4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
molecule tags Hydrolase
molecule keywords Pectocin M2
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
1XLOA 2EKIA 5C2TB 3NS1A 1E7PB 2W55A 4US8A 2XTQA 2XTRA 2MH7A 4YSYB 5C3JB 4G75A 1N60A 1ZUD2 3AEEB 2H89B 1A70A 4HRSA 1E9MA 3SR6A 1OQQA 1OQRA 3DA3A 4FZNA 3AE4B 3EUB2 1ZOYB 3VRAB 1L0VB 4HROA 2Y5CA 1IUEA 1E10A 5G5GA 1NYRA 3DWMA 1N62A 1WGKA 2MJDA 1SF0A 1QOAA 1SB3C 2BS3B 1FMAD 2K9XA 2LEKA 3DWGC 4A9AA 3ABVB 1PUTA 1N5XA 3AE6B 3WCQA 1CJEA 4JWSC 1EWYC 1FIQA 4ITKA 5AUIA 1FM0D 2BS2B 1R7SA 1J7BA 3NVWA 4ZHPA 4FXCA 2WDRB 1FFVA 1V8CA 3AEAB 1NI3A 1ROEA 1NVID 4WWMA 2G1EA 3AECB 1ZXIA 1E0ZA 1B9RA 3LXFA 2W3SA 1JROA 1UWMA 3P63A 1L6UA 1WXQA 3NRZA 3FC4A 1N63A 4YTNB 1FO4A 3KWLA 1GAQB 3AH7A 3AEGB 1FXIA 3AE8B 4US9A 1JWAD 1JALA 3BIID 3HUIA 3AE7B 4FZLA 4C7ZA 1QOFA 2Q5WD 4FZMA 3LB8C 5EE0A 2BT6A 5GXGB 4YTPB 5EE9A 3W5UB 2PIAA 3DA4A 4YT0B 3B2GA 3B2FA 1QOGA 1QLBB 1YJJA 3AEBB 3L4PA 1E6EB 1N5WA 1XLNA 1YQ4B 1N61A 3AMZA 3AEFB 1PFDA 3P4QB 2CJOA 1I7HA 2BS4B 3P4PB 2JQRB 2QJLA 3P4SB 4WQMA 4YSXB 1PDXA 4P6VF 3VR9B 1TKYA 1TKGA 1FRRA 2W54A 4N6EB 1DOIA 1WYGA 1GPXA 3AE3B 2CU3A 1RM6C 2DWQA 1J7CA 3AB5A 1KRHA 1DOYA 4YXDB 2B76B 2K5PA 2WU5B 1SIJA 3AEDB 3NVYA 4JWUC 2W3RA 1V97A 4G76A 2FBWB 2HTME 1TKEA 2H88B 1YJIA 2KAJA 1J7AA 2N0SB 3VRBB 1OFFA 1QOBA 2WLBA 2MJ3A 1RFKA 1VDVA 3B9JA 4JX1C 2CJNA 4C80A 2OHFA 1QF6A 3AN1A 3RPFC 2AX5A 1CZPA 2M19A 1WWTA 3W9CB 2PKOA 4ZOHC 3CIRB 2K22A 4N59A 5H92C 3VR8B 2WU2B 1KFYB 5G5HA 1TJEA 4IDIA 1F0ZA 2ACZB 3AE5B 1AWDA 2E3TA 2WS3B 3AE2B 1FFUA 3AE1B 3PO0A 2MJEA 3P4RB 1VLBA 2WDQB 1NENB 1XLPA 3ETRA 2JX5A 1DGJA 2QIEB 1L6VA 1JQ4A 1FRDA 2WDVB 3SFEB 5MPOA 2KMMA 1L5PA 2L52A 3NVZA 1QT9A 1YQ3B 3AE9B 1NEKB 3FAHA 4USAA 3AM9A 3SFDB 3HRDD 1T3QA 2DBYA 1VJKA 2L83A 2XMXA 4N58A 3CWIA 5EE1A 3P1MA 4YTMB 5H8YE 1TYGB 1JWBD 1JW9D 2M56B 5AUKA 1ZP0B 3NVVA 1FXAA 1DOXA 3HVZA 1XLQA 3AV8A 3W5VB 4LTUA 1RWSA 1AYFA 4YSZB 1KF6B 1JRPA 1XO3A 5EE3A 1RYJA 4ZHOA 4C7YA 2WP9B 2PVOD 2WQYB 4KX6B 1NYQA 3ZYYX 2PVGC 1WRIA
chains in the Genus database with same CATH superfamily
4FRXA 1OPFA 3AAAA 4BVUC 1ZHTA 1QJ8A 4HKQA 3AAEB 4KZCA 1K8RB 1OQRA 1SE4A 2LFUA 4PUXA 2WWZA 5DPRA 5FR6A 5JZEB 2KJRA 2C9WB 4XDDA 4ACFA 4AUIA 5HHDG 3O65B 3ZJVA 3TBLD 1PUTA 4GDKB 4HCNB 3H1UA 4C69X 1WZ0A 2EELA 3A9KA 2MSED 1GUAB 1NVID 5TR5A 2QSDA 1WXQA 4IL6O 2IGGA 2J53A 2J4UP 2JYTA 2Y7SA 3ZNID 5GTHO 2KFJA 2BF8B 3C0RB 2JVCA 3BIID 3IXSA 2HTHA 4FZLA 4C7ZA 1K52A 5DL5A 1OQYA 4O3YA 2HD5B 5AFUL 2CHZA 4FJZA 4F1SA 4RFBA 2CHWA 3AAEA 1GFOA 4NQLB 2KNBA 3Q3OC 3W1YA 1YX6B 1GPXA 2KVZA 2K1FA 3PHWB 3LYYA 3RMKC 4TUUA 3UIPB 3AAAB 3CSTA 2KLGA 3RNAC 4XE0A 1WJNA 1C9FA 1HXUA 4N59A 3NOBA 2DYBA 3PSEB 1F0ZA 3ZNZB 3ZVVA 4MSQB 4FULA 4ANXA 2F1VA 1V81A 4WWOA 3QIJA 2OMFA 2KWCA 1RAXA 2L52A 3VUXA 4MSMB 3R8BA 2DZJA 1JWBD 1JW9D 3HK0A 3AA6B 2KQ7A 3Q3NC 2PVOD 3W5UB 1MM4A 4OZBA 3N3KB 4TV3A 1GB4A 2KXPA 3SY9A 1C78A 2DZMA 4FMSA 3SEBA 2KMCA 1L0XB 2X9KA 1L0VB 2OJRA 3IT6B 3B0AA 4EZKA 1YIWA 2WXHA 3NG0A 5G39A 2MP2A 2BBCA 3UIOB 4DXGA 4FXCA 3GP7A 1P3QU 3HW9A 2V1YA 3ZNHB 4KDIC 2LXCA 1SXTA 1N63A 4YTNB 1NI2A 3KWLA 2VH1A 1FXIA 4GIVA 4MH8A 4AJWA 4B95A 4O3WA 5GXGB 3VHTC 3RCZA 4F8CB 3Q14C 3ZO5B 1H4RA 3FILB 4FHJA 4W9EA 2ZFGA 4QQ1A 1QZEA 1E8WA 1PDXA 1DOIA 2VH2A 1L2NA 1TGZB 1DOYA 3NVYA 2Z59B 2VZKD 2KXPB 2R4LA 2R88A 2M19A 2RDGA 4ANVA 3P42A 2WS3B 1NBFC 1IP9A 4FHKA 1IGCA 4M02A 4K3BA 2JUOA 1V1OA 3HRDD 1T3QA 2DBYA 3RNFC 3CWIA 2KKCA 5H8YE 2PE6B 1UF0A 1P0RA 2DENB 3IG3A 4IM0A 1YN3A 4C7YA 1IBXB 2I38A 1VZ6A 3KLSX 4A20A 4PJ0O 1HEZE 3V61A 5CHVC 4PK1A 3KYDD 4KKJA 1E9MA 5GTIO 3DWOX 4MJSA 3A9JB 2Y5CA 3ENEA 2KC0A 3ZLZA 3DWMA 2BS3B 1WJUA 4A9AA 1FMAD 2IZVB 4HLEA 1N5XA 3DQVA 3HIZA 2GI9A 5BYQA 4DBGA 2ASQA 3NSGA 1EU4A 3AEAB 3BVZA 1L6UA 3DBSA 2N2MA 1WXVA 4AYNA 4P7IA 2X38A 1JALA 1KM7A 1XCQL 1TZOA 4BKTA 4E3CA 3WU2O 2KDFB 3LB8C 2C7NB 2VRRB 1HZ5A 3DVGX 2K0LA 3Q8EA 1IZNA 2PW9A 2LGXA 1E6EB 2HE7A 1YQ4B 4C56C 1QJPA 4HDQA 2MBQA 5C23A 2F1CX 3OG5A 2QJLA 5KAIO 4KGRA 3I63C 4PR7A 4CYEA 2O6VA 4ZRQA 2WGSA 3RULA 3PORA 1YN4A 2NBWB 5AEKB 3BK2A 4RH6A 2LXAA 4O3ZA 3IFWB 4I6PA 3VUYA 2QEJC 5IA7A 2K22A 3VVWB 1UNSA 1S5LO 1D6EC 2E3TA 2IJ0A 3TEYA 2V3NA 1FRDA 1YS5A 4BAXA 1R4MI 1Y56A 2J0KA 1F2RI 2L0FA 4X57B 2V4LA 2MCNB 2W9NA 1VJKA 4RJXA 2BYFA 4GU2A 4MM3B 4MT5A 2J52A 2C5LC 2L8JA 4K3CA 1JMLA 4DXAB 2JZPA 5D6JB 1JCKB 4GGQA 1I4HA 3W1SC 2KX0A 1MG4A 4KV2A 3PGUA 2JZ3B 3CMMB 2RGFA 5DPWA 2JXXA 1ORMA 3PT2B 4PYUA 1F1HA 2D3GA 2IY1B 2D5GA 2LASA 3BZDB 3TCAA 5EDSA 1ZDVA 1WGKA 4REZA 1SF0A 4HKZE 4O49A 1EWYC 3LK2A 3WAPA 2IO0B 1FM0D 2N7DA 4BFRA 2PJHA 4E1SA 3A1QB 2DHZA 2FUHB 2ZPYA 3NRZA 4DK5A 4GN1A 4DWFA 5G2NA 1FO4A 3R2TA 5J17A 3CSFA 2J7QB 1CMXB 5LXHA 3AE7B 2CS4A 4W9JA 1TS3A 4JLCA 2LHDA 2PTLA 1VR9A 4GMVA 3U7DA 1HE8A 3B08A 3QC8B 3IT4B 4P16A 1D3ZA 3PGSA 4HEA1 3VR9B 2JRHA 3V6CB 2FAZA 4JE3B 2BYTA 3NZ3A 2F1TA 4O3XB 2KTRB 3M95A 2OEDA 4JFBA 5EE2A 1Q5WB 1QOBA 2MJ3A 4EUTA 3ZXRA 1FPYA 4RLCA 3AA7A 3VR8B 2WXMA 1E8ZA 2MJEA 1VLBA 3A1QA 2INDC 4WIPA 2R8AA 4N74A 4JL9A 2Y2XA 1Q1OA 2KT7A 1CK1A 3C8YA 4AYDC 1EM7A 2KDIA 3AU5A 1WM3A 3ZXVA 1WIAA 2ONQA 4M01A 2LVQA 3CF6E 2MW5A 4NPNA 2EKIA 2MA9B 2IWWA 1TBEA 5C3JB 3SHQA 1GNUA 3RNEC 5ADXL 1TY0A 3BVGA 2N9XA 3MC0B 1N62A 4ARCA 3AA7B 3KWVA 5IAAC 3TSSA 4LSEA 3SYBA 3JTYA 1T6BX 1I4GA 1TS5A 2AQ1B 3U52E 3POQA 1V1PB 2WXOA 3UQAA 3AE8B 3R66C 2X8XX 3VE1A 1ZGUB 3Q3FA 1P1AA 1G6JA 2KWDA 2G4DB 1WGDA 3B1LX 1N61A 2CJOA 2Y0KA 3RZFA 2BS4B 2KDBA 4FBJB 4RM8A 4ZYNA 1FRRA 1WYGA 4LLGM 3V8UA 2DWQA 3PRPB 4KR8A 2N9EB 2WU5B 1EO6A 2LGSA 4FA6A 2K6DB 4FT6A 2WLBA 3BYYB 4OVZA 3P2BA 4HPLB 4IM2A 1WWTA 2YVCA 1C3TA 2V4IB 1F77A 2EMTA 3NS8A 4FRTA 3AE5B 2WX0A 3H8HA 1KOTA 2JX5A 4KSLC 3DDCB 4W9DA 4KSKC 2DYOA 4ICVA 2WNMA 2KVRA 4GF4A 3KVDD 4CQNA 3U30A 3NUHB 1R4NI 1T0YA 3MC9A 4MH0E 2WP9B 3ZDMC 1NYQA 3VRBB 1WRIA 2XTRA 3PZDA 3JCUO 4ARIA 1FNVA 2LGDA 3VTUA 2IBIB 2N9PC 1E90A 3EUB2 1ZOYB 3R3MA 1BXWA 2K25A 3I57A 5ADXK 4B0MA 3H9DA 3VH3B 4WJOA 3KUDB 1WY8A 2NMQA 4LJOB 1WF9A 3POUA 4WWMA 2J42A 2Y5BB 3LXFA 2W3SA 2CR5A 4A3OA 2MLBA 1WX9A 1WH3A 1KLVA 4W9IA 1XQQA 2DX5B 3PLVA 4S17A 1XT9B 4Z3TA 1JWAD 1C4CA 4D65A 2N4FA 4FZMA 2BT6A 4FSOA 2PPHA 2GBKA 4YTPB 5AZHA 4TQ1A 1C76A 1WXSA 1YJJA 4ZRIA 1P98A 3KZIO 3PRNA 3MHSD 1GFMA 2L76A 5IN7A 2RDHA 4WWNA 1J7CA 4YXDB 4DHZE 2KHWB 2RD0A 1TKEA 1J7AA 4FJVB 4OVUA 3EHVA 1VZ8A 4G3XB 5D3IB 1QF6A 3NHEB 3ML9A 3C19A 2GRIA 4TSSA 1Q9FA 4FUVA 5DCNA 5G3AA 2BGFA 4AYID 3Q8FA 1BUIC 1L6VA 4NAWA 1JQ4A 3T24A 2JF5A 3ZJUA 2KLCA 2AL6A 5FKAC 4TQ0A 1RRBA 2KQ4X 2IO3B 4F4BA 3BWUD 3NJTA 3LK3A 2JWZA 2GBJA 4LTUA 2WXKA 4OVVA 2IYDB 2ZJDA 1WRDB 1X1MA 3A2SX 3Q8AA 3V62A 4YSYB 2D3CA 4G75A 1ZUD2 2WXFA 4XWWA 2N9KA 2YEPF 4P1BC 3AA0B 1E8YA 5T8IA 4LSFA 4OHJA 3VTWA 3FKYA 2YPVA 3TJPA 3DWGC 4F7ZA 3AA1B 3AE6B 3DVNV 3WCQA 1CJEA 2R2QA 2XN9C 5JDPA 2REXA 2WX1A 3GS2A 3EMNX 1K53A 2LJ5A 5DL6A 2PE9A 2ZCCA 3AH7A 2RPQA 2HJ1A 1THQA 2AQ3B 1ZW7A 1YJ1A 3DBRB 3QA8A 2FIDA 1WZ3A 3TEXA 3VUWA 2MNHA 1XLNA 5BMHA 1ZKHA 1ZXHA 4XNKA 4YSXB 2Y0LA 2W54A 3LK3B 4LNKA 3EFUA 2WXGA 2K8HA 2MQJA 2MBEA 1SIJA 4JPSA 2C7HA 2LJIA 1V97A 3EECA 2GMIC 4Q2JA 4PS3A 1KH0A 3M62B 4KDLB 4NAWB 4PS7A 2DZIA 2I1JA 2BTEA 5D5DA 1TJEA 4IDIA 1FCLA 2KD0A 3A9JA 3A9KB 4AOFA 1YN5A 2A5UA 1R4MB 4J3OD 2G4SA 4IWOA 1U4AA 5I4DA 5L83A 4USAA 4AQ7A 1IGDA 2R4NA 2IPKD 3ZKJC 1IBXA 4N58A 4YTMB 2RMMA 2NBVB 2D3BA 1DOXA 3HVZA 2UWQA 3AV8A 1F2RC 1SEBD 1RWSA 1XO3A 4NZLB 1WGRA 4ZHOA 3MJ5A 2KC2A 2WQYB 2K8BA 4LK0M 3MJWA 2WJRA 3NS1A 3L16A 4O4XA 3HWBA 3AEEB 2QCZA 3KH0A 1AN8A 3WANA 1MFWA 4MGZE 3Q8BA 1GG3A 2XNAC 4A90A 3ML8A 3AA0A 4ANWA 2WYQA 2DAFA 2SAKA 5D2MB 4EKUA 4WWPA 5TSSA 3QHTA 3DZMA 3A0HO 2JRIB 1LQBA 4ZRPA 3PTFC 4ITKA 4LDTD 1EF1A 2V9HA 1QKZA 4RGMA 2WXQA 3L17A 3RBHA 4W9CA 1MG8A 5B66O 4CHKA 4IUMB 1ENFA 1OGWA 5IKCM 1JWUD 4BKSA 2EMSA 3L08A 3HHMA 3RNGC 2L3ZA 1HTQA 4CTDA 1MHHE 2DNFA 4IM3A 3M63B 1S3SG 4TMAB 2JU6X 2UU7A 1QLBB 3APFA 1M94A 1BT9A 4HCPB 3AEFB 4WQMA 3MP9A 3VZWX 4AWJA 2RSUA 3BINA 4UB8O 2ZW1A 1FXTB 4M0WA 4JWUC 2O6VD 3ZRFA 4N75A 2W3RA 2FUG1 2G3QB 2WXLA 1RFKA 4EZLA 3Q2AC 1TY2A 3AN1A 4G0NB 1F9JA 8PRNA 2OOBB 5GMVA 1GB1A 2WU2B 1UUPA 2MRPA 4M00A 4M8MA 5BYSA 3PO0A 3AE2B 4LJPB 1OTRB 3OJ3A 3VZTX 4WQOB 2AXTO 2NS5A 4EZJA 3SZDA 3O13A 3AE9B 4XGAB 1WI0A 1TS2A 2XMXA 3DBLI 3VXWA 1WMHA 1TYGB 4RF0A 4D5UA 5E6NA 1V5OA 1RLFA 4DXFA 3T3NA 2I2YA 2Z0EB 2JSVX 1OEYJ 1D5XC 3IVFA 1P4TA 2NVUI 2XK5B 4PT5A 4LSHA 5G5GA 2BQQA 2PVGC 1WYWB 1XLOA 4KIKA 1LXDA 1Z5SB 3UGBB 1EU3A 4LCDE 1WJ6A 1N60A 2KANA 2WXIA 3DA3A 4FZNA 2N1WA 1E10A 1TT5B 2YNKA 3TUOA 4E74A 4HK2A 3SZVA 4AZLA 2BS2B 4D2KA 1V8CA 1ROEA 4KKIA 3AECB 1OEYA 1JROA 1VZ7A 4GSWA 3FC4A 3C5OA 4K7WA 1GAQB 5DPSA 4G50A 4GHBA 3PF1A 2Q5WD 2IWVA 4W9KA 5EE9A 3Q8CA 4ZYSA 2V0GA 2CHXA 4IW0A 4KZ0A 3B2GA 3DWNA 2N9LA 1QOGA 3ALBA 2I1KA 1N5WA 2R4PA 5AZGA 3PZ7A 2GE4A 5KHQA 1MPFA 3QQ8B 2KYWA 3AE3B 3TZGA 3HM3A 5DL8A 1RM6C 3FILA 2LUMA 1E5WA 4KGSA 4MEMA 1L0YB 1PGAA 2H88B 1YJIA 1P7FA 3M3JA 2OHFA 2GB1A 1FNUA 2FIFA 3PRZA 1UBQA 3KVFB 3R7QA 5JXVA 2JMMA 4WH4A 2MX2A 4II2B 2XEWA 5CHFA 3HVDA 3X23A 2R61A 1E7UA 3ETRA 4B0EA 2FE8A 5HKHA 2LUEA 2LWPA 2FGRA 2WDVB 4A3PA 2KFKB 2KMMA 3VH4B 4DQOC 2W80C 4GLSC 1H6S1 1I42A 2KJHB 3PPAA 3P1MA 2HJ8A 3MFGA 1ZP0B 1I4PA 1FXAA 5EE3A 2N7EA 1RYJA 1HTOA 3JSVA 3ZIMA 5J18A 4MM3A 3ECIA 3AULA 4RGTA 3ZJTA 1LM8B 3AI5A 4KR4A 1S1QB 2ZLDA 1J19A 4HRSA 4HPPA 4WAAA 2BYEA 4AUQC 4EOYA 4GDLB 3ONSA 1WGYA 1TS4A 2KN5A 3V60A 2Y5PA 4I6NB 5J2RA 3A0BO 3AA1A 1ZPSA 1FIQA 3LJ3A 3RN9C 1R7SA 2M4NA 4KRAA 3VFKA 3ZNGC 3EFCA 1B9RA 4RLBA 3LDZE 1TTNA 3ZTCA 3W1SA 3AEGB 3BS0A 3GZNB 2KACA 3MTNB 3ZQ4A 3PLUA 3I5JC 3VDZA 2PIAA 3B2FA 3ZGZA 1GFNA 3DHIC 3AMZA 2XBBC 2Y3AA 5D94A 2C60A 4GDLA 5JHBA 1TKGA 2INPE 3OWEB 1M4VA 1WE6A 1T0SC 4K1RB 2KMAA 3DVNU 2FBWB 2N0SB 4J6IA 2GLSA 1XF5L 5KAFO 2CJNA 3QJZA 4HDOA 1Y8RC 5B5EO 3H6NA 1P9DU 5H92C 2M1MA 2N7JA 2TSSA 3IBEA 2MBBB 3UAQA 1FFUA 1D5MC 1JWSD 2L00B 5HFYA 1ISNA 3BRZA 3P4RB 3GE8C 1EUVB 2GOWA 2QIEB 3RUIB 3APCA 3PZ8A 4ANUA 4FESA 1ET9A 1HZ6A 4C4VB 4G11A 1XLQA 4HJGE 3U7ZA 1FD6A 2FCNA 1C79A 4K81A 4KX6B 3ZYYX 4TKNA 2ERVA 3UQBA 5FR3A 1SE2A 4RNAA 5C1ZA 4GCPA 3G7GA 2UYZB 4IWQA 3URYA 2H89B 4BBNF 1LO5D 3WAOA 2BVCA 2L05A 3JW0X 5JHAA 1PRNA 1WX8A 4XX5A 5E6JA 3QWZB 2INCC 3FYXA 3H7PA 3Q69A 3VRAB 3TEWA 4ZRKA 4E1TA 5IO9A 4XDCA 3PGEA 2BW2A 4AP4C 4W9GA 4NQKE 2OJWA 4FQEA 4YWGG 3V05A 2LMCA 3UI3A 3UINB 2WDRB 2G1EA 4PYZA 2QHOA 1WGHA 1C1YB 2NCNA 1WR1A 4RJWA 1SBBB 3BY4B 2ZCBA 4HVBA 4AFKA 2IY0B 4US9A 3SDLC 1QQRA 4IG7B 2M0AA 4YL8A 2JY6A 3DA4A 3PHXB 1BMLC 3L4PA 4KIKB 1UELA 1WJ4A 3GZNI 2JQRB 1L4DB 1C4PA 2KDEB 3Q3JA 3PRMB 1ACCA 3HOLA 2CU3A 3JYUA 3AB5A 3GOEA 1PQSA 2FCQA 3DOWA 2NPTA 4WJNA 3ZRCA 3QARA 3KQ4A 2PKOA 2N2LA 2A4ZA 1HXYD 5G5HA 5PRNA 1AWDA 2G9HD 2M07A 4WJQA 3TL5A 2IO1B 1TZ1A 2J4XA 3MHZA 2FCSA 2BPSA 3DBHB 2V3PA 3JVZX 4BZAA 3KUCB 3FAHA 1D4BA 2IGHA 3WI4A 1WR6E 3R7RA 3VY9X 5G26A 2LVPA 2N1VA 1B1ZA 1AYFA 1KF6B 4H2AA 5BMGA 2KZRA 4DDID 4B61A 3K19A 2HDEA 2W55A 1YD8U 2KC1A 1L4ZB 1GOZA 4NJCA 5DL7A 2LGIA 1WXMA 2G45B 2V3SA 3UU2A 1V80A 1LGRA 1Q10A 1ET6A 3RNCC 4HROA 4AYMC 1N6ZA 2PLPA 3Q6BA 2RR9A 2Y0HA 1V86A 2WVPA 4QAYA 2WDTB 1ZHYA 2MJDA 5G55A 2KWUB 2ZZPB 5AZFA 1NDDA 1J7BA 3N32A 3VY8X 4MGYE 5D7GA 2K8CA 4BOZB 3DVGY 4JCHA 1QJ9A 4HXDA 2ZVOA 1F52A 2KWVB 4A55A 2R2OA 1A5RA 4K7UA 2AEHA 5CTRC 2CU1A 1HQRD 2LVOA 1MM5A 1MI0A 1QOFA 3WI5A 2ZNVB 1T0RC 1EWCA 3IHPC 1WFYA 2O2VB 4RGOS 4ZRJA 3WA0A 3D32A 2JXTA 3AEDB 1PHOA 1E54A 2NBUA 3TMPB 2BB5A 2O4VA 1VDVA 1T0QC 4FLHA 2JT4B 4EFOA 2GBNA 3CIRB 1SIFA 1V1PA 4W9FA 1PYWD 5LNK1 4FJYA 4NNJB 1FCCC 3OAWA 4E71A 4DHZB 1ZDXA 1QILA 1DYQA 4BOSC 2KO3A 1L5PA 4XZ4A 1YQ3B 1WE7A 1NEKB 4JQWC 3T9LA 1Q0WB 5G38A 3L0WB 3MC8A 2WXRA 3RFZB 1WXAA 2EKEC 2O2VA 4O1NA 5FVNA 7PRNA 1JRPA 2R4OA 3RT3B 3QX1A 2ZEQA 2M8SA 2JWUA 4L1BA 3V6EB 2LFIA 4D64A 5C2TB 3PREA 5HG2A 3OLMD 5IOIA 2KDYA 2ZW0A 2MBOA 4W9LA 4K7SA 4HWIB 1I4XA 2W81C 4AYEC 1IUEA 4IKGA 1L7YA 4LNFA 2BKFA 2KZ7A 1UGJA 1I4RA 3O0EA 1HXTA 1OSMA 4MJSB 3PQSA 1WGGA 3NVWA 1LFDA 2KX3A 1G90A 3Q3MC 2WXNA 1ZXIA 2KFKA 2KJ6A 2MHJA 1D5ZC 4RCOA 3JSVB 2D11A 3QRAA 4BUMX 2WHIA 3HUIA 3BYTB 4LSIA 2LZ6A 3E9SA 1GJZA 1V49A 3N30A 4M0WB 2ON8A 3UPGA 1I7HA 1STEA 2L32A 3P4SB 6PRNA 2PRNA 4A8XC 2QDFA 2WXJA 2XE3A 1PGBA 3RI7C 1IPGA 2M17A 4RMAA 2ZNVC 1GC7A 2FNJB 3PVLA 2FGQX 1SSNA 3ZDTA 4GCQA 4LNIA 3W2DA 2KAJA 3ZUNA 2DZKA 3APDA 3B9JA 1TIFA 4C80A 3A4RA 1YNTE 2K39A 4MGIE 1XXGA 4FOZA 2YLMA 4GOCA 5D3DA 2PORA 3VQIA 4XYCA 1HXXA 3AE1B 2KOXA 1UD7A 1MPEA 3EGRA 3PS6A 2DAJA 1AARA 1NENB 2C7MB 3A4SC 5MPOA 2CKHB 2E6XA 3UF8A 2MP2B 3L54A 1Q9GA 2NTTA 3N1YC 3NVZA 4IOIE 1GC6A 3AM9A 2JPHA 2XK5A 5JH5C 5CX3A 4URKA 2KXJA 3LK41 1SE3A 2M56B 3TIXA 3NVVA 5LLIA 5GV0A 3IAM1 2WJQA 1K50A 3RZWC 5CHWA 4ICUA 3T20A 3QAQA 1E7PB 2W82A 4NJ7A 3VAWA 2MWSB 1JRUA 2KZ7B 1A70A 1RFAA 3E56A 2LGYA 3AE4B 2QC8A 1YX5B 3H7PB 1C77A 2GBRA 2AWTA 2LEKA 1SB3C 2QILA 3ABVB 5IP4D 4AKRA 5AUIA 1I35A 1FEHA 5KHOA 3SYSA 1MJDA 1UBIA 3RYTA 1VD2A 5IYUA 4XWTA 3ZW3A 2LRWA 1YMHE 2L1AA 4UDUC 3A33B 2FCMA 1WMHB 3NY5A 5TISO 3AA6A 4RF1A 3QK0A 2MHLA 3PQUA 4YT0B 1IZNB 5BYRA 3WAMA 2QTKA 2DLBA 2KTRA 4XC2A 1WSPA 3P4PB 2J1NA 2AYOB 4KVGB 4P6VF 2LI5A 1WM2A 3L10B 5HI1A 1MHXA 2B76B 2ZVNA 4OW0A 4G76A 4AKRB 1YOVB 3POXA 4RGNA 2ZPNA 5DPTA 4JX1C 2D2QA 3S2AA 1T5XD 2AX5A 1CZPA 3DHHC 4JGHB 4NY0A 2NPTB 3RPFC 4C00A 2J0MA 4ZOHC 3N9YC 3U4EG 3HM6X 3RNBC 1E8XA 1VRAB 4ASWC 2AL3A 