4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectocin M2
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
molecule tags Hydrolase
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
4FZNA 2QIEB 3NVWA 1NENB 1QOBA 1QLBB 2W54A 4HRSA 3DWMA 3RPFC 3W5UB 1AWDA 4JWUC 2PIAA 2K5PA 1RWSA 1FXAA 3FAHA 3AV8A 4LTUA 3VRAB 2BS4B 2AX5A 3B2GA 3B9JA 1OFFA 1WXQA 1ZOYB 2MH7A 5G5GA 3WCQA 4HROA 3AMZA 1YJIA 1ZP0B 2QJLA 1VJKA 3HRDD 3NRZA 3AEBB 3P1MA 4US9A 1B9RA 2H89B 1FFUA 3CWIA 1FXIA 3AE6B 3VRBB 2OHFA 3ZYYX 1RFKA 1E6EB 3LB8C 3VR8B 1WGKA 1JQ4A 1CJEA 1FFVA 2H88B 1N61A 4YXDB 1I7HA 1SIJA 4A9AA 1E0ZA 4IDIA 3AEFB 1R7SA 3AEGB 1JWAD 1N63A 2K22A 2W3SA 3P4SB 5EE9A 4G76A 1J7CA 3ETRA 2BS2B 5GXGB 1XLNA 2WS3B 1PFDA 1VDVA 3LXFA 4C80A 1ROEA 5C2TB 1QF6A 2E3TA 1DOXA 2MJEA 2Q5WD 2BT6A 3SFEB 1KRHA 1CZPA 3VR9B 2M56B 1E10A 1EWYC 2WDRB 4YSZB 3AM9A 1F0ZA 1UWMA 1YQ4B 1N5XA 1N60A 1ZXIA 3AE8B 3SFDB 2JQRB 1XLPA 2L83A 1FO4A 2N0SB 1N62A 1NI3A 1XLOA 4USAA 2DWQA 3HUIA 1XLQA 4JX1C 4JWSC 2KMMA 3DWGC 1GAQB 2K9XA 1DOIA 2CJNA 2PVOD 3DA4A 1JWBD 1L5PA 4US8A 3EUB2 2HTME 5AUKA 1PUTA 2W55A 2Y5CA 3P4PB 3AECB 3AH7A 1KF6B 5MPOA 1YQ3B 1V97A 1YJJA 2JX5A 1QT9A 3AE7B 2XTQA 1GPXA 2WDQB 2ACZB 2MJDA 4YTPB 1QOAA 3NVVA 3AE1B 4C7YA 2DBYA 3ABVB 1NEKB 1QOFA 1L6VA 1NVID 1FIQA 2KAJA 3BIID 3HVZA 3NS1A 1RYJA 4N59A 1JW9D 5EE3A 1SF0A 1TKGA 5C3JB 1TYGB 1TJEA 2FBWB 3KWLA 5H92C 1AYFA 3AE9B 5EE1A 3AEDB 2WU2B 2WQYB 1TKEA 4YTMB 3P4QB 1N5WA 1FM0D 2B76B 3B2FA 1KFYB 3AE4B 4WQMA 3L4PA 4N58A 4YSXB 1PDXA 1FRRA 1QOGA 1VLBA 4FZMA 1A70A 4FZLA 1FMAD 1L6UA 3PO0A 4FXCA 2WU5B 2CJOA 4YT0B 2XMXA 3SR6A 1JALA 5AUIA 2M19A 1E9MA 3W5VB 3P4RB 3NVZA 2CU3A 1WWTA 1WRIA 3AN1A 4C7ZA 1OQRA 1JRPA 1NYQA 3NVYA 2WDVB 3AE5B 5EE0A 1ZUD2 3AB5A 1DOYA 4P6VF 2WP9B 2W3RA 1OQQA 2MJ3A 3AE3B 4G75A 2BS3B 2G1EA 3CIRB 2LEKA 1RM6C 4ZHPA 3AEAB 4ZOHC 2WLBA 4ITKA 4ZHOA 2XTRA 1T3QA 1WYGA 1NYRA 4YSYB 1FRDA 1L0VB 3W9CB 4KX6B 3AEEB 4N6EB 2EKIA 5G5HA 1J7AA 1DGJA 2PVGC 5H8YE 3DA3A 1V8CA 1IUEA 2PKOA 3FC4A 1E7PB 3AE2B 1XO3A 1SB3C 2L52A 1JROA 1TKYA 1J7BA 4WWMA 4YTNB 3P63A
chains in the Genus database with same CATH superfamily
3ZJUA 2QIEB 3T3OA 1SE3A 2Y3AA 3B0AA 5E6JA 1AWDA 4ARIA 4Z3TA 3PV1A 5T8IA 2BS4B 2AX5A 5TISO 2PE9A 4GCSA 1C77A 2IPKD 2IWVA 2W81C 4OW0A 4OZAA 2K25A 1UF0A 4FJVB 1WGDA 4O3XB 3U7DA 4GDLA 2FIFA 2AXTO 1T1LA 5IN7A 4MM3B 4G76A 3ETRA 2BS2B 5GXGB 1MM4A 1RAXA 3LXFA 3LK41 1D5MC 7PRNA 3PLVA 1P7EA 1PYWD 4AWJA 1TY2A 2LXAA 3RMKC 1E10A 1YQ4B 3S2AA 1F2RI 2KDBA 3Q3NC 6PRNA 3X23A 4D2KA 4FSPA 1GAQB 1ZKHA 1HA5A 2CJNA 2GOWA 2OEDA 3DA4A 3VUWA 2LHEA 2ODJA 5D7GA 2XNAC 2KYWA 3L0WB 1EWCA 2XK5B 4UDUC 4FQEA 2L05A 1HZ5A 1M4VA 3NVVA 5AFUK 3ZXRA 4W9HA 2KAJA 3HVZA 2YPVA 4L23A 5EE3A 4TQ0A 5LNK1 1P4TA 5KAFO 2RMMA 2GBNA 3I3TB 2ICIA 2FCSA 3B2FA 1KFYB 1C4PA 3FYXA 1VLBA 3AA0B 3JYUA 2KJHB 3PGEA 2M19A 3BRYA 2D07B 4A55A 1ET6A 3V61A 1RM6C 4ITKA 1K8RB 1NYRA 3LK2B 1L0VB 3BINA 2ZVNA 2PJHA 4MH0E 1E7PB 2WXQA 1TKYA 2R8AA 4B0EA 2M4NA 4ICUA 3D32A 2BGFA 2MP2B 1F9JA 4KKJA 1L4DB 3Q3JA 4MDKE 3W1YA 4F4BA 1OPFA 1OFFA 4WJPA 2MH7A 5BMHA 3DBRI 5EE2A 3HRDD 1E8ZA 3IHPC 3NRZA 3IAM1 3Q3FA 2Z8LA 1HZ6A 4AYID 2JYEA 2HTHA 3A9KA 4E1SA 3WIMA 5J2RA 1WXMA 3TEWA 2L00B 2J7QB 2G45B 2W9NA 3UF8A 4TUUA 1E7VA 2AL3A 2N2LA 2BT6A 1CZPA 2LASA 1OGWA 2KQ7A 4YSZB 3AM9A 3SFDB 2ZPYA 1OQYA 2IY0B 1IBXB 2DNFA 3HHMA 4KZCA 1G6JA 3NG0A 3AH7A 1KF6B 5MPOA 4N75A 1XCQL 4FHJA 2AQ3B 4RLCA 4K1RB 5JH5C 2VH1A 2DHZA 3ABVB 