U7C A;  1D8L A;  5AM1 A;  2ISO A;  3MBY A;  1F44 A;  1NKB A;  3NTU A;  1ZQZ A;  4B9U A;  3AM9 A;  5AI5 A;  4F4W A;  1AQ6 A;  7ICH A;  1Z3E B;  9ICA A;  4DQQ A;  2JZB B;  5KFQ A;  4C80 A;  1ZQS A;  1QTM A;  3WKE A;  2QB0 B;  2ZIV B;  3UU2 A;  3KHL A;  2ZIX A;  2XY7 A;  4B9V A;  2XTQ A;  1ZRM A;  1D8B A;  4RQ1 A;  4C4S A;  3RRH A;  4F4Y A;  4O5E A;  3AAE B;  5ADX K;  3JPS A;  5ALJ A;  8ICP A;  3BDP A;  4KLI A;  2K0L A;  1ARO P;  2QLT A;  2W3S A;  4IRK A;  1X9S A;  5IIJ A;  2G08 A;  3ORY A;  7ICF A;  1L7M A;  2W7P A;  1X9W A;  3EW9 A;  3QUQ A;  4P4M A;  4OO1 J;  4O3S A;  4P2H A;  3T5H A;  5L1L A;  3I1Y A;  2XE3 A;  3HWB A;  4QWC A;  2K8C B;  5D4B A;  3TAQ A;  2PRN A;  5JUM A;  4KLE A;  1ZD2 P;  4HAI A;  3GV8 B;  1NI3 A;  2WFA A;  3T24 A;  1SV4 A;  4M47 A;  5L1K A;  4Y2Q A;  3T5L A;  4P0P B;  4EEL A;  3ISC A;  2H3Z A;  2QKQ A;  5ALV A;  1KTQ A;  5AIA A;  4RJX A;  3TAR A;  2R8A A;  3BRZ A;  4P4O A;  2AHO B;  5ALY A;  1JRP A;  4NLN A;  4NY8 A;  3UMG A;  1UQV A;  3T20 A;  3HX0 A;  1BNP A;  2C2E A;  4MEX A;  4UB1 A;  2WJQ A;  2L5Y A;  4GHB A;  1Q46 A;  1UA1 A;  3F5E A;  4RNN A;  3AAA B;  2YML A;  1NK6 A;  2ERV A;  5J2F A;  2BQR A;  1KQQ A;  4QIW F;  4FT6 A;  1HXT A;  2FPL A;  1TE2 A;  4DEZ A;  8ICX A;  3UXN A;  2KK0 A;  3AUO A;  2FLP A;  4F2R A;  7ICT A;  3UQ2 A;  7ICR A;  4JV0 A;  4F71 A;  2WTF A;  3ZDB A;  5HHI A;  1RQN A;  1O03 A;  1ZQU A;  2MU2 A;  5D49 A;  4B9M A;  2G5I B;  2XG6 A;  5TIS U;  3G7G A;  2KXP B;  3SAG A;  5DLG A;  9ICC A;  2HHX A;  5L1J A;  5DGA A;  1SGG A;  3C5G A;  2IOH A;  7ICL A;  4PL2 A;  5KG1 A;  3TFR A;  7ICJ A;  5C5J A;  9ICN A;  5DB6 A;  2KIC A;  3NSG A;  1XO1 A;  5ALS A;  9ICG A;  4BWM A;  2LYH A;  3SAH A;  1X9X A;  5F3X B;  3CP8 A;  3GV5 B;  2MSN A;  2K4T A;  3ED5 A;  4B9T A;  4DSI A;  1S0N A;  4KLL A;  2HCF A;  4EEY A;  3VC8 A;  4MFA A;  3TAN A;  3M1Y A;  2P6R A;  3T5K A;  1KBU A;  2YMQ A;  9ICT A;  4KLH A;  1VJ5 A;  2ZUD A;  4FBT A;  3NAS A;  3NRW A;  4GCS A;  1RDF A;  4GXJ A;  3CNH A;  4C8L A;  4ZOH C;  3GIK A;  3KHR A;  4G76 A;  2ZIW B;  3C29 A;  2F1H A;  4X5V A;  1QQ6 A;  1ZQJ A;  4PH5 A;  4B61 A;  5EE1 A;  4QIW C;  2ZXH A;  3SY7 A;  3BQ0 A;  4DSE A;  1PRN A;  4UBB A;  2HBK A;  2OMF A;  3FM9 A;  2G06 A;  4DFJ A;  3IRU A;  9ICF A;  7ICK A;  9ICV A;  4Q43 A;  2W81 C;  2Y9T A;  2W9C B;  1RM6 C;  4GFJ A;  3IP4 B;  5AI6 A;  4DL6 A;  4IRC A;  4O9M A;  5AKY A;  3SQI A;  4G75 A;  3ZDC A;  2W43 A;  3H8W A;  4K4H A;  1KN5 A;  1BXW A;  3SD7 A;  1N2X A;  5EE2 A;  3UQ0 A;  2HVI A;  2ZIU A;  3NVZ A;  3Q8Q B;  3MR5 A;  4ED3 A;  9ICI A;  3B0Y A;  1PVQ A;  1MQ3 A;  5AK4 A;  2W54 A;  5KFZ A;  1BPD A;  1GO3 F;  3IG5 A;  5EOZ A;  4R66 A;  4ED7 A;  5J0S A;  1DK3 A;  2ASD A;  3NRZ A;  4TQS A;  5J2E A;  2E1E A;  4AKR A;  9ICP A;  2F3N A;  4FZL A;  3I76 A;  1ZJN A;  1Z4N A;  4A8E A;  4R8U B;  1EXN A;  4KTQ A;  3H0L B;  5KAI U;  1NK8 A;  2A19 A;  4NV0 A;  3O0E A;  2R8K A;  4ACO A;  3NGD A;  3LK3 A;  1RPL A;  2NRZ A;  1BPY A;  5KAF U;  4YG2 A;  3KZI O;  3LK4 2;  5JDP A;  4PHD A;  3PSP A;  5KFM A;  2EZX A;  2GH1 A;  4DF4 A;  4J9O A;  3C5O A;  1T1L A;  2FGQ X;  4M0A A;  2MUT B;  4YD2 A;  1CUK A;  1KDH A;  4B9L A;  2Y0K A;  4XUS A;  3UMB A;  4NLC A;  4C4V A;  4RQ3 A;  2YB4 A;  4FUV A;  4KR8 A;  3WK4 A;  2HHS A;  3EPG A;  1H6S 1;  2W8L A;  1SKS A;  7ICP A;  5C0Y A;  3LYS A;  4XRH A;  4I2C A;  2HHV A;  4Q8E A;  3BS7 A;  2HOI A;  7ICG A;  2FLN A;  4RQ2 A;  2KD1 A;  4D65 A;  3H4B A;  1RZT A;  1LKY B;  3LVW A;  3JPR A;  2J6T A;  5AM5 A;  3AA7 B;  1BT9 A;  3Q8R B;  5HR7 A;  2KKP A;  3LWM A;  5ALM A;  3QU7 A;  3PW2 A;  4KX3 A;  2JEG A;  4OJ5 A;  5J0O A;  4Y2J A;  5KFL A;  3PML A;  3MR3 A;  1KFD A;  4GXI A;  4DL4 A;  3VY9 X;  1MQ2 A;  1CRX A;  4DQR A;  2DKZ A;  1B0X A;  5KFK A;  4FMS A;  1S76 D;  4CF4 A;  1SL0 A;  2HBM A;  4UBC A;  5TIS O;  5AKZ A;  2KEY A;  1IM4 A;  4DFP A;  4IQV A;  4DLG A;  2LYB A;  2KHV A;  5AKH A;  3RB6 A;  8ICI A;  5D5D A;  1KSP A;  2FMS A;  2EH9 A;  2F44 A;  1JX4 A;  1HJP A;  3L3F X;  5ADX L;  4RQ5 A;  4RJW A;  4C7Z A;  5B5E U;  3AAE A;  5G5G A;  1TAU A;  4AYI D;  2ES6 A;  8ICS A;  4USA A;  2DKX A;  1ZQ1 C;  3QXG A;  5DG7 A;  5KFB A;  4C8O A;  3SAF A;  2XE1 A;  3C23 A;  4K4I A;  4NLK A;  8PRN A;  4C8M A;  4KLD A;  3Q8P B;  1A6S A;  4OJO A;  3K1R B;  1WWU A;  2ZUC A;  5DQG A;  2OCE A;  4CTD A;  3N7P D;  1NK5 A;  2GE4 A;  3UPQ A;  2FI1 A;  4US9 A;  4PGX A;  5ALQ A;  3NVV A;  3ZDD A;  2XC9 A;  5DBB A;  4EEN A;  2ESE A;  1TV9 A;  4Y2S A;  4F5P A;  4NLZ A;  1J2N A;  4QWE A;  2XTR A;  5AK6 A;  1S5L O;  3E0F A;  4BJQ A;  4U6P A;  2WF6 A;  2PI4 A;  2CXY A;  9ICW A;  1NJZ A;  2ZFG A;  4EYH B;  1C7Y A;  4DWI A;  2P6U A;  3WK6 A;  4N75 A;  2HHQ A;  2XVT A;  2KSO B;  1T3Q A;  1PZN A;  5DL6 A;  1FFV A;  1Q3V A;  5ALH A;  3JPO A;  5AI8 A;  3GDX A;  1DOQ A;  4K3B A;  4RLC A;  4B9S A;  1TAQ A;  4AYE C;  3OHB A;  2NRX A;  3V6H A;  3ISB A;  2EAN A;  2IOF K;  3GQC A;  1ZYQ A;  4YD1 A;  3K75 D;  1TFR A;  4GCQ A;  5DQH A;  2KXP A;  4QZC A;  1UA0 A;  2Y1J A;  2H3Q A;  4YR3 A;  1XNS A;  4O5K A;  5KFW A;  2CPR A;  3PVX A;  2KP7 A;  2HMX A;  3C2K A;  3HWT A;  2YMP A;  3ETL A;  4I2D A;  4KMO B;  4DSF A;  3DDH A;  5KAF O;  1KL9 A;  3WK8 A;  3RB0 A;  1XSL A;  2MA1 A;  2N1R A;  4ECS A;  1ZQF A;  3RF9 