2DYMA 4GXBA 2WDQB 2MBHA 1GFQA 1Z2MA 2RPVA 3QCAA 4CO7A 4LNNA 4MELA 4MGKE 2SEBD 2JYEA 1YQBA 3H7SA 5AUKA 4O4UA 4C4VA 2O6VB 2L7RA 5E79O 3VE2A 4R3DA 4MACA 2BKRB 2L0TA 4US8A 2XTQA 4AKMA 3PV1A 2MH7A 4ZDVA 3DBRI 1UZXB 1ZE3D 3SR6A 5LXIB 3V3XA 2LRUA 1BH3A 2K4TA 2XE1A 3R2IA 2B3AA 1ZHWA 4LNOA 1T16A 1NYRA 2VZKB 2KQSA 1WX7A 2K9XA 1FNWA 2BWES 4JIOU 2M06A 3VZUX 4JWSC 3TEZA 3KYCD 4U9CA 2IGDA 4FSPA 3EC8A 1FFVA 1IYFA 1NI3A 2K3UA 4L2YA 3P63A 1UWMA 4LDTB 2IO2B 2NR2A 4GDKA 1MVKA 1XD3B 4EEWA 3DCGA 2Z0DB 2QMTA 3ZTDA 1GFPA 1KLGD 5EE0A 1V6EA 3T0SA 1T1LA 4II3B 3EA6A 3L13A 3KUZA 3P4QB 2XE2A 1VCBA 1AW7A 1SGHA 3AXCA 1JWMD 1KRHA 3SY7A 1ESFA 4DHJD 1KJTA 3HOEA 1I4QA 3KW5B 4B9KA 4HPMB 3GE3C 1C4AA 3T3OA 2Z8LA 1E7VA 1KFYB 3DBLB 1J8CA 4WURA 5FK9C 3IAS1 3N20C 5E6PA 2NTSA 1DGJA 3DBHI 2XE5A 1EF5A 1UGMA 4BBNC 4XNLA 3LK42 2IDYA 4GB9A 3SFDB 1K51A 4UB6O 2L83A 2LHFA 4HJKA 4NJ6A 4WJPA 4MDKE 4L23A 3RD2A 5H2FO 3W5VB 1BXTA 3I3TB 2JQYA 1H8CA 2JZZA 2RDBC 4RM9A 1XCTL 5AFUK 4P1CC 5T5FA 1V2YA 2J0JA 4NAMA 3VTVA 1P7EA 2KTFA 4KGTA 1OQQA 2BYVE 2X27X 4IC7B 4OZAA 5BO4B 2INNE 1R4NB 3N1ZC 4WAFA 3WIMA 3NZSA 1J0GA 3U8ZA 1QOAA 1SJHD 1V9JA 3DHGC 2K6QA 1HA5A 3T8MA 4B6WA 2ICIA 1XEEA 3LK2B 4ZHPA 4A6QA 4S0RA 1SJED 2YEPB 4W9HA 1E0ZA 3DPDA 5E6OA 2BB6A 1UWXA 1UH6A 2KDMA 2GBMA 2MEKA 3BVMA 1ZHXA 4BKSD 3N1XC 3OJ4B 1V5TA 3WALA 2D10A 1KTKA 1SE9A 3AEBB 3I9V1 2KK8A 1PFDA 2WXPA 4OZCA 1BT0A 3GB1A 4AJYB 4I6LB 3NZUA 3GP6A 3U2SC 4DDGD 1TKYA 4N6EB 4FADA 2R89A 1ZHZA 2XG6A 1PGXA 2K5PA 2AQ2B 2HTME 3X0WA 1OFFA 1CQVA 3PGRA 2BWFA 3K9PB 5BMIA 3QRCA 4DHJB 4N9F4 3W9CB 4RL9A 3J9CA 2ACZB 3BRYA 3SD5A 2M0XA 3K9OB 4EE2A 4GCSA 3BK1A 4AS1A 2ODJA 1XLPA 2KN4A 3SFEB 2LHEA 1QT9A 2K0PA 1KLUD 5L95C 4PS8A 5EE1A 4BKGA 3AU4A 4FN2A 2PMVA 4M8NA 3SU8X 2D3AA 4YSZB 2D07B 4IWPA 2LD9A 2PEAA
chains in the Genus database with same CATH topology
1XLOA 4FRXA 2EKIA 2LFIA 4D64A 4L1BA 5C2TB 1EU3A 1OPFA 3AAAA 5C3JB 1ZHTA 1N60A 1QJ8A 4HKQA 3AAEB 2WXIA 5HG2A 2KDYA 2ZW0A 5ADXL 1OQRA 1TY0A 3BVGA 3DA3A 2W81C 4FZNA 4AYEC 1I4XA 1SE4A 2LFUA 4PUXA 1IUEA 1E10A 4IKGA 2YNKA 3TUOA 3MC0B 1N62A 4XDDA 2KZ7A 4ARCA 4AUIA 1UGJA 3AA7B 5HHDG 3KWVA 3SZVA 3ZJVA 1I4RA 3TSSA 3O0EA 1PUTA 4GDKB 1HXTA 4LSEA 4AZLA 1OSMA 3SYBA 3PQSA 3JTYA 1T6BX 1I4GA 4C69X 1TS5A 2BS2B 2EELA 3NVWA 4D2KA 2AQ1B 3U52E 1V8CA 1G90A 1ROEA 1NVID 2WXNA 3AECB 1ZXIA 4KKIA 3POQA 1JROA 2QSDA 1WXQA 1VZ7A 2IGGA 2J53A 1D5ZC 2J4UP 1V1PB 3FC4A 4RCOA 3C5OA 2WXOA 2JYTA 1GAQB 2Y7SA 3AE8B 3QRAA 4BUMX 3VE1A 3HUIA 3BIID 3BYTB 3IXSA 4LSIA 4FZLA 4GHBA 4C7ZA 1K52A 5DL5A 2Q5WD 4O3YA 5AFUL 3E9SA 5EE9A 2KWDA 3Q8CA 4RFBA 4ZYSA 2V0GA 3AAEA 1GFOA 3B2GA 2N9LA 1QOGA 1N5WA 2ON8A 3UPGA 1N61A 2CJOA 2Y0KA 1I7HA 2BS4B 2GE4A 1STEA 3PZ7A 2L32A 1MPFA 3P4SB 6PRNA 2PRNA 1GPXA 1FRRA 4A8XC 1WYGA 2WXJA 2XE3A 1PGBA 3TZGA 3AE3B 5DL8A 3V8UA 1RM6C 2DWQA 3FILA 4LLGM 2LUMA 4KR8A 2WU5B 4KGSA 2FGQX 1SSNA 3LYYA 1L0YB 4GCQA 1PGAA 2H88B 2KAJA 1YJIA 3W2DA 1P7FA 4FT6A 2WLBA 3BYYB 3B9JA 4OVZA 3AAAB 4C80A 2OHFA 2GB1A 1FNUA 4XE0A 5JXVA 1YNTE 1WWTA 1C9FA 1HXUA 1XXGA 2JMMA 4FOZA 4N59A 1F77A 2V4IB 5D3DA 2PORA 4WH4A 3VQIA 1F0ZA 1HXXA 4FRTA 3AE5B 3AE1B 3H8HA 1MPEA 3EGRA 3HVDA 2R61A 2F1VA 1NENB 3ETRA 2JX5A 4B0EA 2FE8A 2WDVB 2FGRA 5MPOA 2E6XA 2KMMA 2OMFA 1Q9GA 2L52A 2DYOA 2NTTA 3NVZA 4IOIE 2W80C 4DQOC 3AM9A 2WNMA 4GLSC 1H6S1 4GF4A 3R8BA 3KVDD 4CQNA 3P1MA 3LK41 1JWBD 1SE3A 3MFGA 1JW9D 2M56B 3AA6B 1ZP0B 1I4PA 1FXAA 3NVVA 3NUHB 5GV0A 5EE3A 1RYJA 3IAM1 1K50A 2WP9B 2PVOD 3W5UB 1NYQA 1MM4A 3T20A 3VRBB 1WRIA 4OZBA 1E7PB 4RGTA 2W82A 2XTRA 3ZJTA 1GB4A 2KXPA 3SY9A 1C78A 4ARIA 1FNVA 4KR4A 4FMSA 3SEBA 2ZLDA 2KZ7B 1A70A 4HRSA 3E56A 1L0XB 3AE4B 3EUB2 1ZOYB 1L0VB 1BXWA 4GDLB 3I57A 4B0MA 5ADXK 3IT6B 1C77A 1TS4A 2LEKA 1SB3C 2QILA 2Y5PA 2WXHA 3ABVB 2NMQA 4AKRA 3AA1A 1ZPSA 1FIQA 2BBCA 5AUIA 4DXGA 1FEHA 1R7SA 3POUA 4FXCA 3GP7A 4KRAA 3SYSA 4WWMA 2J42A 3HW9A 1B9RA 3LXFA 2W3SA 4RLBA 1SXTA 1N63A 5IYUA 4YTNB 3KWLA 3W1SA 3AEGB 1FXIA 4XWTA 4MH8A 4Z3TA 2KACA 1JWAD 1YMHE 1C4CA 4D65A 2L1AA 4O3WA 4UDUC 3ZQ4A 4FZMA 2BT6A 5GXGB 4FSOA 3AA6A 4YTPB 4RF1A 2MHLA 3PQUA 2PIAA 4TQ1A 4YT0B 3FILB 3B2FA 1IZNB 1C76A 1YJJA 3ZGZA 1GFNA 3AMZA 2ZFGA 2QTKA 4QQ1A 2DLBA 2Y3AA 3PRNA 1WSPA 3P4PB 2J1NA 1PDXA 4P6VF 1GFMA 1TKGA 2INPE 1DOIA 3OWEB 1M4VA 2RDHA 1J7CA 1DOYA 5HI1A 4YXDB 1MHXA 2B76B 4OW0A 3NVYA 4G76A 4AKRB 2FBWB 1TKEA 2N0SB 3POXA 1J7AA 2VZKD 2KXPB 1XF5L 4RGNA 1VZ8A 2CJNA 4JX1C 5D3IB 1QF6A 1T5XD 2AX5A 1CZPA 2M19A 3RPFC 2RDGA 4ZOHC 2GRIA 3N9YC 5H92C 3U4EG 2N7JA 2TSSA 4TSSA 3P42A 2WS3B 3UAQA 1FFUA 1Q9FA 1D5MC 4FUVA 1JWSD 1VRAB 5HFYA 3P4RB 2DYMA 2WDQB 4AYID 2QIEB 3Q8FA 1BUIC 1L6VA 1JQ4A 3T24A 1IGCA 1GFQA 3PZ8A 3ZJUA 2RPVA 5FKAC 4TQ0A 4FESA 1ET9A 1V1OA 2KQ4X 3HRDD 1T3QA 2DBYA 2SEBD 1HZ6A 3CWIA 2JYEA 5H8YE 4F4BA 3BWUD 5AUKA 1XLQA 4O4UA 3LK3A 4LTUA 2WXKA 1YN3A 4HJGE 4C7YA 3U7ZA 1FD6A 3VE2A 4KX6B 1C79A 4MACA 4R3DA 3ZYYX 1IBXB 2ERVA 5FR3A 1SE2A 2I38A 4RNAA 4US8A 2XTQA 3A2SX 3Q8AA 4AKMA 1VZ6A 2MH7A 3KLSX 4GCPA 4YSYB 4G75A 3G7GA 1ZUD2 1HEZE 3URYA 2H89B 1LO5D 2WXFA 1E9MA 1ZE3D 4KKJA 3SR6A 1PRNA 4XWWA 3V3XA 5E6JA 2N9KA 2YEPF 1BH3A 2K4TA 2XE1A 3FYXA 3Q69A 3R2IA 2Y5CA 3VRAB 3TEWA 3AA0B 1ZHWA 2KC0A 4E1TA 1NYRA 2VZKB 5T8IA 4LSFA 3DWMA 4OHJA 4XDCA 2YPVA 2BS3B 2BW2A 4A9AA 2K9XA 1FMAD 3DWGC 1FNWA 1N5XA 3AA1B 3AE6B 2M06A 4YWGG 3VZUX 1CJEA 4JWSC 2GI9A 2XN9C 3V05A 5BYQA 4U9CA 2IGDA 3TEZA 5JDPA 2LMCA 4FSPA 3UI3A 3GS2A 2WDRB 3NSGA 1EU4A 1FFVA 1NI3A 2K3UA 3AEAB 4L2YA 2G1EA 3BVZA 3P63A 1UWMA 1L6UA 3EMNX 1K53A 5DL6A 2N2MA 3WCQA 4RJWA 3AH7A 1SBBB 1MVKA 4AYNA 4AFKA 1THQA 2X38A 4US9A 1JALA 2AQ3B 2QMTA 1XCQL 1GFPA 1KLGD 1QQRA 1TZOA 5EE0A 3LB8C 2M0AA 3T0SA 1HZ5A 3EA6A 3TEXA 2K0LA 3DA4A 1IZNA 3Q8EA 1BMLC 2PW9A 3L4PA 2MNHA 1E6EB 1XLNA 1YQ4B 3P4QB 1QJPA 4C56C 5BMHA 2XE2A 1ZXHA 4XNKA 2JQRB 2QJLA 4KGRA 4YSXB 1AW7A 2Y0LA 1C4PA 1L4DB 2W54A 3LK3B 1ACCA 2WXGA 3HOLA 2CU3A 4ZRQA 3AB5A 1JWMD 1KRHA 3SY7A 3PORA 1YN4A 1ESFA 1SIJA 4JPSA 2LJIA 1V97A 3BK2A 4RH6A 3HOEA 4Q2JA 1I4QA 4O3ZA 1KH0A 1C4AA 2QEJC 3T3OA 3KQ4A 2PKOA 4NAWB 2K22A 2Z8LA 2N2LA 2BTEA 1HXYD 5D5DA 1KFYB 1TJEA 1UNSA 5PRNA 4IDIA 5G5HA 1FCLA 1D6EC 1AWDA 2E3TA 2G9HD 2IJ0A 1YN5A 2M07A 4WURA 5FK9C 3TEYA 3IAS1 2NTSA 2J4XA 1DGJA 3MHZA 2V3NA 4J3OD 2XE5A 1FRDA 1YS5A 2V3PA 1Y56A 4XNLA 1F2RI 5I4DA 3LK42 3FAHA 2IDYA 1IGDA 4USAA 1K51A 3SFDB 4AQ7A 2IPKD 1IBXA 1D4BA 1VJKA 2IGHA 2L83A 2LHFA 4N58A 4RJXA 3WI4A 4YTMB 3VY9X 4MM3B 2RMMA 2J52A 4MT5A 5G26A 4L23A 1DOXA 3HVZA 1B1ZA 1JMLA 1F2RC 3AV8A 1SEBD 1RWSA 1AYFA 2JZPA 1KF6B 1XO3A 3W5VB 1BXTA 1JCKB 4NZLB 4H2AA 3MJ5A 5BMGA 4ZHOA 2WQYB 1I4HA 4B61A 4LK0M 3K19A 2HDEA 1XCTL 2W55A 3NS1A 5AFUK 5T5FA 4NAMA 1L4ZB 4O4XA 3HWBA 1P7EA 