4FZMA

Crystal structure of the bacteriocin syringacin m from pseudomonas syringae pv. tomato dc3000
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
PIELPPTYITPYPEISAGGNGTYRGQDLSSGQSFPRGMQNPVATVLLLQGDLYCSPNCLATFQDQARRDSFGIQSKVALKTFAAADQREAEGRDLRTAYNEIATDIGRSQQINENIIKYPPGNHVLSGGLMTPFHALAHGMFGLGAPLTFPIQNVGLNVDIRGIPDVMNVIQSARPVGTSSLDVNFAYDVGKDSNASWLTLGNITLRLVGTIDKNASGAWTFSGEIRAFNDVYDANPSNHRGWLGENLTSLLSAVPFTSYSIEIPGSLPVTVSGNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Bacteriocin
publication title The Crystal Structure of the Lipid II-degrading Bacteriocin Syringacin M Suggests Unexpected Evolutionary Relationships between Colicin M-like Bacteriocins.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.880 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4fzmA01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4fzmA02
4FZLA 4FZMA 4G76A 2XTQA 3DA4A 4G75A 4N58A 2XTRA 4FZNA 4N59A 3DA3A 2XMXA
chains in the Genus database with same CATH superfamily
4O5KA 2ZJ5A 1KL9A 2E8OA 3RBDA 2ZLDA 2QB1A 5DKWA 1MQ3A 2O6KA 3UMGA 1XO0A 1ZQDA 2JHDA 2EANA 2HHQA 4HYKA 3UMBA 2GLEA 3TI0A 3K1RB 1AQ6A 1V9PA 3BDPA 1PK1A 4UB6O 1TK0A 3AA0B 1L7MA 1U9LA 3RB0A 2QTKA 2AQ0A 2NRXA 4DL6A 1XU4A 3ZDBA 2HHTA 3FM9A 5ALQA 2KHQA 1KFSA 3JPQA 2XVTA 4B9NA 2XO7A 2W7PA 2FE9A 2ZIUB 4C4RA 1S0OA 2D6FC 3T20A 3IM1A 1KLNA 3AU2A 4JFBA 2LHTA 5CHGA 3D6JA 3QRCA 1ZQOA 3T5LA 4GXJA 5D46A 3E58A 3NSGA 2HBKA 5ALXA 1ZRMA 3HRDD 2YTUA 4GC7A 4O0IA 3GV8B 3RJEA 8ICLA 2L5YA 5JTIA 4FO6A 3M9OB 3K75D 3PX6A 3PGSA 4MEXA 2H3FA 1COOA 2A3VA 3OJSA 3KHGA 1TK8A 2XY6A 7ICJA 2RQ5A 2PFPA 3KZIO 4YG2A 2GH1A 2IBKA 3NASA 4Y2JA 4DSFA 4TUQA 2XE3A 5ALUA 2MUTA 2FLPA 4NL9C 1UA0A 4UB2A 2OMFA 2FLNA 2DFLA 4DL2A 3LK3B 3HX0A 1JXLA 3VZUX 3DWOX 5AICA 1ZXIA 2ZXHA 5G3AA 2EQYA 5AKXA 1OSMA 2F1IA 2BR0A 3GDXA 5KAFU 4QZ9A 1S97A 2D8CA 4UAWA 5ALLA 2N1RA 3RRGA 5TZVA 4GXIA 4P0QB 5J2JA 1A76A 5CEHA 4RJXA 3SZDA 1QTMA 4JV2A 1X66A 4GCPA 2BKEA 2WB1C 5JUMA 3PMNA 4NLKA 2JEFA 2AGOA 5G38A 2PMZC 3WKCA 3PF1A 2H3IA 3KBBA 8ICZA 3NVVA 4AUIA 4LVSA 1IXRA 4DFPA 2K89A 4X5VA 3DEEA 2JEIA 2P66A 8ICFA 4Z6DA 2IHNA 1X9MA 6PRNA 3C21A 4CRXA 1ZQNA 3QU4A 4I2CA 2LM1A 4YMOA 2X27X 1RQLA 1QJ8A 2RDJA 3VY9X 4O5CA 4DL7A 5DB9A 3G7GA 1DK2A 5KFHA 1BPXA 4F3OA 4O3OA 2KMDA 1SV0A 3RJIA 5J0OA 5KG1A 3DV9A 4Q8FA 2AHOB 3QXGA 5JU5A 2K4IA 5KTQA 1ZD3A 5J2FA 3LK41 4D65A 3OGUA 4IC9A 1NK5A 4Y2YA 3BQ0A 1S76D 5AKHA 5KFNA 1EXNA 3IDWA 1XSPA 1K1QA 2KSOA 4JWNA 9ICWA 2R4NA 3EW9A 5BOMA 4GC6A 2LFUA 2ZUBA 1T7PA 3UXPA 1ZQ1C 1WCNA 4J9RA 3NUQA 2ZTEA 4OD0A 4B9TA 4MF2A 3GIJA 2BPCA 4UQGA 4DSLA 1A0PA 2AXTU 2FMSA 3PSPA 3DWNA 2G09A 4F5PA 1KFTA 8ICKA 2KEYA 2KXPB 4GCSA 3L3FX 3T5JA 4C4VB 2KKPA 2OYYA 1Z1BA 3BS5B 1JX4A 5EE2A 4M9HA 2KD1A 3BRYA 3PQSA 3SY7A 4R64A 5AM3A 3HW9A 2NRZA 2FLLA 4DSIA 3KOOA 1NK8A 3WI5A 3MR2A 4KX5A 5EOZA 4AP9A 3QE9Y 2HHSA 1SGGA 1PHOA 4N58A 4ECYA 1UT8A 4IQVA 1SIJA 3H4DA 1RYSA 1URJA 4NLZA 2ZJ8A 1S0MA 2XCAA 3BQ2A 4M9JA 1SB3C 2KZ7B 2E1FA 2AXTO 2FPMA 2G0AA 3RH5A 4I2JA 3RH6A 5CRXA 3PRNA 4EELA 1ZQKA 2WHEA 2KHVA 2EH9A 3CP8A 3V6HA 3TARA 3UXOA 1O03A 3RJFA 4K3CA 5KT5A 2DUYA 1QH9A 4P2HA 2LYHA 3RRHA 3V7LA 2KZMA 5HMLA 4C4TA 4ELTA 9ICGA 9ICFA 2LYBA 2AU0A 2I6XA 2UVWA 4J9MA 5ALJA 2CN1A 1FFVA 4FT6A 4YXJA 5FVNA 4MFAA 1GFMA 1VJ5A 1ZQLA 1XC9A 4C8OA 4LSIA 1UHUA 3KD3A 3N7SC 3LVVA 2WF5A 2FI1A 3F5AA 3K1ZA 4NM1A 1N5XA 2ATLA 3VE2A 2NO5A 3ALRA 4Z6EA 4AYBF 1KKXA 2PI4A 2IWWA 4KLHA 3KFUF 1HUOA 4NL9A 3T24A 3LDAA 4DLGA 2W8KA 1ZHZA 3SEIA 4DFMA 5J2EA 1OPFA 4N74A 1Y88A 2KNJA 3OSNA 3T5HA 3OHAA 3PO4A 3MFIA 1D8LA 3MGHA 4PR7A 9ICQA 2YB1A 5HNKA 4KLLA 2E8PA 4NWIA 1NI3A 4Z3TA 2VA2A 4QQ1A 4IRCA 5CB1A 2ODGA 3THVA 3EWAA 4F4KA 2DQNB 2AH5A 3C2KA 2H3QA 4C4SA 4O5EA 2WFAA 3AEVA 2ZIVB 4AKRA 2QB0A 2BCQA 5J0UA 4ECQA 1NZPA 4I2DA 3N7RC 2BCVA 4UAVA 7ICQA 2Y7SA 4DL3A 2MA1A 5AK3A 1S0VA 3HP6A 4DFKA 1S8OA 3QZ7A 3HKZF 2O4VA 2RP5A 4CF3A 4U9CA 2FGRA 4M9LA 3PR4A 3HPOA 4F8RA 5AK5A 3WK5A 4JWMA 1COKA 4KMUA 3AMZA 1KBUA 5ALIA 4F93B 3PV8A 1LKYA 1C7YA 3MDAA 5PRNA 2M07A 2A19A 1J97A 5D49A 4WJ3B 4UB4A 2GWSA 3IG5A 3GIIA 2W9MA 2G06A 2J6TA 2F1VA 1ZQAA 5KFYA 3OSPA 3RF9A 3IG8A 4DWIA 1TAMA 3OTQA 4OJOA 5IIIA 1NK4A 3B0YA 1ZD2P 3SAFA 2F8LA 4EBDA 4RQ3A 2QKQA 4BWJA 1T3QA 2K8CB 1ZQEA 5F3XB 3I1YA 5HMMA 4ECZA 5EE0A 2JMGA 2LMRA 3RH4A 3JPSA 3KHRA 1S9FA 8ICCA 3ZD9A 5DB8A 3A0HU 1GFQA 3CRXA 4O3XB 1ZQXA 1MSWD 2JR5A 3BQ1A 3GIKA 2BCUA 1QQ5A 2JEGA 1L3SA 5GTIO 5AKJA 4BXOB 3WK7A 2XY7A 2YB4A 4PL1A 8ICQA 3H7IA 5KFVA 4J9NA 4J9PA 3WK8A 3PGRA 8ICYA 4NLNA 3QU2A 3QEAZ 1GFOA 1Q9GA 3M6ZA 3UXNA 5AM5A 3WK4A 4DFJA 1MM5A 4R65A 3Q8LA 4FFDA 2UVUA 3WU2O 1U4BA 3E2EA 4B9SA 3FAHA 4FZLA 2R8IA 3H40A 3ZI4A 1Z00B 3J81j 3LK2A 2R8GA 1TV9A 4DEZA 3H8MA 5KT3A 4YD2A 4IQWA 2DKZA 2UVRA 5DLGA 9ICMA 3M8SA 3A0HO 3C2LA 4KLGA 1TE2A 3RTVA 1L3UA 2GO7A 4RQ2A 2V4QA 1QSSA 5AIBA 3T3FA 1OXJA 4PJ0U 4F71A 4BUGA 4KLSA 1SXEA 5ALZA 2JMMA 4GCQA 1QCKA 5KFFA 3C1ZA 4US9A 1LB2B 2WF6A 5KFBA 3M9NB 1WG8A 5KFJA 2IOFK 2P6RA 4FUVA 3NTUA 4J03A 5KAIU 1M6YA 5KFEA 5J2KA 1YZ7A 1WYGA 4RT2A 1QSLA 2KFNA 4J9QA 3ONNA 2A1JB 3B9JA 5IIOA 4B9VA 2YPVA 4D5UA 1N60A 3POXA 5ALKA 2W43A 4DF8A 5KG2A 1XO1A 4ED8A 1J2MA 2MAXA 4AZLA 1Z4OA 2Q0ZX 5EE1A 5KFLA 1Q3UA 3VZTX 3M6KA 4Y2RA 4KR4A 4M0AA 1MQ2A 3PSTA 3MR5A 1L5UA 1ZQRA 3ISBA 5DBAA 9ICNA 1HXTA 2FGQX 4RQ7A 2KJ9A 3PY8A 4DOAA 2P35A 1KN5A 5DDYA 3SV3A 3T5KA 