A;  4RQM A;  4Z3T A;  3H8M A;  2MAX A;  1N5X A;  5J8Y C;  1NJX A;  3T0S A;  2JR5 A;  2JRZ A;  4DLE A;  4AYM C;  2CN1 A;  1ZQH A;  3TAP A;  3MC1 A;  3PR5 B;  1U48 A;  5BPC A;  3GZF A;  4OCZ A;  4DSJ A;  2YB1 A;  4YVZ A;  4RQ6 A;  2QAR B;  4Y2R A;  4JFB A;  5KFI A;  4TUR A;  1ZHT A;  2WVP A;  5AI9 A;  3RJK A;  4YR0 A;  2OH2 A;  2XMX A;  3C28 A;  2ZUB A;  1ZQR A;  4F5R A;  3MDC A;  5DL8 A;  4QWD A;  3JPT A;  3AU2 A;  2BHN A;  2AH5 A;  2CRX A;  3JPQ A;  4UAT A;  2F1V A;  3GU3 A;  2VA8 A;  1THQ A;  3PNC A;  3ETR A;  5DL7 A;  1JRO A;  1X40 A;  3WK7 A;  5JRT A;  8ICM A;  5IIL A;  4PPX A;  2KN7 A;  3LDA A;  1U47 A;  2BCU A;  1HUZ A;  3NS1 A;  5AHX A;  2XIC A;  2Y0H A;  8ICY A;  1PK3 A;  4NLB A;  3PF1 A;  4BDP A;  3UXO A;  2ASJ A;  2K8B B;  3G6V A;  5H2F U;  2R89 A;  7PRN A;  4O3N A;  3IN5 A;  3E2E A;  3QNM A;  8ICL A;  5T5F A;  1T7P A;  3MGH A;  1L7N A;  2HDO A;  4JCH A;  1ZJM A;  3SZD A;  1L3V A;  3GP6 A;  3LK2 A;  1PK1 B;  5KFV A;  5B5E O;  4YQW A;  5AM2 A;  5CEH A;  5AIB A;  1NK7 A;  4K4G A;  4DL2 A;  4LZG A;  1ZQX A;  2KC0 A;  4M04 A;  5KFA A;  8ICV A;  3ZDE A;  3F5A A;  4D64 A;  1IV8 A;  4E1T A;  4UAU A;  5IIM A;  2Y0S F;  3PW7 A;  3RJE A;  2BZF A;  8ICR A;  4FE3 A;  1SKW A;  1S97 A;  3HKZ F;  4QW8 A;  1ZD3 A;  3KTQ A;  3VZW X;  4DOB A;  3WKD A;  2JEI A;  3KOO A;  4F3O A;  5ALF A;  1X9M A;  5J2K A;  3PX6 A;  3NJT A;  1NK4 A;  3MFH A;  4C0Z A;  5KFE A;  4ECX A;  3RR8 A;  5KFR A;  4R65 A;  2E8M A;  4DL5 A;  4NM2 A;  4CF3 A;  1GFM A;  2BDU A;  4N59 A;  3IV6 A;  4RL9 A;  8ICC A;  5DB7 A;  4NL9 C;  1ZQK A;  4LSH A;  5KNI A;  1ZOL A;  3VE1 A;  3C2M A;  3ZDA A;  4YN4 A;  3MGI A;  1G90 A;  1LKY A;  2ZTD A;  4ECR A;  4JV2 A;  2BCQ A;  5DQI A;  3V6K A;  2BQU A;  2W03 A;  1ZD4 A;  2K4E A;  2K8A A;  2P66 A;  4ED1 A;  1S10 A;  2YPV A;  2KZ3 A;  4LVS A;  1OSM A;  2G07 A;  3GIL A;  1NJW A;  2W9B A;  3N7R C;  2M06 A;  2J6S A;  3PRN A;  5CA7 A;  4KIT B;  5CP2 A;  5KFU A;  5AKG A;  1Z19 A;  4J9P A;  4AYB F;  1BPB A;  4I2I A;  3KHG A;  2R8G A;  8ICG A;  3D2S A;  2Y0S C;  3THV A;  4YXJ A;  3VY8 X;  4EBE A;  1NKC A;  1IZN B;  3HKZ C;  3KZI U;  3QE9 Y;  1ZQC A;  1VDV A;  3RJJ A;  2F76 X;  4YXM A;  9ICO A;  3TZG A;  3PSI A;  4O5C A;  5ALN A;  4J9K A;  1P7D A;  1L5U A;  2OXO A;  4ECT A;  1KFT A;  1SB3 C;  2PFO A;  2XE2 A;  4Q44 A;  4KLS A;  2A1A A;  1RYS A;  2O4V A;  3HP6 A;  1SXD A;  4F4B A;  2DPJ A;  2K4I A;  4I2B A;  1ZET A;  3QUC A;  3M9O B;  7ICM A;  1SZH A;  3QUB A;  5D46 A;  5DLF A;  4IRD A;  3AA0 B;  2VJ5 A;  1URJ A;  5IIO A;  9ICH A;  3TFS A;  2DUY A;  2E3T A;  5KFC A;  4P0Q A;  2R8H A;  2ALZ A;  5T14 A;  1XWL