1GOZA 4NJCA 3AEEB 1AN8A 5DL7A 2LGIA 1ORMA 3Q8BA 4KGTA 1OQQA 3UU2A 2XNAC 1Q10A 4A90A 2X27X 3AA0A 1ET6A 4AYMC 2PLPA 4HROA 4OZAA 2D5GA 2Y0HA 2INNE 3BZDB 4WAFA 2SAKA 1ZDVA 1WGKA 1ZHYA 2MJDA 1SF0A 1QOAA 4HKZE 1SJHD 4REZA 5TSSA 4O49A 4ZRPA 1HA5A 1EWYC 3LK2A 1XEEA 2ICIA 4ITKA 1FM0D 3LK2B 1J7BA 5D7GA 3VY8X 4A6QA 4ZHPA 1QKZA 4RGMA 1SJED 2WXQA 2YEPB 1E0ZA 3RBHA 4JCHA 4E1SA 1QJ9A 1ENFA 3NRZA 4A55A 1FO4A 3R2TA 2BB6A 1UWXA 1JWUD 2KDMA 2MEKA 1HQRD 1MM5A 1MI0A 3AE7B 1TS3A 3BVMA 1QOFA 2LHDA 2PTLA 1MHHE 1VR9A 1ZHXA 3WI5A 4TMAB 2JU6X 1KTKA 1QLBB 1EWCA 3AEBB 3I9V1 1BT9A 3AEFB 1PFDA 2WXPA 3IT4B 4OZCA 4P16A 3GB1A 4WQMA 4HEA1 3GP6A 3U2SC 3MP9A 3VR9B 3VZWX 1TKYA 4RGOS 4N6EB 4JE3B 2ZW1A 1ZHZA 2XG6A 2JXTA 2BYTA 4M0WA 1PGXA 2K5PA 3AEDB 4JWUC 1PHOA 1E54A 2F1TA 2AQ2B 4O3XB 2W3RA 3NZ3A 2OEDA 2HTME 4JFBA 5EE2A 2FUG1 2WXLA 1OFFA 1QOBA 2BB5A 1CQVA 2MJ3A 1RFKA 2O4VA 1VDVA 5BMIA 1TY2A 3QRCA 4RLCA 3AN1A 3AA7A 8PRNA 3W9CB 3CIRB 1GB1A 3VR8B 1V1PA 2WU2B 1UUPA 2WXMA 4RL9A 1PYWD 3J9CA 2ACZB 5BYSA 3PO0A 3AE2B 5LNK1 3VZTX 2MJEA 4EE2A 4GCSA 1FCCC 3BK1A 4AS1A 2ODJA 1VLBA 1XLPA 1ZDXA 1QILA 2KN4A 1DYQA 3SFEB 2LHEA 1L5PA 4WIPA 3SZDA 3O13A 1QT9A 1YQ3B 3AE9B 1NEKB 2K0PA 1KLUD 2Y2XA 1TS2A 2XMXA 5EE1A 3C8YA 1CK1A 1TYGB 2WXRA 4RF0A 4D5UA 4AYDC 3RFZB 1EM7A 4DXFA 3T3NA 2PMVA 4O1NA 5FVNA 7PRNA 2I2YA 2JSVX 4YSZB 1JRPA 1D5XC 2ONQA 1P4TA 4PT5A 4LSHA 5G5GA 2JWUA 2PVGC 5BYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLO A;  2EKI A;  5C2T B;  3NS1 A;  1E7P B;  2W55 A;  4US8 A;  2XTQ A;  2XTR A;  2MH7 A;  4YSY B;  5C3J B;  4G75 A;  1N60 A;  1ZUD 2;  3AEE B;  2H89 B;  1A70 A;  4HRS A;  1E9M A;  3SR6 A;  1OQQ A;  1OQR A;  3DA3 A;  4FZN A;  3AE4 B;  3EUB 2;  1ZOY B;  3VRA B;  1L0V B;  4HRO A;  2Y5C A;  1IUE A;  1E10 A;  5G5G A;  1NYR A;  3DWM A;  1N62 A;  1WGK A;  2MJD A;  1SF0 A;  1QOA A;  1SB3 C;  2BS3 B;  1FMA D;  2K9X A;  2LEK A;  3DWG C;  4A9A A;  3ABV B;  1PUT A;  1N5X A;  3AE6 B;  3WCQ A;  1CJE A;  4JWS C;  1EWY C;  1FIQ A;  4ITK A;  5AUI A;  1FM0 D;  2BS2 B;  1R7S A;  1J7B A;  3NVW A;  4ZHP A;  4FXC A;  2WDR B;  1FFV A;  1V8C A;  3AEA B;  1NI3 A;  1ROE A;  1NVI D;  4WWM A;  2G1E A;  3AEC B;  1ZXI A;  1E0Z A;  1B9R A;  3LXF A;  2W3S A;  1JRO A;  1UWM A;  3P63 A;  1L6U A;  1WXQ A;  3NRZ A;  3FC4 A;  1N63 A;  4YTN B;  1FO4 A;  3KWL A;  1GAQ B;  3AH7 A;  3AEG B;  1FXI A;  3AE8 B;  4US9 A;  1JWA D;  1JAL A;  3BII D;  3HUI A;  3AE7 B;  4FZL A;  4C7Z A;  1QOF A;  2Q5W D;  4FZM A;  3LB8 C;  5EE0 A;  2BT6 A;  5GXG B;  4YTP B;  5EE9 A;  3W5U B;  2PIA A;  3DA4 A;  4YT0 B;  3B2G A;  3B2F A;  1QOG A;  1QLB B;  1YJJ A;  3AEB B;  3L4P A;  1E6E B;  1N5W A;  1XLN A;  1YQ4 B;  1N61 A;  3AMZ A;  3AEF B;  1PFD A;  3P4Q B;  2CJO A;  1I7H A;  2BS4 B;  3P4P B;  2JQR B;  2QJL A;  3P4S B;  4WQM A;  4YSX B;  1PDX A;  4P6V F;  3VR9 B;  1TKY A;  1TKG A;  1FRR A;  2W54 A;  4N6E B;  1DOI A;  1WYG A;  1GPX A;  3AE3 B;  2CU3 A;  1RM6 C;  2DWQ A;  1J7C A;  3AB5 A;  1KRH A;  1DOY A;  4YXD B;  2B76 B;  2K5P A;  2WU5 B;  1SIJ A;  3AED B;  3NVY A;  4JWU C;  2W3R A;  1V97 A;  4G76 A;  2FBW B;  2HTM E;  1TKE A;  2H88 B;  1YJI A;  2KAJ A;  1J7A A;  2N0S B;  3VRB B;  1OFF A;  1QOB A;  2WLB A;  2MJ3 A;  1RFK A;  1VDV A;  3B9J A;  4JX1 C;  2CJN A;  4C80 A;  2OHF A;  1QF6 A;  3AN1 A;  3RPF C;  2AX5 A;  1CZP A;  2M19 A;  1WWT A;  3W9C B;  2PKO A;  4ZOH C;  3CIR B;  2K22 A;  4N59 A;  5H92 C;  3VR8 B;  2WU2 B;  1KFY B;  5G5H A;  1TJE A;  4IDI A;  1F0Z A;  2ACZ B;  3AE5 B;  1AWD A;  2E3T A;  2WS3 B;  3AE2 B;  1FFU A;  3AE1 B;  3PO0 A;  2MJE A;  3P4R B;  1VLB A;  2WDQ B;  1NEN B;  1XLP A;  3ETR A;  2JX5 A;  1DGJ A;  2QIE B;  1L6V A;  1JQ4 A;  1FRD A;  2WDV B;  3SFE B;  5MPO A;  2KMM A;  1L5P A;  2L52 A;  3NVZ A;  1QT9 A;  1YQ3 B;  3AE9 B;  1NEK B;  3FAH A;  4USA A;  3AM9 A;  3SFD B;  3HRD D;  1T3Q A;  2DBY A;  1VJK A;  2L83 A;  2XMX A;  4N58 A;  3CWI A;  5EE1 A;  3P1M A;  4YTM B;  5H8Y E;  1TYG B;  1JWB D;  1JW9 D;  2M56 B;  5AUK A;  1ZP0 B;  3NVV A;  1FXA A;  1DOX A;  3HVZ A;  1XLQ A;  3AV8 A;  3W5V B;  4LTU A;  1RWS A;  1AYF A;  4YSZ B;  1KF6 B;  1JRP A;  1XO3 A;  5EE3 A;  1RYJ A;  4ZHO A;  4C7Y A;  2WP9 B;  2PVO D;  2WQY B;  4KX6 B;  1NYQ A;  3ZYY X;  2PVG C;  1WRI A; 
#chains in the Genus database with same CATH topology
 4FRX A;  1OPF A;  3AAA A;  4BVU C;  1ZHT A;  1QJ8 A;  4HKQ A;  3AAE B;  4KZC A;  1K8R B;  1OQR A;  1SE4 A;  2LFU A;  4PUX A;  2WWZ A;  5DPR A;  5FR6 A;  5JZE B;  2KJR A;  2C9W B;  4XDD A;  4ACF A;  4AUI A;  5HHD G;  3O65 B;  3ZJV A;  3TBL D;  1PUT A;  4GDK B;  4HCN B;  3H1U A;  4C69 X;  1WZ0 A;  2EEL A;  3A9K A;  2MSE D;  1GUA B;  1NVI D;  5TR5 A;  2QSD A;  1WXQ A;  4IL6 O;  2IGG A;  2J53 A;  2J4U P;  2JYT A;  2Y7S A;  3ZNI D;  5GTH O;  2KFJ A;  2BF8 B;  3C0R B;  2JVC A;  3BII D;  3IXS A;  2HTH A;  4FZL A;  4C7Z A;  1K52 A;  5DL5 A;  1OQY A;  4O3Y A;  2HD5 B;  5AFU L;  2CHZ A;  4FJZ A;  4F1S A;  4RFB A;  2CHW A;  3AAE A;  1GFO A;  4NQL B;  2KNB A;  3Q3O C;  3W1Y A;  1YX6 B;  1GPX A;  2KVZ A;  2K1F A;  3PHW B;  3LYY A;  3RMK C;  4TUU A;  3UIP B;  3AAA B;  3CST A;  2KLG A;  3RNA C;  4XE0 A;  1WJN A;  1C9F A;  1HXU A;  4N59 A;  3NOB A;  2DYB A;  3PSE B;  1F0Z A;  3ZNZ B;  3ZVV A;  4MSQ B;  4FUL A;  4ANX A;  2F1V A;  1V81 A;  4WWO A;  3QIJ A;  2OMF A;  2KWC A;  1RAX A;  2L52 A;  3VUX A;  4MSM B;  3R8B A;  2DZJ A;  1JWB D;  1JW9 D;  3HK0 A;  3AA6 B;  2KQ7 A;  3Q3N C;  2PVO D;  3W5U B;  1MM4 A;  4OZB A;  3N3K B;  4TV3 A;  1GB4 A;  2KXP A;  3SY9 A;  1C78 A;  2DZM A;  4FMS A;  3SEB A;  2KMC A;  1L0X B;  2X9K A;  1L0V B;  2OJR A;  3IT6 B;  3B0A A;  4EZK A;  1YIW A;  2WXH A;  3NG0 A;  5G39 A;  2MP2 A;  2BBC A;  3UIO B;  4DXG A;  4FXC A;  3GP7 A;  1P3Q U;  3HW9 A;  2V1Y A;  3ZNH B;  4KDI C;  2LXC A;  1SXT A;  1N63 A;  4YTN B;  1NI2 A;  3KWL A;  2VH1 A;  1FXI A;  4GIV A;  4MH8 A;  4AJW A;  4B95 A;  4O3W A;  5GXG B;  3VHT C;  3RCZ A;  4F8C B;  3Q14 C;  3ZO5 B;  1H4R A;  3FIL B;  4FHJ A;  4W9E A;  2ZFG A;  4QQ1 A;  1QZE A;  1E8W A;  1PDX A;  1DOI A;  2VH2 A;  1L2N A;  1TGZ B;  1DOY A;  3NVY A;  2Z59 B;  2VZK D;  2KXP B;  2R4L A;  2R88 A;  2M19 A;  2RDG A;  4ANV A;  3P42 A;  2WS3 B;  1NBF C;  1IP9 A;  4FHK A;  1IGC A;  4M02 A;  4K3B A;  2JUO A;  1V1O A;  3HRD D;  1T3Q A;  2DBY A;  3RNF C;  3CWI A;  2KKC A;  5H8Y E;  2PE6 B;  1UF0 A;  1P0R A;  2DEN B;  3IG3 A;  4IM0 A;  1YN3 A;  4C7Y A;  1IBX B;  2I38 A;  1VZ6 A;  3KLS X;  4A20 A;  4PJ0 O;  1HEZ E;  3V61 A;  5CHV C;  4PK1 A;  3KYD D;  4KKJ A;  1E9M A;  5GTI O;  3DWO X;  4MJS A;  3A9J B;  2Y5C A;  3ENE A;  2KC0 A;  3ZLZ A;  3DWM A;  2BS3 B;  1WJU A;  4A9A A;  1FMA D;  2IZV B;  4HLE A;  1N5X A;  3DQV A;  3HIZ A;  2GI9 A;  5BYQ A;  4DBG A;  2ASQ A;  3NSG A;  1EU4 A;  3AEA B;  3BVZ A;  1L6U A;  3DBS A;  2N2M A;  1WXV A;  4AYN A;  4P7I A;  2X38 A;  1JAL A;  1KM7 A;  1XCQ L;  1TZO A;  4BKT A;  4E3C A;  3WU2 O;  2KDF B;  3LB8 C;  2C7N B;  2VRR B;  1HZ5 A;  3DVG X;  2K0L A;  3Q8E A;  1IZN A;  2PW9 A;  2LGX A;  1E6E B;  2HE7 A;  1YQ4 B;  4C56 C;  1QJP A;  4HDQ A;  2MBQ A;  5C23 A;  2F1C X;  3OG5 A;  2QJL A;  5KAI O;  4KGR A;  3I63 C;  4PR7 A;  4CYE A;  2O6V A;  4ZRQ A;  2WGS A;  3RUL A;  3POR A;  1YN4 A;  2NBW B;  5AEK B;  3BK2 A;  4RH6 A;  2LXA A;  4O3Z A;  3IFW B;  4I6P A;  3VUY A;  2QEJ C;  5IA7 A;  2K22 A;  3VVW B;  1UNS A;  1S5L O;  1D6E C;  2E3T A;  2IJ0 A;  3TEY A;  2V3N A;  1FRD A;  1YS5 A;  4BAX A;  1R4M I;  1Y56 A;  2J0K A;  1F2R I;  2L0F A;  4X57 B;  2V4L A;  2MCN B;  2W9N A;  1VJK A;  4RJX A;  2BYF A;  4GU2 A;  4MM3 B;  4MT5 A;  2J52 A;  2C5L C;  2L8J A;  4K3C A;  1JML A;  4DXA B;  2JZP A;  5D6J B;  1JCK B;  4GGQ A;  1I4H A;  3W1S C;  2KX0 A;  1MG4 A;  4KV2 A;  3PGU A;  2JZ3 B;  3CMM B;  2RGF A;  5DPW A;  2JXX A;  1ORM A;  3PT2 B;  4PYU A;  1F1H A;  2D3G A;  2IY1 B;  2D5G A;  2LAS A;  3BZD B;  3TCA A;  5EDS A;  1ZDV A;  1WGK A;  4REZ A;  1SF0 A;  4HKZ E;  4O49 A;  1EWY C;  3LK2 A;  3WAP A;  2IO0 B;  1FM0 D;  2N7D A;  4BFR A;  2PJH A;  4E1S A;  3A1Q B;  2DHZ A;  2FUH B;  2ZPY A;  3NRZ A;  4DK5 A;  4GN1 A;  4DWF A;  5G2N A;  1FO4 A;  3R2T A;  5J17 A;  3CSF A;  2J7Q B;  1CMX B;  5LXH A;  3AE7 B;  2CS4 A;  4W9J A;  1TS3 A;  4JLC A;  2LHD A;  2PTL A;  1VR9 A;  4GMV A;  3U7D A;  1HE8 A;  3B08 A;  3QC8 B;  3IT4 B;  4P16 A;  1D3Z A;  3PGS A;  4HEA 1;  3VR9 B;  2JRH A;  3V6C B;  2FAZ A;  4JE3 B;  2BYT A;  3NZ3 A;  2F1T A;  4O3X B;  2KTR B;  3M95 A;  2OED A;  4JFB A;  5EE2 A;  1Q5W B;  1QOB A;  2MJ3 A;  4EUT A;  3ZXR A;  1FPY A;  4RLC A;  3AA7 A;  3VR8 B;  2WXM A;  1E8Z A;  2MJE A;  1VLB A;  3A1Q A;  2IND C;  4WIP A;  2R8A A;  4N74 A;  4JL9 A;  2Y2X A;  1Q1O A;  2KT7 A;  1CK1 A;  3C8Y A;  4AYD C;  1EM7 A;  2KDI A;  3AU5 A;  1WM3 A;  3ZXV A;  1WIA A;  2ONQ A;  4M01 A;  2LVQ A;  3CF6 E;  2MW5 A;  4NPN A;  2EKI A;  2MA9 B;  2IWW A;  1TBE A;  5C3J B;  3SHQ A;  1GNU A;  3RNE C;  5ADX L;  1TY0 A;  3BVG A;  2N9X A;  3MC0 B;  1N62 A;  4ARC A;  3AA7 B;  3KWV A;  5IAA C;  3TSS A;  4LSE A;  3SYB A;  3JTY A;  1T6B X;  1I4G A;  1TS5 A;  2AQ1 B;  3U52 E;  3POQ A;  1V1P B;  2WXO A;  3UQA A;  3AE8 B;  3R66 C;  2X8X X;  3VE1 A;  1ZGU B;  3Q3F A;  1P1A A;  1G6J A;  2KWD A;  2G4D B;  1WGD A;  3B1L X;  1N61 A;  2CJO A;  2Y0K A;  3RZF A;  2BS4 B;  2KDB A;  4FBJ B;  4RM8 A;  4ZYN A;  1FRR A;  1WYG A;  4LLG M;  3V8U A;  2DWQ A;  3PRP B;  4KR8 A;  2N9E B;  2WU5 B;  1EO6 A;  2LGS A;  4FA6 A;  2K6D B;  4FT6 A;  2WLB A;  3BYY B;  4OVZ A;  3P2B A;  4HPL B;  4IM2 A;  1WWT A;  2YVC A;  1C3T A;  2V4I B;  1F77 A;  2EMT A;  3NS8 A;  4FRT A;  3AE5 B;  2WX0 A;  3H8H A;  1KOT A;  2JX5 A;  4KSL C;  3DDC B;  4W9D A;  4KSK C;  2DYO A;  4ICV A;  2WNM A;  2KVR A;  4GF4 A;  3KVD D;  4CQN A;  3U30 A;  3NUH B;  1R4N I;  1T0Y A;  3MC9 A;  4MH0 E;  2WP9 B;  3ZDM C;  1NYQ A;  3VRB B;  1WRI A;  2XTR A;  3PZD A;  3JCU O;  4ARI A;  1FNV A;  2LGD A;  3VTU A;  2IBI B;  2N9P C;  1E90 A;  3EUB 2;  1ZOY B;  3R3M A;  1BXW A;  2K25 A;  3I57 A;  5ADX K;  4B0M A;  3H9D A;  3VH3 B;  4WJO A;  3KUD B;  1WY8 A;  2NMQ A;  4LJO B;  1WF9 A;  3POU A;  4WWM A;  2J42 A;  2Y5B B;  3LXF A;  2W3S A;  2CR5 A;  4A3O A;  2MLB A;  1WX9 A;  1WH3 A;  1KLV A;  4W9I A;  1XQQ A;  2DX5 B;  3PLV A;  4S17 A;  1XT9 B;  4Z3T A;  1JWA D;  1C4C A;  4D65 A;  2N4F A;  4FZM A;  2BT6 A;  4FSO A;  2PPH A;  2GBK A;  4YTP B;  5AZH A;  4TQ1 A;  1C76 A;  1WXS A;  1YJJ A;  4ZRI A;  1P98 A;  3KZI O;  3PRN A;  3MHS D;  1GFM A;  2L76 A;  5IN7 A;  2RDH A;  4WWN A;  1J7C A;  4YXD B;  4DHZ E;  2KHW B;  2RD0 A;  1TKE A;  1J7A A;  4FJV B;  4OVU A;  3EHV A;  1VZ8 A;  4G3X B;  5D3I B;  1QF6 A;  3NHE B;  3ML9 A;  3C19 A;  2GRI A;  4TSS A;  1Q9F A;  4FUV A;  5DCN A;  5G3A A;  2BGF A;  4AYI D;  3Q8F A;  1BUI C;  1L6V A;  4NAW A;  1JQ4 A;  3T24 A;  2JF5 A;  3ZJU A;  2KLC A;  2AL6 A;  5FKA C;  4TQ0 A;  1RRB A;  2KQ4 X;  2IO3 B;  4F4B A;  3BWU D;  3NJT A;  3LK3 A;  2JWZ A;  2GBJ A;  4LTU A;  2WXK A;  4OVV A;  2IYD B;  2ZJD A;  1WRD B;  1X1M A;  3A2S X;  3Q8A A;  3V62 A;  4YSY B;  2D3C A;  4G75 A;  1ZUD 2;  2WXF A;  4XWW A;  2N9K A;  2YEP F;  4P1B C;  3AA0 B;  1E8Y A;  5T8I A;  4LSF A;  4OHJ A;  3VTW A;  3FKY A;  2YPV A;  3TJP A;  3DWG C;  4F7Z A;  3AA1 B;  3AE6 B;  3DVN V;  3WCQ A;  1CJE A;  2R2Q A;  2XN9 C;  5JDP A;  2REX A;  2WX1 A;  3GS2 A;  3EMN X;  1K53 A;  2LJ5 A;  5DL6 A;  2PE9 A;  2ZCC A;  3AH7 A;  2RPQ A;  2HJ1 A;  1THQ A;  2AQ3 B;  1ZW7 A;  1YJ1 A;  3DBR B;  3QA8 A;  2FID A;  1WZ3 A;  3TEX A;  3VUW A;  2MNH A;  1XLN A;  5BMH A;  1ZKH A;  1ZXH A;  4XNK A;  4YSX B;  2Y0L A;  2W54 A;  3LK3 B;  4LNK A;  3EFU A;  2WXG A;  2K8H A;  2MQJ A;  2MBE A;  1SIJ A;  4JPS A;  2C7H A;  2LJI A;  1V97 A;  3EEC A;  2GMI C;  4Q2J A;  4PS3 A;  1KH0 A;  3M62 B;  4KDL B;  4NAW B;  4PS7 A;  2DZI A;  2I1J A;  2BTE A;  5D5D A;  1TJE A;  4IDI A;  1FCL A;  2KD0 A;  3A9J A;  3A9K B;  4AOF A;  1YN5 A;  2A5U A;  1R4M B;  4J3O D;  2G4S A;  4IWO A;  1U4A A;  5I4D A;  5L83 A;  4USA A;  4AQ7 A;  1IGD A;  2R4N A;  2IPK D;  3ZKJ C;  1IBX A;  4N58 A;  4YTM B;  2RMM A;  2NBV B;  2D3B A;  1DOX A;  3HVZ A;  2UWQ A;  3AV8 A;  1F2R C;  1SEB D;  1RWS A;  1XO3 A;  4NZL B;  1WGR A;  4ZHO A;  3MJ5 A;  2KC2 A;  2WQY B;  2K8B A;  4LK0 M;  3MJW A;  2WJR A;  3NS1 A;  3L16 A;  4O4X A;  3HWB A;  3AEE B;  2QCZ A;  3KH0 A;  1AN8 A;  3WAN A;  1MFW A;  4MGZ E;  3Q8B A;  1GG3 A;  2XNA C;  4A90 A;  3ML8 A;  3AA0 A;  4ANW A;  2WYQ A;  2DAF A;  2SAK A;  5D2M B;  4EKU A;  4WWP A;  5TSS A;  3QHT A;  3DZM A;  3A0H O;  2JRI B;  1LQB A;  4ZRP A;  3PTF C;  4ITK A;  4LDT D;  1EF1 A;  2V9H A;  1QKZ A;  4RGM A;  2WXQ A;  3L17 A;  3RBH A;  4W9C A;  1MG8 A;  5B66 O;  4CHK A;  4IUM B;  1ENF A;  1OGW A;  5IKC M;  1JWU D;  4BKS A;  2EMS A;  3L08 A;  3HHM A;  3RNG C;  2L3Z A;  1HTQ A;  4CTD A;  1MHH E;  2DNF A;  4IM3 A;  3M63 B;  1S3S G;  4TMA B;  2JU6 X;  2UU7 A;  1QLB B;  3APF A;  1M94 A;  1BT9 A;  4HCP B;  3AEF B;  4WQM A;  3MP9 A;  3VZW X;  4AWJ A;  2RSU A;  3BIN A;  4UB8 O;  2ZW1 A;  1FXT B;  4M0W A;  4JWU C;  2O6V D;  3ZRF A;  4N75 A;  2W3R A;  2FUG 1;  2G3Q B;  2WXL A;  1RFK A;  4EZL A;  3Q2A C;  1TY2 A;  3AN1 A;  4G0N B;  1F9J A;  8PRN A;  2OOB B;  5GMV A;  1GB1 A;  2WU2 