2HHUA 3PZPA 4QWDA 1ZQFA 3ISCA 3PVXA 1FIQA 4OCZA 4QW8A 2Z7JA 5KG6A 1QSYA 1ZQSA 3NVYA 3V72A 7ICOA 5KFCA 3R9KA 4GFJA 1CUKA 4EEKA 1MN8A 4RQ1A 4U6PA 5DGAA 4DSKA 2KG5A 1S77D 4YP3A 2M9NA 5CJ7A 3MGIA 3ISDA 4QZAA 2M0NA 4TUSA 4YXMA 1IIPA 5J2GA 4Q43A 2FMQA 5TISU 2MUTB 3RAQA 2KJ5A 4ECTA 2JZBA 1WCLA 3VZWX 4NLBA 4XUSA 3WI4A 2G5IB 4Z6FA 4G75A 2VJ4A 2Y0HA 5DG7A 1N56A 2JRZA 3C5FA 4CGZA 2C2RA 4MEYA 3PW5A 2WB1F 3RBEA 2PMZF 2F1TA 1ZQGA 2YY6A 3AA1A 4QWCA 4KLIA 3TZGA 7ICIA 3GU3A 3TADC 2WTFA 1JUDA 2W80C 2BDUA 2RDIA 5EWEA 1GFPA 5GV0A 4QZBA 5KFQA 1XS9D 4TUPA 3F2CA 5TISO 4FSPA 1V38A 2EZYA 3O0EA 1NZBA 1GFNA 4N75A 5ALEA 4K4HA 4RNNA 4QZIA 3VC8A 8ICHA 2K8BB 5F9LA 4O49A 4I2IA 3V6JA 5DL7A 5DBCA 4JK1A 2RLTA 5B5EU 1SKWA 2CPRA 3SYBA 2NO4A 1K1SA 4GLXA 4DOBA 4RPXA 2R4LA 1XNSA 2H3VA 4OJLA 1UA1A 3BRZA 5IYUA 7PRNA 2ZUDA 3M7DA 4C7YA 3AA6B 3WKBA 3WK9A 4RNMA 4M47A 2E8NA 1X6JA 4AYMC 4I27A 3NRWA 2KJ8A 1Q46A 3K19A 9ICLA 4KLFA 2JGAA 2KSOB 2PFOA 3RJHA 1Q8KA 3QU7A 5L1LA 3MFHA 1ZHXA 4ECRA 3AA0A 2WF7A 2EAPA 5ALTA 3LWMA 5CR0A 2ASDA 5KT6A 4RUAA 2AGQA 1QQ7A 2XI9A 5L1JA 5J2HA 2XC9A 2YQEA 5B5EO 5HHIA 2V9WA 2ZIUA 4Z6CA 2HBJA 2E3TA 1A77A 5AKYA 3C23A 3POQA 3TQ1A 2ZIXA 3PORA 3MR6A 1F0MA 5AKZA 1RZTA 1FFUA 3QNMA 1JXEA 4JV1A 5KAFO 5AM0A 1N48A 4KITB 1DGSA 4KLUA 2B6GA 2W9BA 5CWRA 5J2CA 1ZQUA 3RAXA 2FPKA 5KG3A 4A8EA 4U7CA 4C69X 3HJEA 1ZD4A 3F2BA 1ZQIA 4RZRA 3NJTA 1UPHA 3C2MA 3V7KA 2Y0SC 5ALNA 2VKQA 4J9SA 3T0SA 1HEKA 3PMLA 2FDRA 5KFZA 4KMOB 2F44A 5ALOA 4MFCA 9ICVA 2ZTDA 4PHAA 3Q8PB 2AGPA 2HW3A 4IQTA 2J1NA 2I1QA 1KW4A 4ED3A 3LK3A 5F9NA 5E79U 3GZFA 2BGWA 8ICTA 5KFSA 3JCUO 4Y2QA 3UQ0A 7ICHA 5AI9A 2KZZA 1NK7A 3SYSA 4PPXA 2BQUA 1B22A 2YMQA 4ECSA 3ICXA 4FS1A 5J0YA 1G90A 3OPXA 2LHFA 4MFFA 4P0QA 4O4XA 1B43A 3FYHA 2B21A 4RJWA 4EX6A 1X9XA 1BPYA 2FJ6A 1F44A 3ORYA 3DA4A 2VANA 2H3ZA 2IWVA 4NY8A 1DXSA 4P4MA 1BPDA 4O3WA 2EZXA 4C7ZA 4UB3A 5AHXA 2KK0A 1NJXA 5KL1B 2VIXA 5G5GA 2GOLA 1N63A 4UAYA 3N97B 4KRAA 1PUZA 2M06A 1RYUA 3CYMA 3LWLA 1ZQQA 5E79O 1MA7A 3H0RB 4C80A 2XY5A 1L7OA 1NKBA 2H5XA 4ED1A 2IHMA 2ZIWA 1TFRA 5T5FA 4YVZA 4DCCA 3QUTA 4PZNA 5KG4A 1ORMA 9ICBA 3SY9A 4B6JA 3KZXA 5AI6A 8ICUA 5KFMA 4P4PA 2CXYA 3SZ2A 2HHVA 1BPEA 1NK0A 1BNPA 2W3RA 4ACOA 3ZD8A 5KG0A 2JH7A 4KLQA 3S6JA 5D4BA 9ICTA 5DBBA 1XSNA 8ICOA 1ZETA 2YX8A 1ZQTA 3MBYA 2K4TA 4PHEA 2WAQC 3H8WA 3AUOA 1SXDA 4E0DA 2ASLA 7ICFA 3C1YA 4TURA 4NLGA 1KSPA 2HOQA 2XGQA 4DQPA 2DF4B 5L1KA 3PW4A 3HOLA 2R89A 4RPYA 3G6YA 5DL8A 4O3RA 3KHLA 3SV4A 1ZJNA 4O3YA 4JB3A 3VY8X 1ZQBA 2ASJA 2GE4A 1LKYB 3NVWA 2VA3A 1Z19A 3IP4B 3BS5A 2KDYA 1LVHA 5AK4A 2HCFA 3WKAA 3FDSA 1DK3A 4PL2A 4FE3A 2ZJAA 5KFGA 2W8LA 2R8JA 4DSJA 3EPGA 4EENA 2HDOA 1SWVA 2ALZA 2HOFA 4AYNA 4UARA 2W9AA 1Z1VA 5J8YC 4LSFA 3JPTA 2JEJA 5KFIA 5EE3A 2XTRA 3H0MB 1E54A 1PVPA 3T79A 1ZQZA 2QARA 5ALGA 9ICJA 1SWWA 1U45A 2B0CA 5KFWA 3V6KA 1SV4A 4OO1J 3HWBA 4KN4A 5ALWA 4FSOA 5C0YA 2R8HA 2W81C 5AI8A 4EZ6A 2BCRA 2R4OA 4FESA 2WF9A 2HVHA 1N5WA 1XWLA 4I2GA 9ICPA 3MC1A 4M9GA 1NKEA 2XE5A 1WUDA 2DBYA 3LYSA 4IS7A 3SAGA 3HWTA 2KP7A 3DDHA 2XICA 1PRNA 2K60A 1ZOLA 4ED2A 3PSFA 4XA5A 2ERVA 2FPLA 5D5DA 4O3SA 4UB8U 4F5NA 1SL2A 3UU2A 1IZNA 2XGPA 5GTHU 1B0XA 4OJ6A 2IOHA 3RR8A 3C5GA 3LK2B 3GV7B 2YNKA 5AM1A 3AA7A 2Y9TA 1DGJA 4ED0A 3F2DA 3ZDAA 5HP4A 1D9FA 4NLCA 4AKMA 4G3IA 2IOFA 3IRUA 4AYID 2G5HB 4YD1A 1BPZA 4ECXA 3ED5A 2I5HA 1X42A 3ZDCA 3RFAA 2W9CA 3ZDDA 4AYDC 5J0QA 3GILA 2PORA 1S5LU 4NV0A 4UB8O 1T3NA 4MHVA 4JCHA 2V4RA 3M9MB 3FC4A 2CRXA 1CEZA 4F5OA 5AKKA 1UQVA 1AROP 4Q45A 4TQSA 3PNCA 5GTHO 3D2NA 4PHDA 9ICAA 1V97A 4QZDA 4BDPA 4KLTA 2MSNA 5B66U 3NRZA 8ICNA 4KN7A 3MGVA 5ALHA 4RNOA 2I9GA 2K4EA 5K4LA 3FYXA 1SKRA 4UW9A 1U48A 4DL5A 4ZH4A 3GIMA 2R4PA 3BZKA 1NKCA 3NVZA 9ICSA 4QZCA 3AAEB 3AM9A 3AAAB 2PKEA 1JI7A 1X9SA 1ZQVA 5HR6A 1CI4A 2BQRA 4DOCA 4BWMA 3LK42 7ICGA 2BDPA 5ALSA 1J2NA 1TVAA 4LZGA 1S5LO 4YR0A 1ZQPA 3JPRA 1ZQYA 2D3DA 1QLNA 3SYZA 4I2FA 1X2IA 5KFAA 5J29A 3EZ5A 8ICVA 4ED6A 4ICAA 1SKSA 2R18A 1BT9A 4QZFA 4M2YA 2JH1A 2KVSA 2ZTCA 4Q44A 1N2XA 4K3BA 1PK1B 5G26A 2R8KA 2JZBB 2KN7A 5CP2A 2C28A 1RM6C 1CRXA 4ELVA 3K4GA 5KNIA 4IL6U 2HI0A 2DWQA 4C8LA 8ICMA 3AN1A 3AA1B 4Y2SA 2OXOA 4F4YA 3BJYA 3M1YA 5KT2A 2Y1IA 5AFUK 8ICJA 3BS7A 2XIDA 1Z4NA 3PW0A 1ZYQA 2W7OA 3F53A 5ALDA 1NK6A 4EYIB 4J9KA 3SR6A 4PJ0O 4J9LA 4RQ8A 3RJGA 2W54A 2OHFA 4GIBA 4UBCA 4HAIA 5AKEA 3U26A 3KVDD 4B9UA 4EBCA 4FMSA 3EYZA 4F4XA 4LSEA 4KR8A 2Y0LA 5J8YA 2K0LA 2P6UA 3JPOA 4UB6U 1THQA 3QU9A 2KVCA 5KAIO 1JN3A 3M8RA 1XSLA 3F5EA 4QNLA 5EWGA 1B4FA 4O4UA 5IIJA 3QX7A 5J2AA 3SENA 4IL6O 1ZD5A 2MU2A 2DKXA 3MABA 3QUQA 3DZMA 1P7DA 4F4WA 2PRNA 5KFTA 2F2AB 2K8AA 3AU6A 4CE6A 1L8LA 4C8KA 3I76A 3JTYA 4IQUA 4CNQA 7ICEA 3RJKA 1KDHA 4P0PA 1VDVA 7ICUA 2JQYA 1L7PA 3RR7A 4R63A 4IRDA 2KE7A 3C28A 4O3MA 1NJWA 4K4IA 2KV2A 2NRWA 9ICXA 3G6VA 2HHXA 4M6WA 4IR1A 4O3ZA 7ICNA 3G6XA 2IA6A 5KL8B 1RG6A 1IM4A 2DL0A 3ETLA 1S10A 4UAZA 3KKAC 1BH3A 1ZRNA 3AQFA 2A1JA 2ZFGA 1Z3EB 3ZDEA 3KZIU 2RRDA 4FBUA 3SI8A 3L4PA 5IIKA 5HHHA 4F2SA 1QJPA 4R8UA 2KOBA 5J2IA 1H38A 1JROA 4RUCA 3SQIA 9ICUA 1N62A 4KX3A 2J4UP 4DS4A 3UQ2A 1L6NA 1ZQJA 1PVQA 3E0FA 4F91B 3SMVA 1T4GA 3QYPA 4MF8A 7ICMA 2ZIXB 1V85A 2ZXIA 4LJXA 7ICTA 2KIVA 2QLTA 3JPNA 2Y0SF 3QZ8A 2XMXA 2G08A 1KFDA 4R66A 1RPLA 2W9BB 1BPBA 2WJRA 2DGZA 4ED7A 2NYVA 1NK9A 5DB7A 5J0SA 1C20A 3PW2A 1MM4A 3H8JA 1VLBA 4UB5A 2KICA 4F92B 4DQIA 4DLEA 4FS2A 4C0ZA 