A;  2HHW A;  3AMZ A;  2VA3 A;  4UQG A;  4I2J A;  1F0M A;  2KOB A;  3HPO A;  2D8C A;  1B43 A;  1PUZ A;  1NK9 A;  1JUD A;  4BUM X;  4US8 A;  4IQT A;  4UB8 O;  2ASL A;  4Y2P A;  2IHM A;  5TZV A;  2W80 C;  1Y88 A;  4AYB C;  2OHF A;  1DRG A;  2A3V A;  5H2F O;  3BQ1 A;  2YQE A;  3A2S X;  1N48 A;  3D2Q A;  3F2B A;  4P4P A;  3RR7 A;  4BXO A;  2DWQ A;  3MR2 A;  4KLJ A;  2GWS A;  4M9G A;  2EZZ A;  4QZG A;  1ZQG A;  1QCK A;  2KNJ A;  2NRV A;  8ICF A;  1X66 A;  4LZD A;  3Q8L A;  9ICQ A;  4J9Q A;  4RUA A;  1M6Y A;  2WAQ F;  1WYG A;  1DK2 A;  1JXL A;  2KIV A;  1RXV A;  3SY9 A;  2QB1 A;  1RYU A;  4UAV A;  4U9C A;  1XSN A;  2RDJ A;  5DB9 A;  5J2A A;  2BR0 A;  4UW9 A;  2E1F A;  3JPP A;  4PHP A;  3TI0 A;  3V7J A;  2MNH A;  2POR A;  2LFU A;  1BPE A;  3M6K A;  1XU4 A;  1S5L U;  5CHG A;  2KFZ A;  5DB8 A;  1NKE A;  7ICN A;  2ZTE A;  3PX0 A;  3EUB 2;  4G3I A;  4KRA A;  3K4G A;  1L6N A;  3J81 j;  2JHD A;  4EYI B;  2IA6 A;  1MPF A;  1X6J A;  2QAR A;  4QZB A;  1HXX A;  2VIX A;  3AQE A;  8ICN A;  2KMD A;  1E54 A;  1O08 A;  1DXS A;  1TK5 A;  3OGU A;  3NVW A;  2KE7 A;  2DBY A;  2ISP A;  4O3Z A;  4DO9 A;  1QSL A;  3A0H U;  4MFC A;  1S0V A;  3RTV A;  4IQW A;  1ORM A;  4YFK A;  3WKB A;  1A0P A;  1ZQI A;  4UB4 A;  4Z6E A;  3RAX A;  2J1N A;  3H0M B;  3BS5 A;  4EEK A;  3RJI A;  1SZP A;  1L3T A;  3ALR A;  5L9X A;  3AA6 B;  4EX7 A;  5KT7 A;  5KG4 A;  5KG5 A;  2R4N A;  4I27 A;  4JB3 A;  2ZJA A;  2FPK A;  5KG2 A;  4ED0 A;  2LMR A;  1S0M A;  1Q8K A;  3N7S C;  4J9M A;  3AL0 B;  4O49 A;  3SYS A;  2R8I A;  5AKX A;  2WAQ C;  1HXU A;  2VAN A;  4M9H A;  3M8R A;  2JEF A;  2GO7 A;  4QZI A;  4B9N A;  3WKC A;  3UPG A;  2DF4 B;  1VLB A;  2B6G A;  4LSI A;  1ZQY A;  2XY6 A;  2YMM A;  5HP4 A;  1X6I A;  2HOF A;  1PK1 A;  4RQN A;  2F8K A;  5IIK A;  3C2L A;  4G9B A;  1V97 A;  3N97 B;  1MM5 A;  4F2S A;  4PGY A;  4ELT A;  1T4G A;  2KIW A;  3CYM A;  3G6Y A;  5J29 A;  1KEJ A;  2I6X A;  4UB5 A;  3RH4 A;  2M07 A;  3WKA A;  1KLN A;  2JGA A;  4FOZ A;  5ALT A;  4B6J A;  3WK9 A;  3HW9 A;  3C21 A;  5KTQ A;  5AI4 A;  2HI0 A;  1KW4 A;  5J0X A;  5ALO A;  3UMC A;  4UAW A;  5AKI A;  4OD0 A;  4F92 B;  4M6W B;  3KZX A;  8ICA A;  3PST A;  4RT3 A;  1Z00 A;  3MDA A;  5F9N A;  4UAS A;  4KR4 A;  1RXW A;  3Q8S B;  3D2N A;  3POQ A;  4QZE A;  1LB2 B;  3SYB A;  5BOM A;  3EZ5 A;  2VA2 A;  7ICU A;  1PVP A;  8ICE A;  2XCA A;  5J2C A;  5J2J A;  2IBK A;  1C20 A;  1SKR A;  2WF9 A;  1ED1 A;  2N2L A;  1TAM A;  2JZB A;  4Y2Y A;  3ICX A;  5G5H A;  2KKV A;  2QB0 A;  2ZIV A;  2ZIX B;  2YN4 A;  2OEH A;  3RB4 A;  2J4U P;  4C7Y A;  8ICO A;  3SV3 A;  2K4H A;  4QQ1 A;  1YZ7 A;  1ZQD A;  3AU6 A;  