B;  1UUP A;  2MRP A;  4M00 A;  4M8M A;  5BYS A;  3PO0 A;  3AE2 B;  4LJP B;  1OTR B;  3OJ3 A;  3VZT X;  4WQO B;  2AXT O;  2NS5 A;  4EZJ A;  3SZD A;  3O13 A;  3AE9 B;  4XGA B;  1WI0 A;  1TS2 A;  2XMX A;  3DBL I;  3VXW A;  1WMH A;  1TYG B;  4RF0 A;  4D5U A;  5E6N A;  1V5O A;  1RLF A;  4DXF A;  3T3N A;  2I2Y A;  2Z0E B;  2JSV X;  1OEY J;  1D5X C;  3IVF A;  1P4T A;  2NVU I;  2XK5 B;  4PT5 A;  4LSH A;  5G5G A;  2BQQ A;  2PVG C;  1WYW B;  1XLO A;  4KIK A;  1LXD A;  1Z5S B;  3UGB B;  1EU3 A;  4LCD E;  1WJ6 A;  1N60 A;  2KAN A;  2WXI A;  3DA3 A;  4FZN A;  2N1W A;  1E10 A;  1TT5 B;  2YNK A;  3TUO A;  4E74 A;  4HK2 A;  3SZV A;  4AZL A;  2BS2 B;  4D2K A;  1V8C A;  1ROE A;  4KKI A;  3AEC B;  1OEY A;  1JRO A;  1VZ7 A;  4GSW A;  3FC4 A;  3C5O A;  4K7W A;  1GAQ B;  5DPS A;  4G50 A;  4GHB A;  3PF1 A;  2Q5W D;  2IWV A;  4W9K A;  5EE9 A;  3Q8C A;  4ZYS A;  2V0G A;  2CHX A;  4IW0 A;  4KZ0 A;  3B2G A;  3DWN A;  2N9L A;  1QOG A;  3ALB A;  2I1K A;  1N5W A;  2R4P A;  5AZG A;  3PZ7 A;  2GE4 A;  5KHQ A;  1MPF A;  3QQ8 B;  2KYW A;  3AE3 B;  3TZG A;  3HM3 A;  5DL8 A;  1RM6 C;  3FIL A;  2LUM A;  1E5W A;  4KGS A;  4MEM A;  1L0Y B;  1PGA A;  2H88 B;  1YJI A;  1P7F A;  3M3J A;  2OHF A;  2GB1 A;  1FNU A;  2FIF A;  3PRZ A;  1UBQ A;  3KVF B;  3R7Q A;  5JXV A;  2JMM A;  4WH4 A;  2MX2 A;  4II2 B;  2XEW A;  5CHF A;  3HVD A;  3X23 A;  2R61 A;  1E7U A;  3ETR A;  4B0E A;  2FE8 A;  5HKH A;  2LUE A;  2LWP A;  2FGR A;  2WDV B;  4A3P A;  2KFK B;  2KMM A;  3VH4 B;  4DQO C;  2W80 C;  4GLS C;  1H6S 1;  1I42 A;  2KJH B;  3PPA A;  3P1M A;  2HJ8 A;  3MFG A;  1ZP0 B;  1I4P A;  1FXA A;  5EE3 A;  2N7E A;  1RYJ A;  1HTO A;  3JSV A;  3ZIM A;  5J18 A;  4MM3 A;  3ECI A;  3AUL A;  4RGT A;  3ZJT A;  1LM8 B;  3AI5 A;  4KR4 A;  1S1Q B;  2ZLD A;  1J19 A;  4HRS A;  4HPP A;  4WAA A;  2BYE A;  4AUQ C;  4EOY A;  4GDL B;  3ONS A;  1WGY A;  1TS4 A;  2KN5 A;  3V60 A;  2Y5P A;  4I6N B;  5J2R A;  3A0B O;  3AA1 A;  1ZPS A;  1FIQ A;  3LJ3 A;  3RN9 C;  1R7S A;  2M4N A;  4KRA A;  3VFK A;  3ZNG C;  3EFC A;  1B9R A;  4RLB A;  3LDZ E;  1TTN A;  3ZTC A;  3W1S A;  3AEG B;  3BS0 A;  3GZN B;  2KAC A;  3MTN B;  3ZQ4 A;  3PLU A;  3I5J C;  3VDZ A;  2PIA A;  3B2F A;  3ZGZ A;  1GFN A;  3DHI C;  3AMZ A;  2XBB C;  2Y3A A;  5D94 A;  2C60 A;  4GDL A;  5JHB A;  1TKG A;  2INP E;  3OWE B;  1M4V A;  1WE6 A;  1T0S C;  4K1R B;  2KMA A;  3DVN U;  2FBW B;  2N0S B;  4J6I A;  2GLS A;  1XF5 L;  5KAF O;  2CJN A;  3QJZ A;  4HDO A;  1Y8R C;  5B5E O;  3H6N A;  1P9D U;  5H92 C;  2M1M A;  2N7J A;  2TSS A;  3IBE A;  2MBB B;  3UAQ A;  1FFU A;  1D5M C;  1JWS D;  2L00 B;  5HFY A;  1ISN A;  3BRZ A;  3P4R B;  3GE8 C;  1EUV B;  2GOW A;  2QIE B;  3RUI B;  3APC A;  3PZ8 A;  4ANU A;  4FES A;  1ET9 A;  1HZ6 A;  4C4V B;  4G11 A;  1XLQ A;  4HJG E;  3U7Z A;  1FD6 A;  2FCN A;  1C79 A;  4K81 A;  4KX6 B;  3ZYY X;  4TKN A;  2ERV A;  3UQB A;  5FR3 A;  1SE2 A;  4RNA A;  5C1Z A;  4GCP A;  3G7G A;  2UYZ B;  4IWQ A;  3URY A;  2H89 B;  4BBN F;  1LO5 D;  3WAO A;  2BVC A;  2L05 A;  3JW0 X;  5JHA A;  1PRN A;  1WX8 A;  4XX5 A;  5E6J A;  3QWZ B;  2INC C;  3FYX A;  3H7P A;  3Q69 A;  3VRA B;  3TEW A;  4ZRK A;  4E1T A;  5IO9 A;  4XDC A;  3PGE A;  2BW2 A;  4AP4 C;  4W9G A;  4NQK E;  2OJW A;  4FQE A;  4YWG G;  3V05 A;  2LMC A;  3UI3 A;  3UIN B;  2WDR B;  2G1E A;  4PYZ A;  2QHO A;  1WGH A;  1C1Y B;  2NCN A;  1WR1 A;  4RJW A;  1SBB B;  3BY4 B;  2ZCB A;  4HVB A;  4AFK A;  2IY0 B;  4US9 A;  3SDL C;  1QQR A;  4IG7 B;  2M0A A;  4YL8 A;  2JY6 A;  3DA4 A;  3PHX B;  1BML C;  3L4P A;  4KIK B;  1UEL A;  1WJ4 A;  3GZN I;  2JQR B;  1L4D B;  1C4P A;  2KDE B;  3Q3J A;  3PRM B;  1ACC A;  3HOL A;  2CU3 A;  3JYU A;  3AB5 A;  3GOE A;  1PQS A;  2FCQ A;  3DOW A;  2NPT A;  4WJN A;  3ZRC A;  3QAR A;  3KQ4 A;  2PKO A;  2N2L A;  2A4Z A;  1HXY D;  5G5H A;  5PRN A;  1AWD A;  2G9H D;  2M07 A;  4WJQ A;  3TL5 A;  2IO1 B;  1TZ1 A;  2J4X A;  3MHZ A;  2FCS A;  2BPS A;  3DBH B;  2V3P A;  3JVZ X;  4BZA A;  3KUC B;  3FAH A;  1D4B A;  2IGH A;  3WI4 A;  1WR6 E;  3R7R A;  3VY9 X;  5G26 A;  2LVP A;  2N1V A;  1B1Z A;  1AYF A;  1KF6 B;  4H2A A;  5BMG A;  2KZR A;  4DDI D;  4B61 A;  3K19 A;  2HDE A;  2W55 A;  1YD8 U;  2KC1 A;  1L4Z B;  1GOZ A;  4NJC A;  5DL7 A;  2LGI A;  1WXM A;  2G45 B;  2V3S A;  3UU2 A;  1V80 A;  1LGR A;  1Q10 A;  1ET6 A;  3RNC C;  4HRO A;  4AYM C;  1N6Z A;  2PLP A;  3Q6B A;  2RR9 A;  2Y0H A;  1V86 A;  2WVP A;  4QAY A;  2WDT B;  1ZHY A;  2MJD A;  5G55 A;  2KWU B;  2ZZP B;  5AZF A;  1NDD A;  1J7B A;  3N32 A;  3VY8 X;  4MGY E;  5D7G A;  2K8C A;  4BOZ B;  3DVG Y;  4JCH A;  1QJ9 A;  4HXD A;  2ZVO A;  1F52 A;  2KWV B;  4A55 A;  2R2O A;  1A5R A;  4K7U A;  2AEH A;  5CTR C;  2CU1 A;  1HQR D;  2LVO A;  1MM5 A;  1MI0 A;  1QOF A;  3WI5 A;  2ZNV B;  1T0R C;  1EWC A;  3IHP C;  1WFY A;  2O2V B;  4RGO S;  4ZRJ A;  3WA0 A;  3D32 A;  2JXT A;  3AED B;  1PHO A;  1E54 A;  2NBU A;  3TMP B;  2BB5 A;  2O4V A;  1VDV A;  1T0Q C;  4FLH A;  2JT4 B;  4EFO A;  2GBN A;  3CIR B;  1SIF A;  1V1P A;  4W9F A;  1PYW D;  5LNK 1;  4FJY A;  4NNJ B;  1FCC C;  3OAW A;  4E71 A;  4DHZ B;  1ZDX A;  1QIL A;  1DYQ A;  4BOS C;  2KO3 A;  1L5P A;  4XZ4 A;  1YQ3 B;  1WE7 A;  1NEK B;  4JQW C;  3T9L A;  1Q0W B;  5G38 A;  3L0W B;  3MC8 A;  2WXR A;  3RFZ B;  1WXA A;  2EKE C;  2O2V A;  4O1N A;  5FVN A;  7PRN A;  1JRP A;  2R4O A;  3RT3 B;  3QX1 A;  2ZEQ A;  2M8S A;  2JWU A;  4L1B A;  3V6E B;  2LFI A;  4D64 A;  5C2T B;  3PRE A;  5HG2 A;  3OLM D;  5IOI A;  2KDY A;  2ZW0 A;  2MBO A;  4W9L A;  4K7S A;  4HWI B;  1I4X A;  2W81 C;  4AYE C;  1IUE A;  4IKG A;  1L7Y A;  4LNF A;  2BKF A;  2KZ7 A;  1UGJ A;  1I4R A;  3O0E A;  1HXT A;  1OSM A;  4MJS B;  3PQS A;  1WGG A;  3NVW A;  1LFD A;  2KX3 A;  1G90 A;  3Q3M C;  2WXN A;  1ZXI A;  2KFK A;  2KJ6 A;  2MHJ A;  1D5Z C;  4RCO A;  3JSV B;  2D11 A;  3QRA A;  4BUM X;  2WHI A;  3HUI A;  3BYT B;  4LSI A;  2LZ6 A;  3E9S A;  1GJZ A;  1V49 A;  3N30 A;  4M0W B;  2ON8 A;  3UPG A;  1I7H A;  1STE A;  2L32 A;  3P4S B;  6PRN A;  2PRN A;  4A8X C;  2QDF A;  2WXJ A;  2XE3 A;  1PGB A;  3RI7 C;  1IPG A;  2M17 A;  4RMA A;  2ZNV C;  1GC7 A;  2FNJ B;  3PVL A;  2FGQ X;  1SSN A;  3ZDT A;  4GCQ A;  4LNI A;  3W2D A;  2KAJ A;  3ZUN A;  2DZK A;  3APD A;  3B9J A;  1TIF A;  4C80 A;  3A4R A;  1YNT E;  2K39 A;  4MGI E;  1XXG A;  4FOZ A;  2YLM A;  4GOC A;  5D3D A;  2POR A;  3VQI A;  4XYC A;  1HXX A;  3AE1 B;  2KOX A;  1UD7 A;  1MPE A;  3EGR A;  3PS6 A;  2DAJ A;  1AAR A;  1NEN B;  2C7M B;  3A4S C;  5MPO A;  2CKH B;  2E6X A;  3UF8 A;  2MP2 B;  3L54 A;  1Q9G A;  2NTT A;  3N1Y C;  3NVZ A;  4IOI E;  