1IV8A 2E5SA 1T94A 3RJJA 5JRTA 1X40A 4RLBA 1TAQA 2OH2A 4QZGA 4PZOA 2XE1A 2XE2A 3CW2C 4CF5A 5DDMA 1U47A 3UPQA 5ADXL 2Y2XA 4QW9A 2F77X 2KTQA 5KFDA 3TACB 5KT7A 1JRPA 5CA7A 4FQEA 4ECVA 2HVIA 4AFKA 2F1HA 5KT4A 2ZUCA 1ZHYA 2HOIA 4BUMX 4KLOA 3MR3A 5EWFA 2W3SA 4ECUA 2XCPA 3HT3A 2LKYA 1SL0A 3LVWA 3EPIA 2KFZA 1ED1A 4I2HA 1JMSA 1U49A 3KHHA 8ICXA 4I28A 4KTQA 1FEZA 4J9OA 1D8YA 1OW5A 2EZZA 3TAQA 5ADXK 1BVSA 3OJUA 5KFRA 1O08A 4IR9A 8ICGA 1GO3F 3Q8KA 1A6SA 4Y2XA 2IMWP 1PK3A 5AI4A 3Q8RB 2E1EA 4BJQA 4PHPA 3GQCA 2E8MA 2ZIWB 3PSIA 4BGDA 4DS5A 4GF4A 1ZQMA 1LV5A 1D8BA 5DQIA 1KTQA 1YS5A 4DQRA 3QUBA 4I2BA 1HJPA 3AA6A 4YQWA 2WAQF 3EUB2 4F5QA 2LPEA 4LZDA 5AM2A 2F1JA 4UAUA 7ICRA 3TAPA 3RB6A 2XTQA 4RL9A 2UVVA 2Q4TA 3Q8SB 5L1MA 1L3TA 4FBTA 4Y2PA 2AQ4A 1X9WA 4YR3A 1QJ9A 4US8A 2EAOA 2J6SA 4PGXA 3IHQB 5AI5A 3WKDA 4GHBA 2HSZA 3RB4A 3PGUA 8ICPA 3GV5B 4F4ZA 2PI5A 4FOZA 2F1CX 9ICKA 5A0LA 2W11A 2AJQA 9ICRA 4O3QA 3PX0A 2LI6A 4AYEC 1PZNA 5KFPA 1KQQA 8PRNA 4E1SA 4QZ8A 1YZ6A 3EMNX 2OCEA 1HXUA 3A0BU 2PFNA 2HMXA 3PO5A 2YMLA 2YMMA 1ZHTA 4QWEA 4KLJA 1IG6A 4G9BA 4QWBA 8ICIA 4I2EA 3L5KA 4N59A 3KKAA 1T1LA 3SD7A 2QARB 2RHFA 3TADA 3MDCA 3POUA 9ICIA 4PGYA 3QUCA 4O3NA 2OWOA 2N2LA 4AKRB 1SL1A 3N4MB 1RYRA 3TFSA 2QB0B 2A1AA 5J0WA 5EE9A 2VJ5A 4D64A 4O9MA 3N7PD 4Y2VA 4DL4A 5BPCA 4ZOHC 7ICSA 8ICRA 5AKLA 5AKIA 3A2SX 1RQNA 3Q8QB 4K4GA 3A0BO 2BPGA 1KEJA 4M9NA 4OJPA 2R88A 1IZNB 3TFRA 2Y1JA 3HILA 4NM2A 1HUZA 2KXPA 4DO9A 4DSEA 4C4VA 2ZG6A 5KG7A 3KTQA 9ICEA 2NV3A 7ICKA 2JV3A 3WKEA 3PR5B 4FRTA 3HW8A 3BS0A 5AKGA 4RQNA 3PQUA 3AA7B 2KIWA 1F5SA 5T14A 1RXVA 2BCSA 3VE1A 3BZCA 2OM6A 3UPGA 9ICHA 5DL5A 4OJ5A 5AM4A 2G07A 1PVRA 1NOMA 4YR2A 4EX7A 2F3NA 5ALFA 2PFQA 3H8SA 4UASA 4JMUA 5AK6A 1L8OA 3UMCA 4QZEA 2BZFA 1ZQCA 2W9CB 5H2FU 2KZ7A 2W03A 2ESEA 2W04A 2EAMA 2EDUA 3UM9A 4UBBA 8ICSA 8ICAA 4RT3A 5BOLA 2HHWA 5L9XA 3IV6A 5FP0A 7ICLA 2HBLA 3V7JA 3UAQA 2OEHA 4B61A 4IRKA 4C8NA 5G39A 5HR7A 2KC0A 5KG5A 8ICEA 5ALYA 1S0NA 2R8AA 2YMPA 2HBMA 4PGQA 4YCXA 1HXXA 5L1IA 4P4OA 2MNHA 2N2MA 4KLDA 4QWAA 2JXJA 4F72A 4YMNA 4RQ4A 3TKAA 5J0PA 5H2FO 3SAHA 4DFDA 2LBOA 2BHNA 4Y2UA 4RPZA 2WVPA 4XQ8A 5KFKA 1T16A 2ODJA 5ALVA 2NRTA 1WWUA 1BNOA 5AI0A 4B9MA 1OUQA 1Q9FA 5KFOA 4BX9C 4QIWF 2X9KA 5GTIU 5DG8A 4AYBC 3TANA 5KFUA 4RU9A 3BQ7A 3Q8MA 4CF4A 1QQ6A 4YMMA 2K4PA 4FZMA 3AL0B 4QJFB 3PW7A 4F2RA 2BQ3A 4Q8EA 2F76X 3WU2U 4YFKA 3HOEA 4TQRA 2Y0KA 1P4TA 5C5JA 1NNLA 1HIWA 5DB6A 1ZQHA 4RQMA 4KLMA 4Y2TA 3RBHA 4ELUA 4PH5A 2ZIVA 1SZPA 1RXWA 3BQTA 4XRHA 1UCVA 9ICOA 3NS1A 3JPPA 1ZQWA 4CCHA 1MC8A 4G76A 4YN4A 5G5HA 1ECWA 1JIHA 4USAA 3B0XA 3GFKB 4O3PA 1FO4A 1L7NA 3WK6A 4E1TA 4UB1A 4F5RA 1NJZA 3IN5A 3VCBA 2PXIA 2C2EA 5DGBA 4DF4A 2XG6A 2BPFA 4LSHA 1WWVA 1TK5A 9ICCA 4C8MA 3RB3A 5J0TA 3QU5A 5DG9A 2C22A 2NRVA 1RDFA 3C29A 4EZ9A 4FZNA 3D2QA 5AFUL 3HKZC 4B9LA 1TKDA 4EBEA 5B66O 2ES6A 2KKVA 8ICWA 5KFXA 1BGXT 4C00A 3CNHA 3GP6A 4EEYA 2J6UA 1JALA 3N28A 3ETRA 3QEBZ 4CDGA 5J2DA 1ZHWA 4F4BA 5J2BA 4NJ8A 4QIWC 2C2DA 4M04A 5DL6A 4P0PB 3AQEA 2WJQA 4DQSA 1SZHA 1L3VA 2DPJA 2DPIA 4UATA 4RQ5A 4I2AA 3C5OA 7ICPA 2WF8A 5J0RA 4M6WB 4F50A 4I29A 5IINA 7ICVA 4KLEA 1SV0C 3OHBA 5AIAA 3DA3A 2F8KA 5DQHA 1D9DA 4XNKA 4JV0A 5DQGA 4JUZA 3SZVA 1MPFA 3D2SA 2MHLA 3V8UA 2KZ3A 2FMPA 1NJYA 1DRGA 4XNLA 4BXOA 4QZHA 4R8UB 5DLFA 2W55A 5ALMA 1K5OA 2K4HA 4GXKA 1ZJMA 4FRXA 2ISPA 1BXWA 3I28A 4PUXA 3LK9A 4EYHB 3NGDA 5JDPA 1TAUA 2LM4A 5ALPA 2MRLA 4RQ6A 2ISOA 3AAEA 4DQQA 4RQ0A 1Q3VA 3AAAA 3QRAA 1N61A 3H4BA 1YT3A 2Y9UA 4CTDA 4NXZA 2LYAA 2YN4A 1H6S1 5IILA 1Z00A 2VA8A 3O0FA 4RLCA 5IIMA 5J0XA 1T8EA 8ICBA 1UT5A 1DOQA 4ECWA 1KRPA 3H0LB 5ALRA 1X6IA 3PX4A
chains in the Genus database with same CATH topology
2ZLDA 5ADXK 1GFQA 2HOQA 1XO0A 3CRXA 4O3XB 2JHDA 2DF4B 1GO3F 1A6SA 3HOLA 5DL8A 4O3YA 3AA0B 2E1EA 3VY8X 2GE4A 2YB4A 4PL1A 4BJQA 2QTKA 2ZIWB 3PSIA 1Z19A 3IP4B 4GF4A 2KDYA 1D8BA 1GFOA 4PL2A 1Q9GA 3M6ZA 4FE3A 2KHQA 2XVTA 1YS5A 2W7PA 1MM5A 2HOFA 2ZIUB 3AA6A 4AYNA 2D6FC 3T20A 2WAQF 4LSFA 4FZLA 4JFBA 2LHTA 2XTRA 3LK2A 3H0MB 3QRCA 1E54A 1PVPA 3T79A 2XTQA 4RL9A 3NSGA 2Q4TA 2HBKA 4OO1J 3HWBA 1QJ9A 4FSOA 5C0YA 2W81C 4GHBA 4FESA 4BUGA 2JMMA 2H3FA 4FOZA 4GCQA 5A0LA 2A3VA 2XE5A 1WUDA 3SAGA 3LYSA 4FUVA 2XICA 2GH1A 1PRNA 4AYEC 8PRNA 3PSFA 3ONNA 2ERVA 5D5DA 4E1SA 2XE3A 3EMNX 2YPVA 3UU2A 1IZNA 4D5UA 3POXA 1HXUA 2HMXA 4AZLA 1Q3UA 1ZHTA 2OMFA 3VZTX 3LK3B 3M6KA 4KR4A 3PSTA 4OJ6A 3VZUX 3LK2B 1HXTA 2FGQX 2ZXHA 2YNKA 4N59A 1OSMA 2RHFA 2KJ9A 3AA7A 3POUA 3F2DA 4NLCA 2N1RA 3PZPA 4AKMA 4P0QB 2N2LA 4RJXA 4AYID 2Z7JA 2G5HB 4AKRB 3SZDA 4GCPA 2WB1C 2VJ5A 2PMZC 4D64A 3N7PD 4GFJA 3RFAA 2H3IA 4AUIA 4AYDC 2PORA 4NV0A 2K89A 4U6PA 3DEEA 3A2SX 4JCHA 2CRXA 2M0NA 6PRNA 4CRXA 1IIPA 4OJPA 3D2NA 1IZNB 2X27X 2KJ5A 1QJ8A 2KXPA 3VY9X 3MGVA 3VZWX 4NLBA 3WI4A 2ZG6A 2G5IB 3G7GA 2K4EA 3FYXA 4G75A 2VJ4A 2NV3A 2Y0HA 4FRTA 4CGZA 3PQUA 2WB1F 3AAEB 3AA7B 2K4IA 2KIWA 2PMZF 5T14A 2F1TA 3AAAB 3LK41 4D65A 4IC9A 3AA1A 3VE1A 2OM6A 5HR6A 3UPGA 5DL5A 3TZGA 4OJ5A 2G07A 1PVRA 3LK42 3GU3A 4JMUA 2LFUA 2W80C 2BDUA 1ZQ1C 1GFPA 5GV0A 2KZ7A 2W03A 3NUQA 2W04A 3F2CA 4FSPA 1A0PA 3O0EA 1NZBA 1GFNA 4ICAA 2R18A 1BT9A 3PSPA 2HBLA 2G09A 3VC8A 2JH1A 2K8BB 3UAQA 2KEYA 2KXPB 5G26A 4B61A 4GCSA 3L3FX 5HR7A 4O49A 2KC0A 5DL7A 2KKPA 1CRXA 2OYYA 1Z1BA 2CPRA 3SYBA 2HBMA 5EE2A 1XNSA 2KD1A 2H3VA 1HXXA 3PQSA 4OJLA 3SY7A 3HW9A 5IYUA 2MNHA 7PRNA 3M7DA 