1L3U A;  2VKQ A;  1X2I A;  3PO4 A;  2ZLD A;  4O3W A;  2KHQ A;  2Q4T A;  3BQ2 A;  2KZZ A;  1WCL A;  5DG9 A;  3RH5 A;  2V9W A;  1MA7 A;  5AKK A;  3SZV A;  4NM1 A;  2R4L A;  2KG5 A;  2YTU A;  4IR1 A;  1Q9G A;  3PMN A;  3EPI A;  3PW5 A;  1ZQO A;  3GV7 B;  2FMQ A;  1COO A;  1A76 A;  4YMN A;  3PW0 A;  4P0P A;  4JK1 A;  1ZQP A;  1RYR A;  3T5J A;  5GV0 A;  1RG6 A;  1QLN A;  2HHU A;  1A77 A;  2FDR A;  3NUQ A;  4O0I A;  3PV8 A;  1JN3 A;  4QJF B;  3OSN A;  2VJ4 A;  2UVR A;  5AM3 A;  2V4Q A;  2G0A A;  5HHH A;  2H5X A;  5J2H A;  4NXZ A;  3AA0 A;  3FC4 A;  4IC9 A;  3SV4 A;  1BPZ A;  2PXI A;  3JTY A;  1V38 A;  4GIB A;  4Z6F A;  2ATL A;  3AAA A;  5KL8 B;  5JU5 A;  1S9F A;  1P4T A;  1SWV A;  3QU4 A;  3WU2 U;  3VE2 A;  4RPZ A;  2EQY A;  5J2D A;  2JV3 A;  1N56 A;  3A0H O;  3JPN A;  1J2M A;  4CF5 A;  4KMU A;  4GCP A;  4Y2X A;  1ZD5 A;  9ICU A;  4I29 A;  4Y2U A;  2DL0 A;  4QZA A;  1UHU A;  3AA1 B;  4BUG A;  3TQ1 A;  3DEE A;  1UT8 A;  3KKA A;  3WI4 A;  1WG8 A;  4XNL A;  3KKA C;  2F2A B;  3ZI4 A;  4F5N A;  1GFO A;  1L7O A;  1SWW A;  4I2G A;  5KG3 A;  4UAY A;  2KZM A;  5CJ7 A;  4C4R A;  4RQ0 A;  1IG6 A;  5AM4 A;  3LVV A;  1JXE A;  2AXT O;  3F2C A;  4GC6 A;  1D9F A;  4GXK A;  2WF8 A;  3QUT A;  5J8Y A;  1YS5 A;  8ICQ A;  2FE9 A;  4F50 A;  1L3S A;  3IG8 A;  1SV0 A;  5J0R A;  3HOE A;  4F72 A;  5EWG A;  3G6X A;  1ECW A;  3RJG A;  1SV0 C;  8ICH A;  4LSF A;  8ICW A;  3AN1 A;  1TK8 A;  1QSY A;  2IWV A;  5G39 A;  5AKL A;  2HVH A;  3GIM A;  1BH3 A;  1Z4O A;  4O3O A;  2NO5 A;  8ICJ A;  3BZK A;  1CI4 A;  1WWV A;  4AYD C;  5KFJ A;  2ZIW A;  3T79 A;  1OUQ A;  3RB3 A;  1BGX T;  2HHT A;  1KKX A;  7ICO A;  3KHH A;  2RDI A;  2UVV A;  4I2H A;  5DDM A;  3UAQ A;  2RLT A;  4PZO A;  2LI6 A;  5FP0 A;  4KLQ A;  1HEK A;  2W9C A;  4DSL A;  2N2M A;  3PGU A;  1UPH A;  5DKW A;  3AEV A;  4RNO A;  3QRC A;  3SEN A;  2C2D A;  4IR9 A;  4UB8 U;  5KT3 A;  2BCV A;  4I2E A;  5L1M A;  2IOF A;  4J9R A;  4ZH4 A;  4ELU A;  5CR0 A;  4YCX A;  9ICJ A;  3NVY A;  2ZIU B;  5ALP A;  3RAQ A;  2D6F C;  2AGQ A;  1V9P A;  2AGO A;  1GFN A;  4PHE A;  2LHF A;  5KG0 A;  3POX A;  1QQ7 A;  4RPY A;  3F2D A;  2KJ5 A;  4FS2 A;  1ZQW A;  2Q0Z X;  1JAL A;  3AA6 A;  2R4P A;  5G3A A;  3KD3 A;  5AM0 A;  4DOA A;  5JTI A;  2JQY A;  4KLF A;  4DCC A;  3E58 A;  2R8J A;  4KLM A;  1XS9 D;  2NRT A;  4R8U A;  4D5U A;  5AIC A;  1UT5 A;  4FRT A;  3LK3 B;  4IQU A;  5DGB A;  4DFM A;  7ICE A;  2XO7 A;  5CB1 A;  4QW9 A;  3PQU A;  1NZB A;  2F77 X;  4KN7 A;  4DFD A;  2AGP A;  3FYX A;  2MUT A;  2HBL A;  5KFN A;  5KT6 A;  4C4V B;  3PSF A;  4N58 A;  4QZH A;  4PZN A;  1ZHX A;  4JMU A;  2KZ7 B;  4KLG A;  