5J18A 2Z59B 3H7PA 1ESFA 1JW9D 3ZO5B 3AU5A 4J6IA 5H92C 2QMTA 3PRMB 3PVLA 4RGOS 2LVPA 2J53A 3POQA 2XE3A 3A4RA 1S5LO 1T0SC 1WRDB 4O3YA 1VCBA 4HDQA 1IZNA 4HKZE 1IGCA 1TS4A 1LGRA 2FNJB 3NVZA 2NTTA 3DBRB 3VUXA 4R3DA 1WH3A 1ZUD2 4I6NB 3AAEB 3AXCA 1WYGA 3VZUX 3AEEB 4N6EB 4MH8A 1MVKA 4AKRA 5B5EO 1HEZE 2PKOA 1LFDA 1Q0WB 2R2QA 2MBOA 2JZ3B 4XNKA 2L52A 3N1ZC 1CMXB 5IP4D 5G38A 3MC9A 4WJOA 1WJUA 1J19A 1NENB 5BMIA 4GDLB 1QZEA 3EC8A 4W9DA 2NCNA 4NNJB 5GTIO 1WX9A 2AEHA 3HWBA 3QCAA 3VH3B 1UGMA 3B9JA 4AS1A 3NZ3A 3EA6A 1MFWA 3GE3C 4C69X 3AEBB 3TZGA 3SU8X 2JU6X 2GLSA 3AE6B 3BVGA 3MFGA 2M1MA 2JZZA 3OJ4B 4JPSA 2INPE 2ZPNA 3KQ4A 3N32A 2GBMA 1SGHA 3FILB 1TBEA 2JXXA 3U52E 1FNUA 1P9DU 1VDVA 4MEMA 2BVCA 2RPQA 4WH4A 2ASQA 3T20A 2BW2A 1UD7A 1PRNA 2GMIC 5C23A 5PRNA 2IJ0A 3B08A 2KVZA 2K8HA 3H7SA 5D94A 1H6S1 2GI9A 2K9XA 2WNMA 4ZRPA 2FIDA 4DWFA 5HFYA 2KFKA 2AQ2B 3U8ZA 3T9LA 3UPGA 3NS8A 2KDEB 2XEWA 2IDYA 5CHWA 5KHOA 4OZBA 4LDTB 2ON8A 2LRUA 2WU2B 3TBLD 2WHIA 4NY0A 1GFPA 2KHWB 3RNBC 2WXOA 5FR3A 2R88A 4BOZB 5HI1A 3HOEA 2WXPA 2WVPA 4EFOA 4JL9A 4GIVA 4FT6A 2G1EA 2WXFA 3PZ7A 4ZOHC 1XEEA 2L3ZA 4IG7B 4B0MA 3PS6A 4XE0A 1I35A 3DHGC 2ZNVC 4GCQA 3UIOB 2J0KA 1Y8RC 3P63A 3DBSA 4TSSA 3MJ5A 2FCNA 5E6PA 2F1VA 2Y2XA 2R89A 1WGRA 2LWPA 1MJDA 4EKUA 1GC6A 3MHZA 2V3NA 2L1AA 2I38A 2KT7A 1VJKA 1ZXHA 4US9A 5B66O 3Q8BA 1E54A 2KZRA 2BTEA 3PRZA 2G4DB 5LXHA 1V81A 2PPHA 1UBIA 3AEFB 4XZ4A 3TIXA 2GBJA 1MG8A 1KTKA 3APCA 5ADXK 2KDMA 5LXIB 2IO0B 3TEYA 2K6DB 3NUHB 1Q9FA 1EM7A 4A3PA 2PEAA 3H7PB 4M8NA 4LK0M 1V6EA 3VR9B 3C0RB 4HDOA 2WXLA 4USAA 1Q5WB 2X38A 3SDLC 2C5LC 3VY9X 2HE7A 1IZNB 2C7HA 3EECA 4DHZB 1WY8A 2KKCA 4RGTA 2IY1B 4O49A 1SSNA 3BIID 4A8XC 1WJ4A 5C3JB 1KOTA 1UGJA 2V4IB 