2N2MA 3AA6B 3AA1B 3WI5A 2OXOA 4KX5A 4AYMC 3NRWA 1PHOA 4N58A 2KJ8A 5AFUK 2XIDA 3K19A 3SAHA 2JGAA 2LBOA 2W7OA 1URJA 3F53A 2ODJA 1ZHXA 2KZ7B 2E1FA 3AA0A 3KVDD 2G0AA 4FMSA 1OUQA 1Q9FA 4LSEA 4KR8A 4BX9C 2Y0LA 2K0LA 4QIWF 5CRXA 3PRNA 1THQA 2KVCA 2XI9A 4AYBC 2KHVA 3CP8A 3F5EA 4QNLA 4O4UA 2ZIUA 2HBJA 1P7DA 4FZMA 3AL0B 4QJFB 2F76X 3POQA 2LYBA 2PRNA 2F2AB 2K8AA 3HOEA 2CN1A 2ZIXA 3PORA 2Y0KA 1P4TA 3JTYA 4FT6A 5FVNA 1GFMA 1HIWA 3RBHA 4LSIA 2ZIVA 4P0PA 3N7SC 3LVVA 3F5AA 3K1ZA 3C28A 3VE2A 3ALRA 4A8EA 4U7CA 4O3MA 4G76A 4C69X 1ECWA 4AYBF 3F2BA 2KV2A 4E1TA 1UPHA 3IN5A 2Y0SC 3KFUF 4O3ZA 2VKQA 3VCBA 3T24A 5KL8B 3T0SA 1HEKA 1ZHZA 4KMOB 2XG6A 4LSHA 1OPFA 1BH3A 3AQFA 2KNJA 2ZFGA 2RRDA 2J1NA 1QJPA 3C29A 2KOBA 3SQIA 2YB1A 3LK3A 4FZNA 3D2QA 5AFUL 3GZFA 3HKZC 4KX3A 4NWIA 2J4UP 4Z3TA 4QQ1A 1L6NA 2KKVA 1PVQA 3E0FA 3SYSA 3SMVA 3GP6A 2ZIXB 4CDGA 1ZHWA 2ZXIA 2DQNB 3ICXA 1G90A 4F4BA 2H3QA 3OPXA 2LHFA 2Y0SF 4P0QA 4QIWC 4O4XA 2XMXA 5DL6A 2G08A 2ZIVB 4P0PB 4AKRA 3AQEA 4RJWA 2DGZA 1SZHA 1F44A 3N7RC 3DA4A 3C5OA 2H3ZA 2Y7SA 2MA1A 1MM4A 4O3WA 2KICA 5KL1B 2VIXA 3HKZF 2GOLA 2O4VA 2RP5A 4U9CA 4XNKA 2FGRA 4KRAA 4C0ZA 2M06A 3SZVA 1MPFA 3D2SA 3CYMA 2MHLA 3V8UA 1MA7A 3H0RB 2E5SA 1T94A 1DRGA 4XNLA 4RLBA 2XE1A 2OH2A 2XE2A 1KBUA 5ADXL 2K4HA 2Y2XA 4FRXA 5PRNA 2F77X 1BXWA 2ZIWA 2M07A 5T5FA 4PUXA 4WJ3B 5JDPA 3IG5A 2G06A 2F1VA 1ORMA 3SY9A 2MRLA 4AFKA 3AAEA 3RF9A 3KZXA 3IG8A 1Q3VA 3AAAA 3QRAA 1ZHYA 1TAMA 2HOIA 4OJOA 4BUMX 1YT3A 4ACOA 2LYAA 1H6S1 3SAFA 2F8LA 2JH7A 3O0FA 2LKYA 4RLCA 3LVWA 2K8CB 1ED1A 2YX8A 3H0LB 2K4TA 2JMGA 2WAQC 3DA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZL A;  4FZM A;  4G76 A;  2XTQ A;  3DA4 A;  4G75 A;  4N58 A;  2XTR A;  4FZN A;  4N59 A;  3DA3 A;  2XMX A; 
#chains in the Genus database with same CATH topology
 4O5K A;  2ZJ5 A;  1KL9 A;  2E8O A;  3RBD A;  2ZLD A;  2QB1 A;  5DKW A;  1MQ3 A;  2O6K A;  3UMG A;  1XO0 A;  1ZQD A;  2JHD A;  2EAN A;  2HHQ A;  4HYK A;  3UMB A;  2GLE A;  3TI0 A;  3K1R B;  1AQ6 A;  1V9P A;  3BDP A;  1PK1 A;  4UB6 O;  1TK0 A;  3AA0 B;  1L7M A;  1U9L A;  3RB0 A;  2QTK A;  2AQ0 A;  2NRX A;  4DL6 A;  1XU4 A;  3ZDB A;  2HHT A;  3FM9 A;  5ALQ A;  2KHQ A;  1KFS A;  3JPQ A;  2XVT A;  4B9N A;  2XO7 A;  2W7P A;  2FE9 A;  2ZIU B;  4C4R A;  1S0O A;  2D6F C;  3T20 A;  3IM1 A;  1KLN A;  3AU2 A;  4JFB A;  2LHT A;  5CHG A;  3D6J A;  3QRC A;  1ZQO A;  3T5L A;  4GXJ A;  5D46 A;  3E58 A;  3NSG A;  2HBK A;  5ALX A;  1ZRM A;  3HRD D;  2YTU A;  4GC7 A;  4O0I A;  3GV8 B;  3RJE A;  8ICL A;  2L5Y A;  5JTI A;  4FO6 A;  3M9O B;  3K75 D;  3PX6 A;  3PGS A;  4MEX A;  2H3F A;  1COO A;  2A3V A;  3OJS A;  3KHG A;  1TK8 A;  2XY6 A;  7ICJ A;  2RQ5 A;  2PFP A;  3KZI O;  4YG2 A;  2GH1 A;  2IBK A;  3NAS A;  4Y2J A;  4DSF A;  4TUQ A;  2XE3 A;  5ALU A;  2MUT A;  2FLP A;  4NL9 C;  1UA0 A;  4UB2 A;  2OMF A;  2FLN A;  2DFL A;  4DL2 A;  3LK3 B;  3HX0 A;  1JXL A;  3VZU X;  3DWO X;  5AIC A;  1ZXI A;  2ZXH A;  5G3A A;  2EQY A;  5AKX A;  1OSM A;  2F1I A;  2BR0 A;  3GDX A;  5KAF U;  4QZ9 A;  1S97 A;  2D8C A;  4UAW A;  5ALL A;  2N1R A;  3RRG A;  5TZV A;  4GXI A;  4P0Q B;  5J2J A;  1A76 A;  5CEH A;  4RJX A;  3SZD A;  1QTM A;  4JV2 A;  1X66 A;  4GCP A;  2BKE A;  2WB1 C;  5JUM A;  3PMN A;  4NLK A;  2JEF A;  2AGO A;  5G38 A;  2PMZ C;  3WKC A;  3PF1 A;  2H3I A;  3KBB A;  8ICZ A;  3NVV A;  4AUI A;  4LVS A;  1IXR A;  4DFP A;  2K89 A;  4X5V A;  3DEE A;  2JEI A;  2P66 A;  8ICF A;  4Z6D A;  2IHN A;  1X9M A;  6PRN A;  3C21 A;  4CRX A;  1ZQN A;  3QU4 A;  4I2C A;  2LM1 A;  4YMO A;  2X27 X;  1RQL A;  1QJ8 A;  2RDJ A;  3VY9 X;  4O5C A;  4DL7 A;  5DB9 A;  3G7G A;  1DK2 A;  5KFH A;  1BPX A;  4F3O A;  4O3O A;  2KMD A;  1SV0 A;  3RJI A;  5J0O A;  5KG1 A;  3DV9 A;  4Q8F A;  2AHO B;  3QXG A;  5JU5 A;  2K4I A;  5KTQ A;  1ZD3 A;  5J2F A;  3LK4 1;  4D65 A;  3OGU A;  4IC9 A;  1NK5 A;  4Y2Y A;  3BQ0 A;  1S76 D;  5AKH A;  5KFN A;  1EXN A;  3IDW A;  1XSP A;  1K1Q A;  2KSO A;  4JWN A;  9ICW A;  2R4N A;  3EW9 A;  5BOM A;  4GC6 A;  2LFU A;  2ZUB A;  1T7P A;  3UXP A;  1ZQ1 C;  1WCN A;  4J9R A;  3NUQ A;  2ZTE A;  4OD0 A;  4B9T A;  4MF2 A;  3GIJ A;  2BPC A;  4UQG A;  4DSL A;  1A0P A;  2AXT U;  2FMS A;  3PSP A;  3DWN A;  2G09 A;  4F5P A;  1KFT A;  8ICK A;  2KEY A;  2KXP B;  4GCS A;  3L3F X;  3T5J A;  4C4V B;  2KKP A;  2OYY A;  1Z1B A;  3BS5 B;  1JX4 A;  5EE2 A;  4M9H A;  2KD1 A;  3BRY A;  3PQS A;  3SY7 A;  4R64 A;  5AM3 A;  3HW9 A;  2NRZ A;  2FLL A;  4DSI A;  3KOO A;  1NK8 A;  3WI5 A;  3MR2 A;  4KX5 A;  5EOZ A;  4AP9 A;  3QE9 Y;  2HHS A;  1SGG A;  1PHO A;  4N58 A;  4ECY A;  1UT8 A;  4IQV A;  1SIJ A;  3H4D A;  1RYS A;  1URJ A;  4NLZ A;  2ZJ8 A;  1S0M A;  2XCA A;  3BQ2 A;  4M9J A;  1SB3 C;  2KZ7 B;  2E1F A;  2AXT O;  2FPM A;  2G0A A;  3RH5 A;  4I2J A;  3RH6 A;  5CRX A;  3PRN A;  4EEL A;  1ZQK A;  2WHE A;  2KHV A;  2EH9 A;  3CP8 A;  3V6H A;  3TAR A;  3UXO A;  1O03 A;  3RJF A;  4K3C A;  5KT5 A;  2DUY A;  1QH9 A;  4P2H A;  2LYH A;  3RRH A;  3V7L A;  2KZM A;  5HML A;  4C4T A;  4ELT A;  9ICG A;  9ICF A;  2LYB A;  2AU0 A;  2I6X A;  2UVW A;  4J9M A;  5ALJ A;  2CN1 A;  1FFV A;  4FT6 A;  4YXJ A;  5FVN A;  4MFA A;  1GFM A;  1VJ5 A;  1ZQL A;  1XC9 A;  4C8O A;  4LSI A;  1UHU A;  3KD3 A;  3N7S C;  3LVV A;  2WF5 A;  2FI1 A;  3F5A A;  3K1Z A;  4NM1 A;  1N5X A;  2ATL A;  