2ZTC A;  2XID A;  2W9M A;  4NL9 A;  4O3R A;  3DZM A;  3RBE A;  2ZJ8 A;  4DQI A;  3B0X A;  3PZP A;  2LHT A;  1L7P A;  3FYH A;  2PKE A;  3LWL A;  2JXJ A;  3L4P A;  4AUI A;  1XO0 A;  3V6J A;  1TK0 A;  3QU9 A;  5CWR A;  5K4L A;  1ZQL A;  2LKY A;  2EAP A;  2JH1 A;  4MEY A;  5J2B A;  4ECQ A;  3RH6 A;  3WU2 O;  5HR6 A;  3AA7 A;  2X9K A;  4EBD A;  5J0P A;  2AJQ A;  1WUD A;  2G5H B;  2JMG A;  4O4U A;  4CRX A;  3D6J A;  4MF2 A;  3GFK B;  3QEA Z;  2W55 A;  1MM4 A;  4F5Q A;  4ED2 A;  1QJ9 A;  5J0Q A;  4DQS A;  2EAM A;  4F93 B;  1CEZ A;  3PR4 A;  1NNL A;  3C5F A;  4QWB A;  5IYU A;  3HIL A;  2WF5 A;  1ZRN A;  4F8R A;  2BPG A;  3A0B U;  4C00 A;  4FSP A;  2PFQ A;  5ALE A;  2Y1I A;  2Y2X A;  4DS5 A;  1N62 A;  4ECU A;  1QJ8 A;  1ZQA A;  1T16 A;  1MN8 A;  1OW5 A;  4F5O A;  2M9N A;  5IIN A;  2ODG A;  9ICS A;  2DGZ A;  3K19 A;  4FO6 A;  1QQ5 A;  1ZQN A;  3L5K A;  4NWI A;  9ICX A;  3BQ7 A;  4KLT A;  2GLE A;  4NJ8 A;  3HT3 A;  1K5O A;  3V7K A;  2H3I A;  3LK9 A;  1Z1V A;  2GOL A;  4Y2T A;  2BDP A;  4I2F A;  3QYP A;  4JWM A;  2BPC A;  5J0W A;  2I5H A;  4FES A;  2E8P A;  4YR2 A;  1SIJ A;  5AFU K;  4RUC A;  2WB1 F;  2W7O A;  1JMS A;  4DF8 A;  2AQ0 A;  2A1J B;  1ZQV A;  2KSO A;  3RFA A;  4KX5 A;  2OYY A;  4UB3 A;  1NOM A;  4I2A A;  1LVH A;  3WK5 A;  4YP3 A;  2W9A A;  3POU A;  2Y9U A;  4JUZ A;  2HSZ A;  3FDS A;  2KDY A;  2D3D A;  3SMV A;  3BS0 A;  3DA3 A;  2F1J A;  5KFD A;  1OPF A;  2C28 A;  3H7I A;  2K60 A;  3IDW A;  2W8K A;  1MC8 A;  5KFT A;  1QH9 A;  3AA1 A;  2E5S A;  5GTI U;  3QEB Z;  3H8J A;  4Q45 A;  3PX4 A;  4DS4 A;  4CDG A;  4DL3 A;  2EDU A;  3M7D A;  3OHA A;  2DFL A;  5KT4 A;  3M9M B;  7ICS A;  4FRX A;  1Q3U A;  2YY6 A;  3WI5 A;  3CW2 C;  3H4D A;  4O3X B;  4ECY A;  1N60 A;  3ZD9 A;  8ICZ A;  2WB1 C;  3M9N B;  4O4X A;  4AYN A;  2PFP A;  3QRA A;  4ECW A;  5GTH U;  3B9J A;  5BOL A;  1UCV A;  3R9K A;  1U45 A;  5KG6 A;  9ICK A;  3EMN X;  4MHV A;  4PGQ A;  2XCP A;  5ALD A;  1HUO A;  2FPM A;  1OXJ A;  3POR A;  1F5S A;  1T3N A;  3PQS A;  4J9S A;  2F1C X;  2LM1 A;  4DSK A;  2NV3 A;  3U26 A;  5KFF A;  4GLX A;  1DGS A;  1PVR A;  3ONN A;  4EZ9 A;  2XI9 A;  2LBO A;  4PUX A;  3M8S A;  3F53 A;  1RQL A;  2J6U A;  4F4X A;  1MSW D;  4C8N A;  3OSP A;  2X27 X;  2AQ4 A;  4OJP A;  2OWO A;  2K89 A;  3I28 A;  5ALI A;  4CE6 A;  2IMW P;  4HYK A;  5KFS A;  4MF8 A;  6PRN A;  2LM4 A;  3QX7 A;  1YZ6 A;  5ALK A;  4FZM A;  2ZXI A;  3BZC A;  1GFQ A;  2FJ6 A;  8ICU A;  1SL2 A;  4BWJ A;  1U49 A;  2MRL A;  1FIQ A;  2R18 A;  3HOL A;  1JI7 A;  3A0B O;  2AXT U;  3RBD A;  5EE3 A;  4ECZ A;  3LK2 B;  3BJY A;  3SZ2 A;  2F1I A;  4FSO A;  3IHQ B;  4YMM A;  1U4B A;  4RT2 A;  4RZR A;  4UAZ A;  3MR6 A;  3SEI A;  2DPI A;  3HRD D;  1B4F A;  3LK4 1;  3FAH A;  1T8E A;  4M2Y A;  1D9D A;  1IIP A;  3ZD8 A;  3KBB A;  5FVN A;  4E0D A;  5J0U A;  4QWA A;  4CGZ A;  4TUS A;  2LPE A;  3SYZ A;  5AK5 A;  4PL1 A;  4ED8 A;  2W3R A;  5E79 U;  4EZ6 A;  3M6Z A;  4E1S A;  4O3Y A;  5HML A;  1S77 D;  4LJX A;  2HW3 A; 