1GC6 A;  3AM9 A;  2JPH A;  2XK5 A;  5JH5 C;  5CX3 A;  4URK A;  2KXJ A;  3LK4 1;  1SE3 A;  2M56 B;  3TIX A;  3NVV A;  5LLI A;  5GV0 A;  3IAM 1;  2WJQ A;  1K50 A;  3RZW C;  5CHW A;  4ICU A;  3T20 A;  3QAQ A;  1E7P B;  2W82 A;  4NJ7 A;  3VAW A;  2MWS B;  1JRU A;  2KZ7 B;  1A70 A;  1RFA A;  3E56 A;  2LGY A;  3AE4 B;  2QC8 A;  1YX5 B;  3H7P B;  1C77 A;  2GBR A;  2AWT A;  2LEK A;  1SB3 C;  2QIL A;  3ABV B;  5IP4 D;  4AKR A;  5AUI A;  1I35 A;  1FEH A;  5KHO A;  3SYS A;  1MJD A;  1UBI A;  3RYT A;  1VD2 A;  5IYU A;  4XWT A;  3ZW3 A;  2LRW A;  1YMH E;  2L1A A;  4UDU C;  3A33 B;  2FCM A;  1WMH B;  3NY5 A;  5TIS O;  3AA6 A;  4RF1 A;  3QK0 A;  2MHL A;  3PQU A;  4YT0 B;  1IZN B;  5BYR A;  3WAM A;  2QTK A;  2DLB A;  2KTR A;  4XC2 A;  1WSP A;  3P4P B;  2J1N A;  2AYO B;  4KVG B;  4P6V F;  2LI5 A;  1WM2 A;  3L10 B;  5HI1 A;  1MHX A;  2B76 B;  2ZVN A;  4OW0 A;  4G76 A;  4AKR B;  1YOV B;  3POX A;  4RGN A;  2ZPN A;  5DPT A;  4JX1 C;  2D2Q A;  3S2A A;  1T5X D;  2AX5 A;  1CZP A;  3DHH C;  4JGH B;  4NY0 A;  2NPT B;  3RPF C;  4C00 A;  2J0M A;  4ZOH C;  3N9Y C;  3U4E G;  3HM6 X;  3RNB C;  1E8X A;  1VRA B;  4ASW C;  2AL3 A;  2DYM A;  4GXB A;  2WDQ B;  2MBH A;  1GFQ A;  1Z2M A;  2RPV A;  3QCA A;  4CO7 A;  4LNN A;  4MEL A;  4MGK E;  2SEB D;  2JYE A;  1YQB A;  3H7S A;  5AUK A;  4O4U A;  4C4V A;  2O6V B;  2L7R A;  5E79 O;  3VE2 A;  4R3D A;  4MAC A;  2BKR B;  2L0T A;  4US8 A;  2XTQ A;  4AKM A;  3PV1 A;  2MH7 A;  4ZDV A;  3DBR I;  1UZX B;  1ZE3 D;  3SR6 A;  5LXI B;  3V3X A;  2LRU A;  1BH3 A;  2K4T A;  2XE1 A;  3R2I A;  2B3A A;  1ZHW A;  4LNO A;  1T16 A;  1NYR A;  2VZK B;  2KQS A;  1WX7 A;  2K9X A;  1FNW A;  2BWE S;  4JIO U;  2M06 A;  3VZU X;  4JWS C;  3TEZ A;  3KYC D;  4U9C A;  2IGD A;  4FSP A;  3EC8 A;  1FFV A;  1IYF A;  1NI3 A;  2K3U A;  4L2Y A;  3P63 A;  1UWM A;  4LDT B;  2IO2 B;  2NR2 A;  4GDK A;  1MVK A;  1XD3 B;  4EEW A;  3DCG A;  2Z0D B;  2QMT A;  3ZTD A;  1GFP A;  1KLG D;  5EE0 A;  1V6E A;  3T0S A;  1T1L A;  4II3 B;  3EA6 A;  3L13 A;  3KUZ A;  3P4Q B;  2XE2 A;  1VCB A;  1AW7 A;  1SGH A;  3AXC A;  1JWM D;  1KRH A;  3SY7 A;  1ESF A;  4DHJ D;  1KJT A;  3HOE A;  1I4Q A;  3KW5 B;  4B9K A;  4HPM B;  3GE3 C;  1C4A A;  3T3O A;  2Z8L A;  1E7V A;  1KFY B;  3DBL B;  1J8C A;  4WUR A;  5FK9 C;  3IAS 1;  3N20 C;  5E6P A;  2NTS A;  1DGJ A;  3DBH I;  2XE5 A;  1EF5 A;  1UGM A;  4BBN C;  4XNL A;  3LK4 2;  2IDY A;  4GB9 A;  3SFD B;  1K51 A;  4UB6 O;  2L83 A;  2LHF A;  4HJK A;  4NJ6 A;  4WJP A;  4MDK E;  4L23 A;  3RD2 A;  5H2F O;  3W5V B;  1BXT A;  3I3T B;  2JQY A;  1H8C A;  2JZZ A;  2RDB C;  4RM9 A;  1XCT L;  5AFU K;  4P1C C;  5T5F A;  1V2Y A;  2J0J A;  4NAM A;  3VTV A;  1P7E A;  2KTF A;  4KGT A;  1OQQ A;  2BYV E;  2X27 X;  4IC7 B;  4OZA A;  5BO4 B;  2INN E;  1R4N B;  3N1Z C;  4WAF A;  3WIM A;  3NZS A;  1J0G A;  3U8Z A;  1QOA A;  1SJH D;  1V9J A;  3DHG C;  2K6Q A;  1HA5 A;  3T8M A;  4B6W A;  2ICI A;  1XEE A;  3LK2 B;  4ZHP A;  4A6Q A;  4S0R A;  1SJE D;  2YEP B;  4W9H A;  1E0Z A;  3DPD A;  5E6O A;  2BB6 A;  1UWX A;  1UH6 A;  2KDM A;  2GBM A;  2MEK A;  3BVM A;  1ZHX A;  4BKS D;  3N1X C;  3OJ4 B;  1V5T A;  3WAL A;  2D10 A;  1KTK A;  1SE9 A;  3AEB B;  3I9V 1;  2KK8 A;  1PFD A;  2WXP A;  4OZC A;  1BT0 A;  3GB1 A;  4AJY B;  4I6L B;  3NZU A;  3GP6 A;  3U2S C;  4DDG D;  1TKY A;  4N6E B;  4FAD A;  2R89 A;  1ZHZ A;  2XG6 A;  1PGX A;  2K5P A;  2AQ2 B;  2HTM E;  3X0W A;  1OFF A;  1CQV A;  3PGR A;  2BWF A;  3K9P B;  5BMI A;  3QRC A;  4DHJ B;  4N9F 4;  3W9C B;  4RL9 A;  3J9C A;  2ACZ B;  3BRY A;  3SD5 A;  2M0X A;  3K9O B;  4EE2 A;  4GCS A;  3BK1 A;  4AS1 A;  2ODJ A;  1XLP A;  2KN4 A;  3SFE B;  2LHE A;  1QT9 A;  2K0P A;  1KLU D;  5L95 C;  4PS8 A;  5EE1 A;  4BKG A;  3AU4 A;  4FN2 A;  2PMV A;  4M8N A;  3SU8 X;  2D3A A;  4YSZ B;  2D07 B;  4IWP A;  2LD9 A;  2PEA A; 
#chains in the Genus database with same CATH homology
 1XLO A;  4FRX A;  2EKI A;  2LFI A;  4D64 A;  4L1B A;  5C2T B;  1EU3 A;  1OPF A;  3AAA A;  5C3J B;  1ZHT A;  1N60 A;  1QJ8 A;  4HKQ A;  3AAE B;  2WXI A;  5HG2 A;  2KDY A;  2ZW0 A;  5ADX L;  1OQR A;  1TY0 A;  3BVG A;  3DA3 A;  2W81 C;  4FZN A;  4AYE C;  1I4X A;  1SE4 A;  2LFU A;  4PUX A;  1IUE A;  1E10 A;  4IKG A;  2YNK A;  3TUO A;  3MC0 B;  1N62 A;  4XDD A;  2KZ7 A;  4ARC A;  4AUI A;  1UGJ A;  3AA7 B;  5HHD G;  3KWV A;  3SZV A;  3ZJV A;  1I4R A;  3TSS A;  3O0E A;  1PUT A;  4GDK B;  1HXT A;  4LSE A;  4AZL A;  1OSM A;  3SYB A;  3PQS A;  3JTY A;  1T6B X;  1I4G A;  4C69 X;  1TS5 A;  2BS2 B;  2EEL A;  3NVW A;  4D2K A;  2AQ1 B;  3U52 E;  1V8C A;  1G90 A;  1ROE A;  1NVI D;  2WXN A;  3AEC B;  1ZXI A;  4KKI A;  3POQ A;  1JRO A;  2QSD A;  1WXQ A;  1VZ7 A;  2IGG A;  2J53 A;  1D5Z C;  2J4U P;  1V1P B;  3FC4 A;  4RCO A;  3C5O A;  2WXO A;  2JYT A;  1GAQ B;  2Y7S A;  3AE8 B;  3QRA A;  4BUM X;  3VE1 A;  3HUI A;  3BII D;  3BYT B;  3IXS A;  4LSI A;  4FZL A;  4GHB A;  4C7Z A;  1K52 A;  5DL5 A;  2Q5W D;  4O3Y A;  5AFU L;  3E9S A;  5EE9 A;  2KWD A;  3Q8C A;  4RFB A;  4ZYS A;  2V0G A;  3AAE A;  1GFO A;  3B2G A;  2N9L A;  1QOG A;  1N5W A;  2ON8 A;  3UPG A;  1N61 A;  2CJO A;  2Y0K A;  1I7H A;  2BS4 B;  2GE4 A;  1STE A;  3PZ7 A;  2L32 A;  1MPF A;  3P4S B;  6PRN A;  2PRN A;  1GPX A;  1FRR A;  4A8X C;  1WYG A;  2WXJ A;  2XE3 A;  1PGB A;  3TZG A;  3AE3 B;  5DL8 A;  3V8U A;  1RM6 C;  2DWQ A;  3FIL A;  4LLG M;  2LUM A;  4KR8 A;  2WU5 B;  4KGS A;  2FGQ X;  1SSN A;  3LYY A;  1L0Y B;  4GCQ A;  1PGA A;  2H88 B;  2KAJ A;  1YJI A;  3W2D A;  1P7F A;  4FT6 A;  2WLB A;  3BYY B;  3B9J A;  4OVZ A;  3AAA B;  4C80 A;  2OHF A;  2GB1 A;  1FNU A;  4XE0 A;  5JXV A;  1YNT E;  1WWT A;  1C9F A;  1HXU A;  1XXG A;  2JMM A;  4FOZ A;  4N59 A;  1F77 A;  2V4I B;  5D3D A;  2POR A;  4WH4 A;  3VQI A;  1F0Z A;  1HXX A;  4FRT A;  3AE5 B;  3AE1 B;  3H8H A;  1MPE A;  3EGR A;  3HVD A;  2R61 A;  2F1V A;  1NEN B;  3ETR A;  2JX5 A;  4B0E A;  2FE8 A;  2WDV B;  2FGR A;  5MPO A;  2E6X A;  2KMM A;  2OMF A;  1Q9G A;  2L52 A;  2DYO A;  2NTT A;  3NVZ A;  4IOI E;  2W80 C;  4DQO C;  3AM9 A;  2WNM A;  4GLS C;  1H6S 1;  4GF4 A;  3R8B A;  3KVD D;  4CQN A;  3P1M A;  3LK4 1;  1JWB D;  1SE3 A;  3MFG A;  1JW9 D;  2M56 B;  3AA6 B;  1ZP0 B;  1I4P A;  1FXA A;  3NVV A;  3NUH B;  5GV0 A;  5EE3 A;  1RYJ A;  3IAM 1;  1K50 A;  2WP9 B;  2PVO D;  3W5U B;  1NYQ A;  1MM4 A;  3T20 A;  3VRB B;  1WRI A;  4OZB A;  1E7P B;  4RGT A;  2W82 A;  2XTR A;  3ZJT A;  1GB4 A;  2KXP A;  3SY9 A;  1C78 A;  4ARI A;  1FNV A;  4KR4 A;  4FMS A;  3SEB A;  2ZLD A;  2KZ7 B;  1A70 A;  4HRS A;  3E56 A;  1L0X B;  3AE4 B;  3EUB 2;  1ZOY B;  1L0V