3VE2 A;  2NO5 A;  3ALR A;  4Z6E A;  4AYB F;  1KKX A;  2PI4 A;  2IWW A;  4KLH A;  3KFU F;  1HUO A;  4NL9 A;  3T24 A;  3LDA A;  4DLG A;  2W8K A;  1ZHZ A;  3SEI A;  4DFM A;  5J2E A;  1OPF A;  4N74 A;  1Y88 A;  2KNJ A;  3OSN A;  3T5H A;  3OHA A;  3PO4 A;  3MFI A;  1D8L A;  3MGH A;  4PR7 A;  9ICQ A;  2YB1 A;  5HNK A;  4KLL A;  2E8P A;  4NWI A;  1NI3 A;  4Z3T A;  2VA2 A;  4QQ1 A;  4IRC A;  5CB1 A;  2ODG A;  3THV A;  3EWA A;  4F4K A;  2DQN B;  2AH5 A;  3C2K A;  2H3Q A;  4C4S A;  4O5E A;  2WFA A;  3AEV A;  2ZIV B;  4AKR A;  2QB0 A;  2BCQ A;  5J0U A;  4ECQ A;  1NZP A;  4I2D A;  3N7R C;  2BCV A;  4UAV A;  7ICQ A;  2Y7S A;  4DL3 A;  2MA1 A;  5AK3 A;  1S0V A;  3HP6 A;  4DFK A;  1S8O A;  3QZ7 A;  3HKZ F;  2O4V A;  2RP5 A;  4CF3 A;  4U9C A;  2FGR A;  4M9L A;  3PR4 A;  3HPO A;  4F8R A;  5AK5 A;  3WK5 A;  4JWM A;  1COK A;  4KMU A;  3AMZ A;  1KBU A;  5ALI A;  4F93 B;  3PV8 A;  1LKY A;  1C7Y A;  3MDA A;  5PRN A;  2M07 A;  2A19 A;  1J97 A;  5D49 A;  4WJ3 B;  4UB4 A;  2GWS A;  3IG5 A;  3GII A;  2W9M A;  2G06 A;  2J6T A;  2F1V A;  1ZQA A;  5KFY A;  3OSP A;  3RF9 A;  3IG8 A;  4DWI A;  1TAM A;  3OTQ A;  4OJO A;  5III A;  1NK4 A;  3B0Y A;  1ZD2 P;  3SAF A;  2F8L A;  4EBD A;  4RQ3 A;  2QKQ A;  4BWJ A;  1T3Q A;  2K8C B;  1ZQE A;  5F3X B;  3I1Y A;  5HMM A;  4ECZ A;  5EE0 A;  2JMG A;  2LMR A;  3RH4 A;  3JPS A;  3KHR A;  1S9F A;  8ICC A;  3ZD9 A;  5DB8 A;  3A0H U;  1GFQ A;  3CRX A;  4O3X B;  1ZQX A;  1MSW D;  2JR5 A;  3BQ1 A;  3GIK A;  2BCU A;  1QQ5 A;  2JEG A;  1L3S A;  5GTI O;  5AKJ A;  4BXO B;  3WK7 A;  2XY7 A;  2YB4 A;  4PL1 A;  8ICQ A;  3H7I A;  5KFV A;  4J9N A;  4J9P A;  3WK8 A;  3PGR A;  8ICY A;  4NLN A;  3QU2 A;  3QEA Z;  1GFO A;  1Q9G A;  3M6Z A;  3UXN A;  5AM5 A;  3WK4 A;  4DFJ A;  1MM5 A;  4R65 A;  3Q8L A;  4FFD A;  2UVU A;  3WU2 O;  1U4B A;  3E2E A;  4B9S A;  3FAH A;  4FZL A;  2R8I A;  3H40 A;  3ZI4 A;  1Z00 B;  3J81 j;  3LK2 A;  2R8G A;  1TV9 A;  4DEZ A;  3H8M A;  5KT3 A;  4YD2 A;  4IQW A;  2DKZ A;  2UVR A;  5DLG A;  9ICM A;  3M8S A;  3A0H O;  3C2L A;  4KLG A;  1TE2 A;  3RTV A;  1L3U A;  2GO7 A;  4RQ2 A;  2V4Q A;  1QSS A;  5AIB A;  3T3F A;  1OXJ A;  4PJ0 U;  4F71 A;  4BUG A;  4KLS A;  1SXE A;  5ALZ A;  2JMM A;  4GCQ A;  1QCK A;  5KFF A;  3C1Z A;  4US9 A;  1LB2 B;  2WF6 A;  5KFB A;  3M9N B;  1WG8 A;  5KFJ A;  2IOF K;  2P6R A;  4FUV A;  3NTU A;  4J03 A;  5KAI U;  1M6Y A;  5KFE A;  5J2K A;  1YZ7 A;  1WYG A;  4RT2 A;  1QSL A;  2KFN A;  4J9Q A;  3ONN A;  2A1J B;  3B9J A;  5IIO A;  4B9V A;  2YPV A;  4D5U A;  1N60 A;  3POX A;  5ALK A;  2W43 A;  4DF8 A;  5KG2 A;  1XO1 A;  4ED8 A;  1J2M A;  2MAX A;  4AZL A;  1Z4O A;  2Q0Z X;  5EE1 A;  5KFL A;  1Q3U A;  3VZT X;  3M6K A;  4Y2R A;  4KR4 A;  4M0A A;  1MQ2 A;  3PST A;  3MR5 A;  1L5U A;  1ZQR A;  3ISB A;  5DBA A;  9ICN A;  1HXT A;  2FGQ X;  4RQ7 A;  2KJ9 A;  3PY8 A;  4DOA A;  2P35 A;  1KN5 A;  5DDY A;  3SV3 A;  3T5K A;  2HHU A;  3PZP A;  4QWD A;  1ZQF A;  3ISC A;  3PVX A;  1FIQ A;  4OCZ A;  4QW8 A;  2Z7J A;  5KG6 A;  1QSY A;  1ZQS A;  3NVY A;  3V72 A;  7ICO A;  5KFC A;  3R9K A;  4GFJ A;  1CUK A;  4EEK A;  1MN8 A;  4RQ1 A;  4U6P A;  5DGA A;  4DSK A;  2KG5 A;  1S77 D;  4YP3 A;  2M9N A;  5CJ7 A;  3MGI A;  3ISD A;  4QZA A;  2M0N A;  4TUS A;  4YXM A;  1IIP A;  5J2G A;  4Q43 A;  2FMQ A;  5TIS U;  2MUT B;  3RAQ A;  2KJ5 A;  4ECT A;  2JZB A;  1WCL A;  3VZW X;  4NLB A;  4XUS A;  3WI4 A;  2G5I B;  4Z6F A;  4G75 A;  2VJ4 A;  2Y0H A;  5DG7 A;  1N56 A;  2JRZ A;  3C5F A;  4CGZ A;  2C2R A;  4MEY A;  3PW5 A;  2WB1 F;  3RBE A;  2PMZ F;  2F1T A;  1ZQG A;  2YY6 A;  3AA1 A;  4QWC A;  4KLI A;  3TZG A;  7ICI A;  3GU3 A;  3TAD C;  2WTF A;  1JUD A;  2W80 C;  2BDU A;  2RDI A;  5EWE A;  1GFP A;  5GV0 A;  4QZB A;  5KFQ A;  1XS9 D;  4TUP A;  3F2C A;  5TIS O;  4FSP A;  1V38 A;  2EZY A;  3O0E A;  1NZB A;  1GFN A;  4N75 A;  5ALE A;  4K4H A;  4RNN A;  4QZI A;  3VC8 A;  8ICH A;  2K8B B;  5F9L A;  4O49 A;  4I2I A;  3V6J A;  5DL7 A;  5DBC A;  4JK1 A;  2RLT A;  5B5E U;  1SKW A;  2CPR A;  3SYB A;  2NO4 A;  1K1S A;  4GLX A;  4DOB A;  4RPX A;  2R4L A;  1XNS A;  2H3V A;  4OJL A;  1UA1 A;  3BRZ A;  5IYU A;  7PRN A;  2ZUD A;  3M7D A;  4C7Y A;  3AA6 B;  3WKB A;  3WK9 A;  4RNM A;  4M47 A;  2E8N A;  1X6J A;  4AYM C;  4I27 A;  3NRW A;  2KJ8 A;  1Q46 A;  3K19 A;  9ICL A;  4KLF A;  2JGA A;  2KSO B;  2PFO A;  3RJH A;  1Q8K A;  3QU7 A;  5L1L A;  3MFH A;  1ZHX A;  4ECR A;  3AA0 A;  2WF7 A;  2EAP A;  5ALT A;  3LWM A;  5CR0 A;  2ASD A;  5KT6 A;  4RUA A;  2AGQ A;  1QQ7 A;  2XI9 A;  5L1J A;  5J2H A;  2XC9 A;  2YQE A;  5B5E O;  5HHI A;  2V9W A;  2ZIU A;  4Z6C A;  2HBJ A;  2E3T A;  1A77 A;  5AKY A;  3C23 A;  3POQ A;  3TQ1 A;  2ZIX A;  3POR A;  3MR6 A;  1F0M A;  5AKZ A;  1RZT A;  1FFU A;  3QNM A;  1JXE A;  4JV1 A;  5KAF O;  5AM0 A;  1N48 A;  4KIT B;  1DGS A;  4KLU A;  2B6G A;  2W9B A;  5CWR A;  5J2C A;  1ZQU A;  3RAX A;  2FPK A;  5KG3 A;  4A8E A;  4U7C A;  4C69 X;  3HJE A;  1ZD4 A;  3F2B A;  1ZQI A;  4RZR A;  3NJT A;  1UPH A;  3C2M A;  3V7K A;  2Y0S C;  5ALN A;  2VKQ A;  4J9S A;  3T0S A;  1HEK A;  3PML A;  2FDR A;  5KFZ A;  4KMO B;  2F44 A;  5ALO A;  4MFC A;  9ICV A;  2ZTD A;  4PHA A;  3Q8P B;  2AGP A;  2HW3 A;  4IQT A;  2J1N A;  2I1Q A;  1KW4 A;  4ED3 A;  3LK3 A;  5F9N A;  5E79 U;  3GZF A;  2BGW A;  8ICT A;  