#chains in the Genus database with same CATH homology
 1GFO A;  4C0Z A;  1ZHW A;  2KZ7 A;  2HBJ A;  2JMM A;  2KIC A;  2Y7S A;  3NSG A;  1GFM A;  2BDU A;  4N59 A;  4RL9 A;  3LVV A;  3F2C A;  1Q9F A;  3SAH A;  4LSH A;  3CP8 A;  2K4T A;  2H3F A;  1YS5 A;  1PHO A;  3VE1 A;  5PRN A;  3IG8 A;  2DQN B;  1G90 A;  3CRX A;  3HOE A;  2RRD A;  3VC8 A;  1ECW A;  1KBU A;  4LSF A;  2Z7J A;  1ZHZ A;  3NRW A;  2Y0L A;  4GCS A;  1BH3 A;  2W03 A;  2K4E A;  2K8A A;  2YPV A;  2M0N A;  1OSM A;  2G07 A;  4AYD C;  4G76 A;  2ZIW B;  4XNK A;  3C29 A;  3N7R C;  2M06 A;  2ZIW A;  3PRN A;  3T79 A;  4B61 A;  1OUQ A;  2KJ9 A;  4QIW C;  2ZXH A;  1Z19 A;  5CRX A;  3SY7 A;  4AYB F;  1PRN A;  3D2S A;  2HBK A;  2Y0S C;  2OMF A;  2W04 A;  2G06 A;  3VY8 X;  1IZN B;  2W81 C;  3UAQ A;  3HKZ C;  1IZN A;  4GFJ A;  4OJL A;  1HEK A;  2F76 X;  2N2M A;  3IP4 B;  3TZG A;  1UPH A;  2QTK A;  3PSI A;  3QRC A;  3SQI A;  4G75 A;  1P7D A;  2PMZ F;  2HOQ A;  2OXO A;  1BXW A;  3KVD D;  5EE2 A;  2XE2 A;  2ZIU B;  4C69 X;  2O4V A;  2ZIU A;  4GF4 A;  2D6F C;  1GFN A;  4F4B A;  2K4I A;  1PVQ A;  2LHF A;  3POX A;  3F2D A;  2KJ5 A;  1SZH A;  1GO3 F;  3IG5 A;  2VJ5 A;  3AA0 B;  1URJ A;  3AA6 A;  4P0Q B;  3RBH A;  4P0Q A;  2E1E A;  4AKR A;  4FZL A;  4A8E A;  3O0F A;  5AFU L;  1T94 A;  3H0L B;  4D5U A;  3VZU X;  5T14 A;  4NV0 A;  3O0E A;  4FRT A;  3LK3 B;  4ACO A;  2FGR A;  3LK3 A;  3PQU A;  3LK4 2;  2KOB A;  4AFK A;  5JDP A;  1NZB A;  2F77 X;  3PSP A;  2GH1 A;  5G26 A;  4BUM X;  3VCB A;  3C5O A;  3FYX A;  2FGQ X;  2HBL A;  4OJ6 A;  2Y0K A;  2W80 C;  4AYB C;  3PSF A;  4FZN A;  4NLC A;  4N58 A;  1DRG A;  2A3V A;  4AKM A;  2YB4 A;  1ZHX A;  4FUV A;  4KR8 A;  4JMU A;  2KZ7 B;  1H6S 1;  3A2S X;  2KVC A;  2XID A;  3D2Q A;  3F2B A;  5C0Y A;  3LYS A;  3PZP A;  2LHT A;  2HOI A;  2PMZ C;  4AUI A;  2KD1 A;  1XO0 A;  4D65 A;  2ODJ A;  2KNJ A;  2LKY A;  2JH1 A;  2G09 A;  3LVW A;  3VZT X;  2MHL A;  3AA7 B;  5HR6 A;  1BT9 A;  3AA7 A;  5HR7 A;  2KKP A;  1WUD A;  2WAQ F;  4KX3 A;  4OJ5 A;  2G5H B;  2JMG A;  3VY9 X;  4O4U A;  4CRX A;  2KV2 A;  3SY9 A;  1CRX A;  4ICA A;  4FMS A;  5A0L A;  2YNK A;  4U9C A;  2JH7 A;  1MM4 A;  2HBM A;  2E1F A;  4WJ3 B;  2KEY A;  2LYB A;  3OPX A;  1QJ9 A;  2KHV A;  2MNH A;  2POR A;  2LFU A;  3M6K A;  5IYU A;  2YX8 