2MBHA 2L0FA 1TKEA 4AKRB 4HLEA 1VR9A 5D5DA 4LDTD 4PUXA 3HM3A 2WX1A 3BK2A 1AN8A 2WU5B 2MBQA 1YS5A 1JALA 1V80A 1L0YB 1K52A 3V3XA 3L08A 3HIZA 3AEAB 1XD3B 1VZ7A 3UQAA 3EFCA 1HTOA 1MM5A 2YNKA 2PE6B 2I1KA 3WI5A 2KWCA 4RH6A 1HXYD 2G3QB 2LMCA 2PTLA 3UGBB 4GDKA 1AW7A 1NDDA 3IXSA 3FAHA 3DZMA 3WCQA 4URKA 1WXSA 4PJ0O 4KGRA 2JZPA 4AYNA 4BAXA 2M8SA 1FFUA 3CF6E 1FXIA 2CS4A 3VTVA 3DBHI 3C8YA 2OHFA 2FCQA 2R4LA 1OEYA 5E79O 5I4DA 2NTSA 2KFKB 1PQSA 1JWAD 4BBNF 4ZDVA 3RNEC 2XG6A 2BB5A 1QQRA 4XDCA 2XE1A 4W9CA 2KDYA 1N60A 2D2QA 2J0MA 1IPGA 2BQQA 2N0SB 4PT5A 4MGZE 1KJTA 4DXAB 2BYFA 4LNOA 4W9IA 4I6LB 2BWFA 4RGMA 1Q1OA 4EE2A 1CQVA 3O13A 3A0BO 2KQSA 4JIOU 4QQ1A 2GB1A 1PUTA 1QILA 3ZW3A 2DZMA 2KJRA 1ZHWA 3QIJA 2INDC 1OTRB 1QOFA 4N9F4 4IL6O 3NJTA 3BYTB 4HEA1 2BBCA 2DX5B 3L4PA 3PSEB 4WAFA 3Q8CA 3V8UA 2KXPA 3DVGX 4FXCA 3V6CB 1D5ZC 1UWXA 3EMNX 4FJYA 4MT5A 4FADA 4MSMB 5E6NA 3TMPB 1WXVA 3M95A 4WURA 2CU1A 3DBHB 3DVNU 4OVVA 3IBEA 4PS7A 4KSKC 1Q10A 5LLIA 4WWOA 1WR1A 1L0XB 4AZLA 2WXIA 1IUEA 1WGHA 4W9FA 2L7RA 3R7RA 3V6EB 3VZWX 5IKCM 2ZZPB 3NVWA 2YVCA 1YMHE 2W54A 3W5UB 4JWUC 2PRNA 3AV8A 1EUVB 1T6BX 4AYEC 1V1PA 2L8JA 3RULA 3P1MA 3R66C 4RL9A 3CWIA 2WJRA 1GFNA 3X0WA 4XNLA 3A4SC 4IM0A 3R2TA 2DYBA 3H8HA 1E6EB 3VR8B 1Z2MA 2H88B 3LJ3A 1R4MB 3WU2O 1YN4A 3RNAC 3A9JB 2W3SA 1SE2A 3T8MA 1ISNA 2RPVA 5JZEB 5EE9A 4BFRA 4N74A 3AA1A 1DOXA 5HG2A 2KANA 2M0XA 3SFEB 2Q5WD 2J52A 3ZXVA 2JF5A 1ZXIA 2CHXA 1TS5A 4P16A 4D65A 2D3AA 3KYCD 4ARCA 2FGRA 4E1TA 4HCPB 2R2OA 3APDA 1HE8A 3PLUA 3SEBA 3V62A 1V97A 3PORA 1J8CA 3I9V1 3OG5A 1GPXA 3WA0A 4ZYSA 2O2VA 3NOBA 1FD6A 1C79A 4NJ6A 4KR4A 3QARA 1UH6A 1V86A 4CYEA 2EKEC 3T24A 3UQBA 1H4RA 3ZNZB 4LNFA 4DXGA 3KYDD 1SJED 1L6UA 3PO0A 3GE8C 3SYSA 