B;  1BXW A;  4GDL B;  3I57 A;  4B0M A;  5ADX K;  3IT6 B;  1C77 A;  1TS4 A;  2LEK A;  1SB3 C;  2QIL A;  2Y5P A;  2WXH A;  3ABV B;  2NMQ A;  4AKR A;  3AA1 A;  1ZPS A;  1FIQ A;  2BBC A;  5AUI A;  4DXG A;  1FEH A;  1R7S A;  3POU A;  4FXC A;  3GP7 A;  4KRA A;  3SYS A;  4WWM A;  2J42 A;  3HW9 A;  1B9R A;  3LXF A;  2W3S A;  4RLB A;  1SXT A;  1N63 A;  5IYU A;  4YTN B;  3KWL A;  3W1S A;  3AEG B;  1FXI A;  4XWT A;  4MH8 A;  4Z3T A;  2KAC A;  1JWA D;  1YMH E;  1C4C A;  4D65 A;  2L1A A;  4O3W A;  4UDU C;  3ZQ4 A;  4FZM A;  2BT6 A;  5GXG B;  4FSO A;  3AA6 A;  4YTP B;  4RF1 A;  2MHL A;  3PQU A;  2PIA A;  4TQ1 A;  4YT0 B;  3FIL B;  3B2F A;  1IZN B;  1C76 A;  1YJJ A;  3ZGZ A;  1GFN A;  3AMZ A;  2ZFG A;  2QTK A;  4QQ1 A;  2DLB A;  2Y3A A;  3PRN A;  1WSP A;  3P4P B;  2J1N A;  1PDX A;  4P6V F;  1GFM A;  1TKG A;  2INP E;  1DOI A;  3OWE B;  1M4V A;  2RDH A;  1J7C A;  1DOY A;  5HI1 A;  4YXD B;  1MHX A;  2B76 B;  4OW0 A;  3NVY A;  4G76 A;  4AKR B;  2FBW B;  1TKE A;  2N0S B;  3POX A;  1J7A A;  2VZK D;  2KXP B;  1XF5 L;  4RGN A;  1VZ8 A;  2CJN A;  4JX1 C;  5D3I B;  1QF6 A;  1T5X D;  2AX5 A;  1CZP A;  2M19 A;  3RPF C;  2RDG A;  4ZOH C;  2GRI A;  3N9Y C;  5H92 C;  3U4E G;  2N7J A;  2TSS A;  4TSS A;  3P42 A;  2WS3 B;  3UAQ A;  1FFU A;  1Q9F A;  1D5M C;  4FUV A;  1JWS D;  1VRA B;  5HFY A;  3P4R B;  2DYM A;  2WDQ B;  4AYI D;  2QIE B;  3Q8F A;  1BUI C;  1L6V A;  1JQ4 A;  3T24 A;  1IGC A;  1GFQ A;  3PZ8 A;  3ZJU A;  2RPV A;  5FKA C;  4TQ0 A;  4FES A;  1ET9 A;  1V1O A;  2KQ4 X;  3HRD D;  1T3Q A;  2DBY A;  2SEB D;  1HZ6 A;  3CWI A;  2JYE A;  5H8Y E;  4F4B A;  3BWU D;  5AUK A;  1XLQ A;  4O4U A;  3LK3 A;  4LTU A;  2WXK A;  1YN3 A;  4HJG E;  4C7Y A;  3U7Z A;  1FD6 A;  3VE2 A;  4KX6 B;  1C79 A;  4MAC A;  4R3D A;  3ZYY X;  1IBX B;  2ERV A;  5FR3 A;  1SE2 A;  2I38 A;  4RNA A;  4US8 A;  2XTQ A;  3A2S X;  3Q8A A;  4AKM A;  1VZ6 A;  2MH7 A;  3KLS X;  4GCP A;  4YSY B;  4G75 A;  3G7G A;  1ZUD 2;  1HEZ E;  3URY A;  2H89 B;  1LO5 D;  2WXF A;  1E9M A;  1ZE3 D;  4KKJ A;  3SR6 A;  1PRN A;  4XWW A;  3V3X A;  5E6J A;  2N9K A;  2YEP F;  1BH3 A;  2K4T A;  2XE1 A;  3FYX A;  3Q69 A;  3R2I A;  2Y5C A;  3VRA B;  3TEW A;  3AA0 B;  1ZHW A;  2KC0 A;  4E1T A;  1NYR A;  2VZK B;  5T8I A;  4LSF A;  3DWM A;  4OHJ A;  4XDC A;  2YPV A;  2BS3 B;  2BW2 A;  4A9A A;  2K9X A;  1FMA D;  3DWG C;  1FNW A;  1N5X A;  3AA1 B;  3AE6 B;  2M06 A;  4YWG G;  3VZU X;  1CJE A;  4JWS C;  2GI9 A;  2XN9 C;  3V05 A;  5BYQ A;  4U9C A;  2IGD A;  3TEZ A;  5JDP A;  2LMC A;  4FSP A;  3UI3 A;  3GS2 A;  2WDR B;  3NSG A;  1EU4 A;  1FFV A;  1NI3 A;  2K3U A;  3AEA B;  4L2Y A;  2G1E A;  3BVZ A;  3P63 A;  1UWM A;  1L6U A;  3EMN X;  1K53 A;  5DL6 A;  2N2M A;  3WCQ A;  4RJW A;  3AH7 A;  1SBB B;  1MVK A;  4AYN A;  4AFK A;  1THQ A;  2X38 A;  4US9 A;  1JAL A;  2AQ3 B;  2QMT A;  1XCQ L;  1GFP A;  1KLG D;  1QQR A;  1TZO A;  5EE0 A;  3LB8 C;  2M0A A;  3T0S A;  1HZ5 A;  3EA6 A;  3TEX A;  2K0L A;  3DA4 A;  1IZN A;  3Q8E A;  1BML C;  2PW9 A;  3L4P A;  2MNH A;  1E6E B;  1XLN A;  1YQ4 B;  3P4Q B;  1QJP A;  4C56 C;  5BMH A;  2XE2 A;  1ZXH A;  4XNK A;  2JQR B;  2QJL A;  4KGR A;  4YSX B;  1AW7 A;  2Y0L A;  1C4P A;  1L4D B;  2W54 A;  3LK3 B;  1ACC A;  2WXG A;  3HOL A;  2CU3 A;  4ZRQ A;  3AB5 A;  1JWM D;  1KRH A;  3SY7 A;  3POR A;  1YN4 A;  1ESF A;  1SIJ A;  4JPS A;  2LJI A;  1V97 A;  3BK2 A;  4RH6 A;  3HOE A;  4Q2J A;  1I4Q A;  4O3Z A;  1KH0 A;  1C4A A;  2QEJ C;  3T3O A;  3KQ4 A;  2PKO A;  4NAW B;  2K22 A;  2Z8L A;  2N2L A;  2BTE A;  1HXY D;  5D5D A;  1KFY B;  1TJE A;  1UNS A;  5PRN A;  4IDI A;  5G5H A;  1FCL A;  1D6E C;  1AWD A;  2E3T A;  2G9H D;  2IJ0 A;  1YN5 A;  2M07 A;  4WUR A;  5FK9 C;  3TEY A;  3IAS 1;  2NTS A;  2J4X A;  1DGJ A;  3MHZ A;  2V3N A;  4J3O D;  2XE5 A;  1FRD A;  1YS5 A;  2V3P A;  1Y56 A;  4XNL A;  1F2R I;  5I4D A;  3LK4 2;  3FAH A;  2IDY A;  1IGD A;  4USA A;  1K51 A;  3SFD B;  4AQ7 A;  2IPK D;  1IBX A;  1D4B A;  1VJK A;  2IGH A;  2L83 A;  2LHF A;  4N58 A;  4RJX A;  3WI4 A;  4YTM B;  3VY9 X;  4MM3 B;  2RMM A;  2J52 A;  4MT5 A;  5G26 A;  4L23 A;  1DOX A;  3HVZ A;  1B1Z A;  1JML A;  1F2R C;  3AV8 A;  1SEB D;  1RWS A;  1AYF A;  2JZP A;  1KF6 B;  1XO3 A;  3W5V B;  1BXT A;  1JCK B;  4NZL B;  4H2A A;  3MJ5 A;  5BMG A;  4ZHO A;  2WQY B;  1I4H A;  4B61 A;  4LK0 M;  3K19 A;  2HDE A;  1XCT L;  2W55 A;  3NS1 A;  5AFU K;  5T5F A;  4NAM A;  1L4Z B;  4O4X A;  3HWB A;  1P7E A;  1GOZ A;  4NJC A;  3AEE B;  1AN8 A;  5DL7 A;  2LGI A;  1ORM A;  3Q8B A;  4KGT A;  1OQQ A;  3UU2 A;  2XNA C;  1Q10 A;  4A90 A;  2X27 X;  3AA0 A;  1ET6 A;  4AYM C;  2PLP A;  4HRO A;  4OZA A;  2D5G A;  2Y0H A;  2INN E;  3BZD B;  4WAF A;  2SAK A;  1ZDV A;  1WGK A;  1ZHY A;  2MJD A;  1SF0 A;  1QOA A;  4HKZ E;  1SJH D;  4REZ A;  5TSS A;  4O49 A;  4ZRP A;  1HA5 A;  1EWY C;  3LK2 A;  1XEE A;  2ICI A;  4ITK A;  1FM0 D;  3LK2 B;  1J7B A;  5D7G A;  3VY8 X;  4A6Q A;  4ZHP A;  1QKZ A;  4RGM A;  1SJE D;  2WXQ A;  2YEP B;  1E0Z A;  3RBH A;  4JCH A;  4E1S A;  1QJ9 A;  1ENF A;  3NRZ A;  4A55 A;  1FO4 A;  3R2T A;  2BB6 A;  1UWX A;  1JWU D;  2KDM A;  2MEK A;  1HQR D;  1MM5 A;  1MI0 A;  3AE7 B;  1TS3 A;  3BVM A;  1QOF A;  2LHD A;  2PTL A;  1MHH E;  1VR9 A;  1ZHX A;  3WI5 A;  4TMA B;  2JU6 X;  1KTK A;  1QLB B;  1EWC A;  3AEB B;  3I9V 1;  1BT9 A;  3AEF B;  1PFD A;  2WXP A;  3IT4 B;  4OZC A;  4P16 A;  3GB1 A;  4WQM A;  4HEA 1;  3GP6 A;  3U2S C;  3MP9 A;  3VR9 B;  3VZW X;  1TKY A;  4RGO S;  4N6E B;  4JE3 B;  2ZW1 A;  1ZHZ A;  2XG6 A;  2JXT A;  2BYT A;  4M0W A;  1PGX A;  2K5P A;  3AED B;  4JWU C;  1PHO A;  1E54 A;  2F1T A;  2AQ2 B;  4O3X B;  2W3R A;  3NZ3 A;  2OED A;  2HTM E;  4JFB A;  5EE2 A;  2FUG 1;  2WXL A;  1OFF A;  1QOB A;  2BB5 A;  1CQV A;  2MJ3 A;  1RFK A;  2O4V A;  1VDV A;  5BMI A;  1TY2 A;  3QRC A;  4RLC A;  3AN1 A;  3AA7 A;  8PRN A;  3W9C B;  3CIR B;  1GB1 A;  3VR8 B;  1V1P A;  2WU2 B;  1UUP A;  2WXM A;  4RL9 A;  1PYW D;  3J9C A;  2ACZ B;  5BYS A;  3PO0 A;  3AE2 B;  5LNK 1;  3VZT X;  2MJE A;  4EE2 A;  4GCS A;  1FCC C;  3BK1 A;  4AS1 A;  2ODJ A;  1VLB A;  1XLP A;  1ZDX A;  1QIL A;  2KN4 A;  1DYQ A;  3SFE B;  2LHE A;  1L5P A;  4WIP A;  3SZD A;  3O13 A;  1QT9 A;  1YQ3 B;  3AE9 B;  1NEK B;  2K0P A;  1KLU D;  2Y2X A;  1TS2 A;  2XMX A;  5EE1 A;  3C8Y A;  1CK1 A;  1TYG B;  2WXR A;  4RF0 A;  4D5U A;  4AYD C;  3RFZ B;  1EM7 A;  4DXF A;  3T3N A;  2PMV A;  4O1N A;  5FVN A;  7PRN A;  2I2Y A;  2JSV X;  4YSZ B;  1JRP A;  1D5X C;  2ONQ A;  1P4T A;  4PT5 A;  4LSH A;  5G5G A;  2JWU A;  2PVG C;  5BYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...