A;  5D5D A;  4KRA A;  1L6N A;  2LYA A;  1ZHY A;  4LSE A;  2JHD A;  4FSP A;  1MPF A;  1HXX A;  3L3F X;  5ADX L;  2VIX A;  3AQE A;  4RJW A;  1YT3 A;  1E54 A;  2Y2X A;  3AAE A;  4AYI D;  1QJP A;  2KJ8 A;  5KL1 B;  1QJ8 A;  4O3Z A;  1ZQ1 C;  2DGZ A;  3K19 A;  3SAF A;  4NWI A;  2XE1 A;  4AZL A;  8PRN A;  2ZG6 A;  1A6S A;  4OJO A;  1ORM A;  1A0P A;  2RHF A;  1Z1B A;  2H3I A;  3N7P D;  2GE4 A;  2J1N A;  2GOL A;  4O3M A;  3H0M B;  3ALR A;  3AA6 B;  2H3V A;  4RLB A;  3KFU F;  4AKR B;  2XTR A;  4FES A;  1HIW A;  3N7S C;  3AL0 B;  3E0F A;  4O49 A;  4QNL A;  3SYS A;  4BJQ A;  2WAQ C;  5AFU K;  4U6P A;  4BX9 C;  1HXU A;  5DL5 A;  2WB1 F;  2W7O A;  2ZFG A;  2F1T A;  3UPG A;  2RP5 A;  2DF4 B;  4LSI A;  2HOF A;  2XVT A;  3RFA A;  3MGV A;  4KX5 A;  5DL6 A;  2OYY A;  3K1Z A;  1MM5 A;  1Q3V A;  3POU A;  2KIW A;  2OM6 A;  3CYM A;  4RLC A;  2KDY A;  2M07 A;  4AYE C;  2JGA A;  4FOZ A;  3AQF A;  3SMV A;  3DA3 A;  3HW9 A;  4GCQ A;  2F8L A;  1OPF A;  3DA4 A;  2KXP A;  3AA1 A;  3KZX A;  3PST A;  2E5S A;  2XE5 A;  2H3Q A;  1XNS A;  2CPR A;  3V8U A;  2HMX A;  4KR4 A;  4CDG A;  3H0R B;  4KMO B;  1GFP A;  3M7D A;  4FRX A;  3D2N A;  3POQ A;  2MA1 A;  4U7C A;  1Q3U A;  2N1R A;  3RF9 A;  4Z3T A;  1F44 A;  3SYB A;  1PVP A;  3WI5 A;  3T0S A;  4O3X B;  4AYM C;  2CN1 A;  1ED1 A;  2N2L A;  2WB1 C;  1TAM A;  2ZIV B;  3GZF A;  4O4X A;  3UU2 A;  4AYN A;  3ICX A;  3QRA A;  2KKV A;  2ZIX B;  2ZIV A;  2YB1 A;  2ZIX A;  2XTQ A;  2J4U P;  1D8B A;  2K4H A;  4JFB A;  4QQ1 A;  3EMN X;  1ZHT A;  3AAE B;  2VKQ A;  5ADX K;  3POR A;  2OH2 A;  2XMX A;  3PQS A;  3C28 A;  2ZLD A;  4O3W A;  2K0L A;  2KHQ A;  5DL8 A;  2NV3 A;  2Q4T A;  1PVR A;  2G08 A;  3ONN A;  1MA7 A;  2XI9 A;  2W7P A;  2CRX A;  2F1V A;  3GU3 A;  4OO1 J;  2LBO A;  1THQ A;  4PUX A;  3SZV A;  3F53 A;  2XE3 A;  5DL7 A;  2X27 X;  4OJP A;  3HWB A;  2K8C B;  2PRN A;  2K89 A;  1Q9G A;  3T24 A;  2XIC A;  2Y0H A;  4NLB A;  6PRN A;  4P0P B;  4P0P A;  2H3Z A;  2K8B B;  4RJX A;  5GV0 A;  4FZM A;  2ZXI A;  1GFQ A;  7PRN A;  3NUQ A;  3IN5 A;  4QJF B;  2VJ4 A;  5T5F A;  2G0A A;  3T20 A;  2MRL A;  2R18 A;  3HOL A;  4JCH A;  3AA0 A;  3LK2 B;  3SZD A;  4GHB A;  4IC9 A;  3F5E A;  3GP6 A;  3LK2 A;  3JTY A;  3AAA B;  4FSO A;  2ERV A;  3AAA A;  5KL8 B;  2KC0 A;  1P4T A;  4QIW F;  4FT6 A;  1HXT A;  3F5A A;  4D64 A;  4E1T A;  3VE2 A;  2Y0S F;  3LK4 1;  4FE3 A;  1IIP A;  3HKZ F;  5FVN A;  3VZW X;  2XG6 A;  2G5I B;  4GCP A;  4CGZ A;  4PL1 A;  3G7G A;  2KXP B;  3SAG A;  3AA1 B;  4BUG A;  3DEE A;  3M6Z A;  3WI4 A;  4E1S A;  4O3Y A;  4XNL A;  4PL2 A;  2F2A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...