3RBHA 3SZVA 3EHVA 3U2SC 4D5UA 3K9PB 2MX2A 4P7IA 1AARA 3G7GA 3CIRB 4G75A 4TV3A 4IM2A 5DPSA 3BZDB 5G5HA 4RLBA 2PVGC 4EZLA 3AU4A 5H8YE 1WM2A 3AA7B 1XT9B 4JGHB 1YN3A 4FBJB 2N7DA 2NVUI 4JLCA 4WWNA 4WWMA 1SB3C 1YJ1A 4HK2A 4YTNB 1STEA 3JVZX 2Y7SA 1QOBA 3RPFC 1BXWA 3K9OB 4KGTA 4FSOA 4FESA 2FUHB 3PZ8A 3BS0A 5G5GA 4JQWC 3A0HO 5AFUL 1KLUD 4E74A 3OLMD 1UELA 1T5XD 2LUEA 2WXJA 3VDZA 3ALBA 2HJ1A 2V3SA 4C4VA 2WXHA 4O3ZA 1HXTA 3ZYYX 4K3BA 4MELA 4HJGE 5EDSA 1E0ZA 2ONQA 2K22A 4DDID 1D3ZA 3Q2AC 5BYRA 3Q8AA 1J7CA 4YL8A 4C80A 5TSSA 3MHSD 4KIKA 2YLMA 1GC7A 1EWYC 1U4AA 2JSVX 1PGXA 2L83A 3BK1A 4B9KA 3P42A 4TKNA 3IVFA 4JWSC 2KMMA 3DWGC 2WXMA 2RSUA 2PVOD 1TTNA 3E56A 2JMMA 1QT9A 3DOWA 1EF1A 3DWOX 2QHOA 3JW0X 3SYBA 4HXDA 2KN4A 1C4CA 4N59A 2AL6A 4CO7A 4MSQB 1I42A 3QWZB 3TUOA 1IYFA 2PLPA 1TS2A 4WQOB 2K8CA 2R4NA 3AI5A 3PF1A 5G3AA 1TS3A 5HHDG 3KVDD 2ZNVB 5D2MB 1DOYA 1G90A 5BMGA 3M63B 1F77A 2WLBA 4BBNC 1DGJA 3DWNA 1V8CA 4DHZE 3GP7A 2AYOB 2BF8B 1C76A 3H1UA 4X57B 5IA7A 2ZCCA 5G26A 1KLGD 2C7MB 4GMVA 8PRNA 2QILA 1RLFA 3PHXB 4O4XA 4KZ0A 4FJZA 4HKQA 3AA1B 4FUVA 1ZOYB 2KWUB 2KN5A 4ZYNA 1SIFA 2H89B 4M8MA 2V9HA 3R7QA 4U9CA 4DK5A 3ZRCA 3IG3A 4FN2A 1XXGA 2V0GA 1C78A 1WX8A 5JDPA 1S3SG 1LQBA 1SIJA 4YXDB 4AJYB 5JXVA 1T0RC 4AKMA 3WANA 2K1FA 2MBBB 1WSPA 2O2VB 3AULA 4ANVA 4BUMX 4QAYA 4REZA 3VUYA 2I1JA 1JWUD 2X9KA 3UAQA 1XLQA 4DXFA 4NQKE 1K50A 4RMAA 1MPFA 1GFMA 1ZGUB 3ZJVA 3T3NA 3EUB2 1SEBD 2NBVB 3PQUA 3ZNGC 1WXAA 3RCZA 1FEHA 1FIQA 3NS1A 4K3CA 1JMLA 2IWWA 2LJ5A 5EE1A 1QJ8A 4MGIE 4ZRKA 2KMCA 1WE6A 1VZ8A 2RDBC 2CJOA 3W5VB 1WJ6A 1OQRA 5EE0A 4DBGA 2MEKA 1MHHE 4W9EA 2JWZA 1WIAA 4ZHPA 1KH0A 3GS2A 1MPEA 1SE9A 3WAMA 4P1BC 3N1XC 1V1OA 4GB9A 1JWMD 2IBIB 2KK8A 4AJWA 