5KFS A;  3JCU O;  4Y2Q A;  3UQ0 A;  7ICH A;  5AI9 A;  2KZZ A;  1NK7 A;  3SYS A;  4PPX A;  2BQU A;  1B22 A;  2YMQ A;  4ECS A;  3ICX A;  4FS1 A;  5J0Y A;  1G90 A;  3OPX A;  2LHF A;  4MFF A;  4P0Q A;  4O4X A;  1B43 A;  3FYH A;  2B21 A;  4RJW A;  4EX6 A;  1X9X A;  1BPY A;  2FJ6 A;  1F44 A;  3ORY A;  3DA4 A;  2VAN A;  2H3Z A;  2IWV A;  4NY8 A;  1DXS A;  4P4M A;  1BPD A;  4O3W A;  2EZX A;  4C7Z A;  4UB3 A;  5AHX A;  2KK0 A;  1NJX A;  5KL1 B;  2VIX A;  5G5G A;  2GOL A;  1N63 A;  4UAY A;  3N97 B;  4KRA A;  1PUZ A;  2M06 A;  1RYU A;  3CYM A;  3LWL A;  1ZQQ A;  5E79 O;  1MA7 A;  3H0R B;  4C80 A;  2XY5 A;  1L7O A;  1NKB A;  2H5X A;  4ED1 A;  2IHM A;  2ZIW A;  1TFR A;  5T5F A;  4YVZ A;  4DCC A;  3QUT A;  4PZN A;  5KG4 A;  1ORM A;  9ICB A;  3SY9 A;  4B6J A;  3KZX A;  5AI6 A;  8ICU A;  5KFM A;  4P4P A;  2CXY A;  3SZ2 A;  2HHV A;  1BPE A;  1NK0 A;  1BNP A;  2W3R A;  4ACO A;  3ZD8 A;  5KG0 A;  2JH7 A;  4KLQ A;  3S6J A;  5D4B A;  9ICT A;  5DBB A;  1XSN A;  8ICO A;  1ZET A;  2YX8 A;  1ZQT A;  3MBY A;  2K4T A;  4PHE A;  2WAQ C;  3H8W A;  3AUO A;  1SXD A;  4E0D A;  2ASL A;  7ICF A;  3C1Y A;  4TUR A;  4NLG A;  1KSP A;  2HOQ A;  2XGQ A;  4DQP A;  2DF4 B;  5L1K A;  3PW4 A;  3HOL A;  2R89 A;  4RPY A;  3G6Y A;  5DL8 A;  4O3R A;  3KHL A;  3SV4 A;  1ZJN A;  4O3Y A;  4JB3 A;  3VY8 X;  1ZQB A;  2ASJ A;  2GE4 A;  1LKY B;  3NVW A;  2VA3 A;  1Z19 A;  3IP4 B;  3BS5 A;  2KDY A;  1LVH A;  5AK4 A;  2HCF A;  3WKA A;  3FDS A;  1DK3 A;  4PL2 A;  4FE3 A;  2ZJA A;  5KFG A;  2W8L A;  2R8J A;  4DSJ A;  3EPG A;  4EEN A;  2HDO A;  1SWV A;  2ALZ A;  2HOF A;  4AYN A;  4UAR A;  2W9A A;  1Z1V A;  5J8Y C;  4LSF A;  3JPT A;  2JEJ A;  5KFI A;  5EE3 A;  2XTR A;  3H0M B;  1E54 A;  1PVP A;  3T79 A;  1ZQZ A;  2QAR A;  5ALG A;  9ICJ A;  1SWW A;  1U45 A;  2B0C A;  5KFW A;  3V6K A;  1SV4 A;  4OO1 J;  3HWB A;  4KN4 A;  5ALW A;  4FSO A;  5C0Y A;  2R8H A;  2W81 C;  5AI8 A;  4EZ6 A;  2BCR A;  2R4O A;  4FES A;  2WF9 A;  2HVH A;  1N5W A;  1XWL A;  4I2G A;  9ICP A;  3MC1 A;  4M9G A;  1NKE A;  2XE5 A;  1WUD A;  2DBY A;  3LYS A;  4IS7 A;  3SAG A;  3HWT A;  2KP7 A;  3DDH A;  2XIC A;  1PRN A;  2K60 A;  1ZOL A;  4ED2 A;  3PSF A;  4XA5 A;  2ERV A;  2FPL A;  5D5D A;  4O3S A;  4UB8 U;  4F5N A;  1SL2 A;  3UU2 A;  1IZN A;  2XGP A;  5GTH U;  1B0X A;  4OJ6 A;  2IOH A;  3RR8 A;  3C5G A;  3LK2 B;  3GV7 B;  2YNK A;  5AM1 A;  3AA7 A;  2Y9T A;  1DGJ A;  4ED0 A;  3F2D A;  3ZDA A;  5HP4 A;  1D9F A;  4NLC A;  4AKM A;  4G3I A;  2IOF A;  3IRU A;  4AYI D;  2G5H B;  4YD1 A;  1BPZ A;  4ECX A;  3ED5 A;  2I5H A;  1X42 A;  3ZDC A;  3RFA A;  2W9C A;  3ZDD A;  4AYD C;  5J0Q A;  3GIL A;  2POR A;  1S5L U;  4NV0 A;  4UB8 O;  1T3N A;  4MHV A;  4JCH A;  2V4R A;  3M9M B;  3FC4 A;  2CRX A;  1CEZ A;  4F5O A;  5AKK A;  1UQV A;  1ARO P;  4Q45 A;  4TQS A;  3PNC A;  5GTH O;  3D2N A;  4PHD A;  9ICA A;  1V97 A;  4QZD A;  4BDP A;  4KLT A;  2MSN A;  5B66 U;  3NRZ A;  8ICN A;  4KN7 A;  3MGV A;  5ALH A;  4RNO A;  2I9G A;  2K4E A;  5K4L A;  3FYX A;  1SKR A;  4UW9 A;  1U48 A;  4DL5 A;  4ZH4 A;  3GIM A;  2R4P A;  3BZK A;  1NKC A;  3NVZ A;  9ICS A;  4QZC A;  3AAE B;  3AM9 A;  3AAA B;  2PKE A;  1JI7 A;  1X9S A;  1ZQV A;  5HR6 A;  1CI4 A;  2BQR A;  4DOC A;  4BWM A;  3LK4 2;  7ICG A;  2BDP A;  5ALS A;  1J2N A;  1TVA A;  4LZG A;  1S5L O;  4YR0 A;  1ZQP A;  3JPR A;  1ZQY A;  2D3D A;  1QLN A;  3SYZ A;  4I2F A;  1X2I A;  5KFA A;  5J29 A;  3EZ5 A;  8ICV A;  4ED6 A;  4ICA A;  1SKS A;  2R18 A;  1BT9 A;  4QZF A;  4M2Y A;  2JH1 A;  2KVS A;  2ZTC A;  4Q44 A;  1N2X A;  4K3B A;  1PK1 B;  5G26 A;  2R8K A;  2JZB B;  2KN7 A;  5CP2 A;  2C28 A;  1RM6 C;  1CRX A;  4ELV A;  3K4G A;  5KNI A;  4IL6 U;  2HI0 A;  2DWQ A;  4C8L A;  8ICM A;  3AN1 A;  3AA1 B;  4Y2S A;  2OXO A;  4F4Y A;  3BJY A;  3M1Y A;  5KT2 A;  2Y1I A;  5AFU K;  8ICJ A;  3BS7 A;  2XID A;  1Z4N A;  3PW0 A;  1ZYQ A;  2W7O A;  3F53 A;  5ALD A;  1NK6 A;  4EYI B;  4J9K A;  3SR6 A;  4PJ0 O;  4J9L A;  4RQ8 A;  3RJG A;  2W54 A;  2OHF A;  4GIB A;  4UBC A;  4HAI A;  5AKE A;  3U26 A;  3KVD D;  4B9U A;  4EBC A;  4FMS A;  3EYZ A;  4F4X A;  4LSE A;  4KR8 A;  2Y0L A;  5J8Y A;  2K0L A;  2P6U A;  3JPO A;  4UB6 U;  1THQ A;  3QU9 A;  2KVC A;  5KAI O;  1JN3 A;  3M8R A;  1XSL A;  3F5E A;  4QNL A;  5EWG A;  1B4F A;  4O4U A;  5IIJ A;  3QX7 A;  5J2A A;  3SEN A;  4IL6 O;  1ZD5 A;  2MU2 A;  2DKX A;  3MAB A;  3QUQ A;  3DZM A;  1P7D A;  4F4W A;  2PRN A;  5KFT A;  2F2A B;  2K8A A;  3AU6 A;  4CE6 A;  1L8L A;  4C8K A;  3I76 A;  3JTY A;  4IQU A;  4CNQ A;  7ICE A;  3RJK A;  1KDH A;  4P0P A;  1VDV A;  7ICU A;  2JQY A;  1L7P A;  3RR7 A;  4R63 A;  4IRD A;  2KE7 A;  3C28 A;  4O3M A;  1NJW A;  4K4I A;  2KV2 A;  2NRW A;  9ICX A;  3G6V A;  2HHX A;  4M6W A;  4IR1 A;  4O3Z A;  7ICN A;  3G6X A;  2IA6 A;  5KL8 B;  1RG6 A;  1IM4 A;  2DL0 A;  3ETL A;  1S10 A;  4UAZ A;  3KKA C;  1BH3 A;  1ZRN A;  3AQF A;  2A1J A;  2ZFG A;  1Z3E B;  3ZDE A;  3KZI U;  2RRD A;  4FBU A;  3SI8 A;  3L4P A;  5IIK A;  5HHH A;  4F2S A;  1QJP A;  4R8U A;  2KOB A;  5J2I A;  1H38 A;  1JRO A;  4RUC A;  3SQI A;  9ICU A;  1N62 A;  4KX3 A;  2J4U P;  4DS4 A;  3UQ2 A;  1L6N A;  1ZQJ A;  1PVQ A;  3E0F A;  4F91 B;  3SMV A;  1T4G A;  3QYP A;  4MF8 A;  7ICM A;  2ZIX B;  1V85 A;  2ZXI A;  4LJX A;  7ICT A;  2KIV A;  2QLT A;  3JPN A;  