4MACA 1ENFA 4BVUC 3QQ8B 1I4PA 1C3TA 2K8BA 1YNTE 2DZJA 3BVMA 1FXAA 4ANXA 1D4BA 2L76A 4KV2A 1WXQA 5DL5A 2O4VA 3AMZA 5IYUA 4KIKB 2DAFA 2QJLA 3KW5B 3RN9C 3VRBB 3POXA 2D10A 3ZIMA 2Z0DB 3ZUNA 3A9KB 1FFVA 4ZRJA 1Z5SB 4GU2A 1N61A 2LGIA 2WWZA 4A3OA 2JRIB 1RRBA 4DHJB 2N7EA 2KC0A 1I4RA 1SE4A 5DPWA 1QF6A 1P0RA 2MJEA 1WR6E 3RZWC 1NBFC 2HJ8A 3AE8B 2OJRA 5IO9A 4ANUA 1WZ0A 3HUIA 4HPLB 3U4EG 2KO3A 1WMHA 3H6NA 3GZNI 1HXUA 2KMAA 1DOIA 4E71A 3MC0B 2O6VA 4RJXA 1HXXA 2INCC 4G50A 2ZVOA 3AE7B 3AAAA 2JXTA 3GB1A 3R8BA 4FLHA 3ZQ4A 1QJ9A 1TZ1A 3C19A 1NVID 2KZ7A 2KLGA 2KX0A 2ZCBA 4G3XB 3A33B 1LM8B 3AEDB 2D3GA 3DVNV 3AE4B 4YSXB 2D11A 1QOGA 3RYTA 5GTHO 1K51A 4FZLA 3KLSX 3LK3A 4M0WA 4C7ZA 5CHFA 2WDVB 2KWVB 4MGKE 3N1YC 1E8WA 2XTRA 3WI4A 3O0EA 3KUDB 5E6OA 3RNFC 5L83A 3ZGZA 3RFZB 2KVRA 2LGDA 1P7FA 3ZVVA 4OHJA 4PS3A 2D3BA 1VD2A 5GMVA 4RJWA 2PMVA 1GOZA 2PIAA 1GFQA 2GE4A 2D3CA 1FCLA 2MSED 3K19A 1WGYA 3UINB 1NI2A 3ZNID 4GHBA 4GLSC 4RF1A 4W9KA 4K7WA 2KDIA 4NAMA 2M07A 2BYVE 4RM8A 1WZ3A 2KLCA 2MCNB 1CJEA 3RI7C 3QRAA 3NZUA 3QX1A 2WXNA 1FCCC 1PFDA 4DHJD 4OZCA 4RFBA 2CR5A 2DZIA 4F1SA 2L32A 1ZHXA 1TY0A 2N9PC 3CMMB 1H8CA 1XLOA 4LJPB 2DWQA 4JX1C 2MA9B 1CK1A 2NMQA 1X1MA 3IT4B 1C4AA 2Y0HA 2HTME 1PGAA 3P4PB 1YQ3B 2I2YA 5AEKB 2ZFGA 3AE1B 3CSFA 2KOXA 2GBKA 4IWOA 1ORMA 4FMSA 1V9JA 4GGQA 1SBBB 2KNBA 2WQYB 2VRRB 2J4XA 3IAS1 4IC7B 2Y0LA 2PW9A 4A6QA 4OVZA 2XMXA 2JWUA 2MLBA 5J17A 1XCTL 2MHLA 2IO1B 4IOIE 2OOBB 2BS3B 3A1QA 5BYSA 1K53A 2V4LA 4UB6O 2EKIA 3KWVA 3VZTX 1BMLC 4WJNA 3GOEA 2AQ1B 1JROA 4CTDA 4TMAB 4FZNA 1MHXA 4LNNA 1D5XC 1WM3A 2K5PA 3L54A 4WWPA 4LTUA 3VRAB 4C00A 3B2GA 1YJIA 2CHZA 3U30A 2K0LA 3VAWA 1BXTA 3ZTDA 1XQQA 4BKTA 3SY9A 3LB8C 1WGKA 1WMHB 3VQIA 4XX5A 2C9WB 2ZW1A 4GCPA 2MRPA 4IDIA 2O6VB 2EMSA 1N63A 2VH2A 4NQLB 1UNSA 3N30A 3P4SB 3AAAB 1XLNA 4LCDE 4A90A 2BYTA 3E9SA 2LGXA 2WYQA 1ZHYA 2KZ7B 3Q6BA 3DPDA 3JCUO 3UI3A 2Y5BB 3OJ3A 1JWBD 1L5PA 4DDGD 1WE7A 4H2AA 2Y5PA 3LK3B 4M0WB 4IWPA 2KWDA 2JX5A 4LSHA 2DAJA 2ACZB 2SAKA 2QDFA 4C7YA 2XBBC 4ACFA 2JQYA 1FNVA 1IP9A 2N9XA 4FHKA 1P1AA 1TKGA 5D3DA 2INNE 3O65B 4C56C 2DYMA 4YTMB 3P4QB 1N5WA 2B76B 5GV0A 2NBWB 3B1LX 5BYQA 2KXJA 4N58A 5HKHA 1FRRA 2X27X 2V1YA 4FZMA 2RGFA 3MP9A 2WJQA 2J1NA 1E8XA 3KZIO 4PK1A 2C7NB 2E6XA 2Y0KA 3I57A 4BKSA 1WWTA 1WRIA 3TJPA 1YQBA 3AE5B 3AAEA 4P6VF 2LXCA 4YWGG 2MJ3A 1R4NI 3RD2A 2JY6A 2LEKA 5JHBA 3PZDA 2J4UP 1T3QA 2NS5A 1V5TA 1WJNA 4B95A 4EZJA 1WI0A 4K7UA 1P3QU 2KTFA 4AYDC 1A5RA 1HQRD 3AE2B 1J7BA 4AYMC 2R4OA 1RFAA 4KRAA 1GG3A 2KACA 1ZW7A 3DWMA 4GDKB 5AZFA 4S0RA 3C5OA 2LJIA 1RWSA 3TCAA 1I4GA 1I4HA 3MJWA 4FA6A 3U7ZA 4KKIA 3QK0A 4KDIC 4J3OD 1ZP0B 3LYYA 3ECIA 2KC1A 2J0JA 2RD0A 2CKHB 2LVOA 3VH4B 2NPTA 2FE8A 2HDEA 4A9AA 2IGDA 3FILA 3ML9A 4RM9A 1F52A 1YN5A 1BUIC 2O6VD 4LJOB 2JUOA 5L95C 1QJPA 5KAIO 1I4XA 2AWTA 4ZRIA 1VRAB 3L16A 1XLPA 2L0TA 3PHWB 4ZRQA 1N62A 2IZVB 3BRZA 3Q8FA 2G9HD 1ET9A 1KM7A 3ONSA 2XE2A 2N9LA 1Y56A 4XYCA 1R4NB 1T16A 2WDTB 1L2NA 4ANWA 2LZ6A 4LSFA 2YEPF 3A1QB 3L13A 3N20C 3VHTC 2FBWB 3NHEB 3HM6X 2M17A 1TT5B 5FK9C 2F1TA 1GB4A 3DHIC 4HVBA 4WQMA 1EU3A 2V3PA 1A70A 2KXPB 1ZDXA 5IAAC 4S17A 4LLGM 4LNKA 5AUIA 4WJQA 3PT2B 2DYOA 3PREA 3ZKJC 3M3JA 5CX3A 4NAWA 1JRPA 4RNAA 4IUMB 4L1BA 2W3RA 3AE3B 5T5FA 2DENB 4LSEA 4WIPA 3R2IA 2CHWA 3SHQA 5DL7A 4GF4A 2KJ6A 2N1VA 3V60A 4II3B 3ZJTA 1P98A 3KUZA 2OMFA 2K4TA 3OWEB 1V49A 2J42A 3QJZA 1V1PB 3KH0A 2K6QA 1ZHZA 1GFOA 2K0PA 3N9YC 2UU7A 5FR6A 3FKYA 3AA6A 1D6EC 1THQA 