2Y0S F;  3QZ8 A;  2XMX A;  2G08 A;  1KFD A;  4R66 A;  1RPL A;  2W9B B;  1BPB A;  2WJR A;  2DGZ A;  4ED7 A;  2NYV A;  1NK9 A;  5DB7 A;  5J0S A;  1C20 A;  3PW2 A;  1MM4 A;  3H8J A;  1VLB A;  4UB5 A;  2KIC A;  4F92 B;  4DQI A;  4DLE A;  4FS2 A;  4C0Z A;  1IV8 A;  2E5S A;  1T94 A;  3RJJ A;  5JRT A;  1X40 A;  4RLB A;  1TAQ A;  2OH2 A;  4QZG A;  4PZO A;  2XE1 A;  2XE2 A;  3CW2 C;  4CF5 A;  5DDM A;  1U47 A;  3UPQ A;  5ADX L;  2Y2X A;  4QW9 A;  2F77 X;  2KTQ A;  5KFD A;  3TAC B;  5KT7 A;  1JRP A;  5CA7 A;  4FQE A;  4ECV A;  2HVI A;  4AFK A;  2F1H A;  5KT4 A;  2ZUC A;  1ZHY A;  2HOI A;  4BUM X;  4KLO A;  3MR3 A;  5EWF A;  2W3S A;  4ECU A;  2XCP A;  3HT3 A;  2LKY A;  1SL0 A;  3LVW A;  3EPI A;  2KFZ A;  1ED1 A;  4I2H A;  1JMS A;  1U49 A;  3KHH A;  8ICX A;  4I28 A;  4KTQ A;  1FEZ A;  4J9O A;  1D8Y A;  1OW5 A;  2EZZ A;  3TAQ A;  5ADX K;  1BVS A;  3OJU A;  5KFR A;  1O08 A;  4IR9 A;  8ICG A;  1GO3 F;  3Q8K A;  1A6S A;  4Y2X A;  2IMW P;  1PK3 A;  5AI4 A;  3Q8R B;  2E1E A;  4BJQ A;  4PHP A;  3GQC A;  2E8M A;  2ZIW B;  3PSI A;  4BGD A;  4DS5 A;  4GF4 A;  1ZQM A;  1LV5 A;  1D8B A;  5DQI A;  1KTQ A;  1YS5 A;  4DQR A;  3QUB A;  4I2B A;  1HJP A;  3AA6 A;  4YQW A;  2WAQ F;  3EUB 2;  4F5Q A;  2LPE A;  4LZD A;  5AM2 A;  2F1J A;  4UAU A;  7ICR A;  3TAP A;  3RB6 A;  2XTQ A;  4RL9 A;  2UVV A;  2Q4T A;  3Q8S B;  5L1M A;  1L3T A;  4FBT A;  4Y2P A;  2AQ4 A;  1X9W A;  4YR3 A;  1QJ9 A;  4US8 A;  2EAO A;  2J6S A;  4PGX A;  3IHQ B;  5AI5 A;  3WKD A;  4GHB A;  2HSZ A;  3RB4 A;  3PGU A;  8ICP A;  3GV5 B;  4F4Z A;  2PI5 A;  4FOZ A;  2F1C X;  9ICK A;  5A0L A;  2W11 A;  2AJQ A;  9ICR A;  4O3Q A;  3PX0 A;  2LI6 A;  4AYE C;  1PZN A;  5KFP A;  1KQQ A;  8PRN A;  4E1S A;  4QZ8 A;  1YZ6 A;  3EMN X;  2OCE A;  1HXU A;  3A0B U;  2PFN A;  2HMX A;  3PO5 A;  2YML A;  2YMM A;  1ZHT A;  4QWE A;  4KLJ A;  1IG6 A;  4G9B A;  4QWB A;  8ICI A;  4I2E A;  3L5K A;  4N59 A;  3KKA A;  1T1L A;  3SD7 A;  2QAR B;  2RHF A;  3TAD A;  3MDC A;  3POU A;  9ICI A;  4PGY A;  3QUC A;  4O3N A;  2OWO A;  2N2L A;  4AKR B;  1SL1 A;  3N4M B;  1RYR A;  3TFS A;  2QB0 B;  2A1A A;  5J0W A;  5EE9 A;  2VJ5 A;  4D64 A;  4O9M A;  3N7P D;  4Y2V A;  4DL4 A;  5BPC A;  4ZOH C;  7ICS A;  8ICR A;  5AKL A;  5AKI A;  3A2S X;  1RQN A;  3Q8Q B;  4K4G A;  3A0B O;  2BPG A;  1KEJ A;  4M9N A;  4OJP A;  2R88 A;  1IZN B;  3TFR A;  2Y1J A;  3HIL A;  4NM2 A;  1HUZ A;  2KXP A;  4DO9 A;  4DSE A;  4C4V A;  2ZG6 A;  5KG7 A;  3KTQ A;  9ICE A;  2NV3 A;  7ICK A;  2JV3 A;  3WKE A;  3PR5 B;  4FRT A;  3HW8 A;  3BS0 A;  5AKG A;  4RQN A;  3PQU A;  3AA7 B;  2KIW A;  1F5S A;  5T14 A;  1RXV A;  2BCS A;  3VE1 A;  3BZC A;  2OM6 A;  3UPG A;  9ICH A;  5DL5 A;  4OJ5 A;  5AM4 A;  2G07 A;  1PVR A;  1NOM A;  4YR2 A;  4EX7 A;  2F3N A;  5ALF A;  2PFQ A;  3H8S A;  4UAS A;  4JMU A;  5AK6 A;  1L8O A;  3UMC A;  4QZE A;  2BZF A;  1ZQC A;  2W9C B;  5H2F U;  2KZ7 A;  2W03 A;  2ESE A;  2W04 A;  2EAM A;  2EDU A;  3UM9 A;  4UBB A;  8ICS A;  8ICA A;  4RT3 A;  5BOL A;  2HHW A;  5L9X A;  3IV6 A;  5FP0 A;  7ICL A;  2HBL A;  3V7J A;  3UAQ A;  2OEH A;  4B61 A;  4IRK A;  4C8N A;  5G39 A;  5HR7 A;  2KC0 A;  5KG5 A;  8ICE A;  5ALY A;  1S0N A;  2R8A A;  2YMP A;  2HBM A;  4PGQ A;  4YCX A;  1HXX A;  5L1I A;  4P4O A;  2MNH A;  2N2M A;  4KLD A;  4QWA A;  2JXJ A;  4F72 A;  4YMN A;  4RQ4 A;  3TKA A;  5J0P A;  5H2F O;  3SAH A;  4DFD A;  2LBO A;  2BHN A;  4Y2U A;  4RPZ A;  2WVP A;  4XQ8 A;  5KFK A;  1T16 A;  2ODJ A;  5ALV A;  2NRT A;  1WWU A;  1BNO A;  5AI0 A;  4B9M A;  1OUQ A;  1Q9F A;  5KFO A;  4BX9 C;  4QIW F;  2X9K A;  5GTI U;  5DG8 A;  4AYB C;  3TAN A;  5KFU A;  4RU9 A;  3BQ7 A;  3Q8M A;  4CF4 A;  1QQ6 A;  4YMM A;  2K4P A;  4FZM A;  3AL0 B;  4QJF B;  3PW7 A;  4F2R A;  2BQ3 A;  4Q8E A;  2F76 X;  3WU2 U;  4YFK A;  3HOE A;  4TQR A;  2Y0K A;  1P4T A;  5C5J A;  1NNL A;  1HIW A;  5DB6 A;  1ZQH A;  4RQM A;  4KLM A;  4Y2T A;  3RBH A;  4ELU A;  4PH5 A;  2ZIV A;  1SZP A;  1RXW A;  3BQT A;  4XRH A;  1UCV A;  9ICO A;  3NS1 A;  3JPP A;  1ZQW A;  4CCH A;  1MC8 A;  4G76 A;  4YN4 A;  5G5H A;  1ECW A;  1JIH A;  4USA A;  3B0X A;  3GFK B;  4O3P A;  1FO4 A;  1L7N A;  3WK6 A;  4E1T A;  4UB1 A;  4F5R A;  1NJZ A;  3IN5 A;  3VCB A;  2PXI A;  2C2E A;  5DGB A;  4DF4 A;  2XG6 A;  2BPF A;  4LSH A;  1WWV A;  1TK5 A;  9ICC A;  4C8M A;  3RB3 A;  5J0T A;  3QU5 A;  5DG9 A;  2C22 A;  2NRV A;  1RDF A;  3C29 A;  4EZ9 A;  4FZN A;  3D2Q A;  5AFU L;  3HKZ C;  4B9L A;  1TKD A;  4EBE A;  5B66 O;  2ES6 A;  2KKV A;  8ICW A;  5KFX A;  1BGX T;  4C00 A;  3CNH A;  3GP6 A;  4EEY A;  2J6U A;  1JAL A;  3N28 A;  3ETR A;  3QEB Z;  4CDG A;  5J2D A;  1ZHW A;  4F4B A;  5J2B A;  4NJ8 A;  4QIW C;  2C2D A;  4M04 A;  5DL6 A;  4P0P B;  3AQE A;  2WJQ A;  4DQS A;  1SZH A;  1L3V A;  2DPJ A;  2DPI A;  4UAT A;  4RQ5 A;  4I2A A;  3C5O A;  7ICP A;  2WF8 A;  5J0R A;  4M6W B;  4F50 A;  4I29 A;  5IIN A;  7ICV A;  4KLE A;  1SV0 C;  3OHB A;  5AIA A;  3DA3 A;  2F8K A;  5DQH A;  1D9D A;  4XNK A;  4JV0 A;  5DQG A;  4JUZ A;  3SZV A;  1MPF A;  3D2S A;  2MHL A;  3V8U A;  2KZ3 A;  2FMP A;  1NJY A;  1DRG A;  4XNL A;  4BXO A;  4QZH A;  4R8U B;  5DLF A;  2W55 A;  5ALM A;  1K5O A;  2K4H A;  4GXK A;  1ZJM A;  4FRX A;  2ISP A;  1BXW A;  3I28 A;  4PUX A;  3LK9 A;  4EYH B;  3NGD A;  5JDP A;  1TAU A;  2LM4 A;  5ALP A;  2MRL A;  4RQ6 A;  2ISO A;  3AAE A;  4DQQ A;  4RQ0 A;  1Q3V A;  3AAA A;  3QRA A;  1N61 A;  3H4B A;  1YT3 A;  2Y9U A;  4CTD A;  4NXZ A;  2LYA A;  2YN4 A;  1H6S 1;  5IIL A;  1Z00 A;  2VA8 A;  3O0F A;  4RLC A;  5IIM A;  5J0X A;  1T8E A;  8ICB A;  1UT5 A;  1DOQ A;  4ECW A;  1KRP A;  3H0L B;  5ALR A;  1X6I A;  3PX4 A; 
#chains in the Genus database with same CATH homology
 2ZLD A;  5ADX K;  1GFQ A;  2HOQ A;  1XO0 A;  3CRX A;  4O3X B;  2JHD A;  2DF4 B;  1GO3 F;  1A6S A;  3HOL A;  5DL8 A;  4O3Y A;  3AA0 B;  2E1E A;  3VY8 X;  2GE4 A;  2YB4 A;  4PL1 A;  4BJQ A;  2QTK A;  2ZIW B;  3PSI A;  1Z19 A;  3IP4 B;  4GF4 A;  2KDY A;  1D8B A;  1GFO A;  4PL2 A;  1Q9G A;  3M6Z A;  4FE3 A;  2KHQ A;  2XVT A;  1YS5 A;  2W7P A;  1MM5 A;  2HOF A;  2ZIU B;  3AA6 A;  4AYN A;  2D6F C;  3T20 A;  2WAQ F;  4LSF A;  4FZL A;  4JFB A;  2LHT A;  2XTR A;  3LK2 A;  3H0M B;  3QRC A;  1E54 A;  1PVP A;  3T79 A;  2XTQ A;  4RL9 A;  3NSG A;  2Q4T A;  2HBK A;  4OO1 J;  3HWB A;  1QJ9 A;  4FSO A;  5C0Y A;  2W81 C;  4GHB A;  4FES A;  4BUG A;  2JMM A;  2H3F A;  4FOZ A;  4GCQ A;  5A0L A;  2A3V A;  2XE5 A;  1WUD A;  3SAG A;  3LYS A;  4FUV A;  2XIC A;  2GH1 A;  1PRN A;  4AYE C;  8PRN A;  3PSF A;  3ONN A;  2ERV A;  5D5D A;  4E1S A;  2XE3 A;  3EMN X;  2YPV A;  3UU2 A;  1IZN A;  4D5U A;  3POX A;  1HXU A;  2HMX A;  4AZL A;  1Q3U A;  1ZHT A;  2OMF A;  3VZT X;  3LK3 B;  3M6K A;  4KR4 A;  3PST A;  4OJ6 A;  3VZU X;  3LK2 B;  1HXT A;  2FGQ X;  2ZXH A;  2YNK A;  4N59 A;  1OSM A;  2RHF A;  2KJ9 A;  3AA7 A;  3POU A;  3F2D A;  4NLC A;  2N1R A;  3PZP A;  4AKM A;  4P0Q B;  2N2L A;  4RJX A;  4AYI D;  2Z7J A;  2G5H B;  4AKR B;  3SZD A;  4GCP A;  2WB1 C;  2VJ5 A;  2PMZ C;  4D64 A;  3N7P D;  4GFJ A;  3RFA A;  2H3I A;  4AUI A;  4AYD C;  2POR A;  4NV0 A;  2K89 A;  4U6P A;  3DEE A;  3A2S X;  4JCH A;  2CRX A;  2M0N A;  6PRN A;  4CRX A;  1IIP A;  4OJP A;  3D2N A;  1IZN B;  2X27 X;  2KJ5 A;  1QJ8 A;  2KXP A;  3VY9 X;  3MGV A;  3VZW X;  4NLB A;  3WI4 A;  2ZG6 A;  2G5I B;  3G7G A;  2K4E A;  3FYX A;  4G75 A;  2VJ4 A;  2NV3 A;  2Y0H A;  4FRT A;  4CGZ A;  3PQU A;  2WB1 F;  3AAE B;  3AA7 B;  2K4I A;  2KIW A;  2PMZ F;  5T14 A;  2F1T A;  3AAA B;  3LK4 1;  4D65 A;  4IC9 A;  3AA1 A;  3VE1 A;  2OM6 A;  5HR6 A;  3UPG A;  5DL5 A;  3TZG A;  4OJ5 A;  2G07 A;  1PVR A;  3LK4 2;  3GU3 A;  4JMU A;  2LFU A;  2W80 C;  2BDU A;  1ZQ1 C;  1GFP A;  5GV0 A;  2KZ7 A;  2W03 A;  3NUQ A;  2W04 A;  3F2C A;  4FSP A;  1A0P A;  3O0E A;  1NZB A;  1GFN A;  4ICA A;  2R18 A;  1BT9 A;  3PSP A;  2HBL A;  2G09 A;  3VC8 A;  2JH1 A;  2K8B B;  3UAQ A;  2KEY A;  2KXP B;  5G26 A;  4B61 A;  4GCS A;  3L3F X;  5HR7 A;  4O49 A;  2KC0 A;  5DL7 A;  2KKP A;  1CRX A;  2OYY A;  1Z1B A;  2CPR A;  3SYB A;  2HBM A;  5EE2 A;  1XNS A;  2KD1 A;  2H3V A;  1HXX A;  3PQS A;  4OJL A;  3SY7 A;  3HW9 A;  5IYU A;  2MNH A;  7PRN A;  3M7D A;  2N2M A;  3AA6 B;  3AA1 B;  3WI5 A;  2OXO A;  4KX5 A;  4AYM C;  3NRW A;  1PHO A;  4N58 A;  2KJ8 A;  5AFU K;  2XID A;  3K19 A;  3SAH A;  2JGA A;  2LBO A;  2W7O A;  1URJ A;  3F53 A;  2ODJ A;  1ZHX A;  2KZ7 B;  2E1F A;  3AA0 A;  3KVD D;  2G0A A;  4FMS A;  1OUQ A;  1Q9F A;  4LSE A;  4KR8 A;  4BX9 C;  2Y0L A;  2K0L A;  4QIW F;  5CRX A;  3PRN A;  1THQ A;  2KVC A;  2XI9 A;  4AYB C;  2KHV A;  3CP8 A;  3F5E A;  4QNL A;  4O4U A;  2ZIU A;  2HBJ A;  1P7D A;  4FZM A;  3AL0 B;  4QJF B;  2F76 X;  3POQ A;  2LYB A;  2PRN A;  2F2A B;  2K8A A;  3HOE A;  2CN1 A;  2ZIX A;  3POR A;  2Y0K A;  1P4T A;  3JTY A;  4FT6 A;  5FVN A;  1GFM A;  1HIW A;  3RBH A;  4LSI A;  2ZIV A;  4P0P A;  3N7S C;  3LVV A;  3F5A A;  3K1Z A;  3C28 A;  3VE2 A;  3ALR A;  4A8E A;  4U7C A;  4O3M A;  4G76 A;  4C69 X;  1ECW A;  4AYB F;  3F2B A;  2KV2 A;  4E1T A;  1UPH A;  3IN5 A;  2Y0S C;  3KFU F;  4O3Z A;  2VKQ A;  3VCB A;  3T24 A;  5KL8 B;  3T0S A;  1HEK A;  1ZHZ A;  4KMO B;  2XG6 A;  4LSH A;  1OPF A;  1BH3 A;  3AQF A;  2KNJ A;  2ZFG A;  2RRD A;  2J1N A;  1QJP A;  3C29 A;  2KOB A;  3SQI A;  2YB1 A;  3LK3 A;  4FZN A;  3D2Q A;  5AFU L;  3GZF A;  3HKZ C;  4KX3 A;  4NWI A;  2J4U P;  4Z3T A;  4QQ1 A;  1L6N A;  2KKV A;  1PVQ A;  3E0F A;  3SYS A;  3SMV A;  3GP6 A;  2ZIX B;  4CDG A;  1ZHW A;  2ZXI A;  2DQN B;  3ICX A;  1G90 A;  4F4B A;  2H3Q A;  3OPX A;  2LHF A;  2Y0S F;  4P0Q A;  4QIW C;  4O4X A;  2XMX A;  5DL6 A;  2G08 A;  2ZIV B;  4P0P B;  4AKR A;  3AQE A;  4RJW A;  2DGZ A;  1SZH A;  1F44 A;  3N7R C;  3DA4 A;  3C5O A;  2H3Z A;  2Y7S A;  2MA1 A;  1MM4 A;  4O3W A;  2KIC A;  5KL1 B;  2VIX A;  3HKZ F;  2GOL A;  2O4V A;  2RP5 A;  4U9C A;  4XNK A;  2FGR A;  4KRA A;  4C0Z A;  2M06 A;  3SZV A;  1MPF A;  3D2S A;  3CYM A;  2MHL A;  3V8U A;  1MA7 A;  3H0R B;  2E5S A;  1T94 A;  1DRG A;  4XNL A;  4RLB A;  2XE1 A;  2OH2 A;  2XE2 A;  1KBU A;  5ADX L;  2K4H A;  2Y2X A;  4FRX A;  5PRN A;  2F77 X;  1BXW A;  2ZIW A;  2M07 A;  5T5F A;  4PUX A;  4WJ3 B;  5JDP A;  3IG5 A;  2G06 A;  2F1V A;  1ORM A;  3SY9 A;  2MRL A;  4AFK A;  3AAE A;  3RF9 A;  3KZX A;  3IG8 A;  1Q3V A;  3AAA A;  3QRA A;  1ZHY A;  1TAM A;  2HOI A;  4OJO A;  4BUM X;  1YT3 A;  4ACO A;  2LYA A;  1H6S 1;  3SAF A;  2F8L A;  2JH7 A;  3O0F A;  2LKY A;  4RLC A;  3LVW A;  2K8C B;  1ED1 A;  2YX8 A;  3H0L B;  2K4T A;  2JMG A;  2WAQ C;  3DA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...