3RT3B 2LD9A 2N9EB 4W9JA 4BKGA 4MJSA 5JHAA 2JT4B 1PGBA 1WF9A 3SD5A 2NR2A 4NPNA 3UIPB 3R3MA 4PYZA 3JTYA 4RF0A 2JRHA 1M94A 2JQRB 3QHTA 5CTRC 2DZKA 2PORA 3I63C 2A5UA 1EU4A 3MTNB 4GSWA 1ZDVA 4K81A 2M0AA 1VZ6A 3PGRA 2W55A 2Y5CA 3JSVA 4LSIA 1ACCA 3VE1A 3BWUD 4BOSC 3BY4B 4YTPB 1YD8U 3NZSA 2KC2A 2QEJC 1NEKB 2YEPB 1E8YA 1LO5D 1TYGB 4HJKA 1AYFA 4AFKA 4GXBA 3VTWA 2KDFB 5IOIA 2W82A 4O1NA 3PGUA 3POUA 4FRTA 1PDXA 2LHFA 4O4UA 5H2FO 1BT0A 1OSMA 4E3CA 3SR6A 2KD0A 2KTRA 2IO2B 1E7UA 3M62B 2FCMA 4LNIA 2RDGA 2QTKA 4AQ7A 3URYA 1TZOA 1J0GA 3AB5A 2JPHA 1OQQA 3IFWB 4WAAA 4ZHOA 4YSYB 1FRDA 4KX6B 2QSDA 1J7AA 5AZHA 1YX5B 4IKGA 3TEXA 2NPTB 5DPRA 3APFA 3L17A 2GBRA 4RCOA 4KSLC 3I5JC 4HRSA 3VY8X 1YX6B 1GNUA 1E90A 1T0QC 2VZKB 4FRXA 4PR7A 4I6PA 4D64A 3P2BA 5G2NA 1B9RA 1T0YA 3WAOA 1FNWA 5G39A 4C4VB 2ZW0A 3TSSA 3DQVA 1JQ4A 5DL8A 5D3IB 5FKAC 1EF5A 1F2RC 3VTUA 4M02A 1R7SA 4AUIA 3V05A 2B3AA 3W1SC 4XWWA 3ZTCA 4JE3B 1WGGA 1E5WA 2WS3B 4NZLB 2BKFA 3LDZE 1KLVA 3ZNHB 2EMTA 2M56B 2WDRB 5AZGA 3PRPB 4UB8O 4PYUA 3LK42 4M00A 4HCNB 1S1QB 1JRUA 3DBLI 1WX7A 2QC8A 4B61A 4NAWB 3L10B 2MJDA 3SZDA 3RZFA 3Q69A 1QOAA 1ZE3D 4BKSD 2DBYA 1L6VA 1EO6A 4P1CC 3KWLA 4CHKA 3CSTA 4JFBA 3RNGC 1JWSD 2RR9A 5KHQA 3DCGA 3GP6A 2MW5A 1FMAD 4YT0B 3NSGA 1E9MA 3A2SX 4TQ1A 1MI0A 2GRIA 3P4RB 3TEZA 3NVYA 1NYQA 4BZAA 4EZKA 2WXGA 1Q9GA 4FOZA 2DLBA 3W9CB 4KR8A 1ZPSA 3DA3A 2BB6A 2WGSA 3EGRA 1YIWA 2FAZA 2JYTA 3FC4A 3KVFB 3N3KB 4W9GA 4G11A 3AA6B 2LHDA 4EOYA 4L2YA 4PS8A 2G4SA 4HWIB 4MJSB 5ADXL 2RDHA 3QAQA 3DDCB 3ENEA 2EELA 2VZKD 1B1ZA 4XGAB 2IGHA 3UU2A 1UUPA 4IM3A 2IYDB 2MNHA 1UZXB 4AOFA 1FPYA 2BPSA 2UYZB 1I7HA 1SJHD 3DBLB 3ZLZA 1QKZA 3A9JA 3AEGB 3JSVB 2Z0EB 2XN9C 3NY5A 5CHVC 3T0SA 4DQOC 2SEBD 3HOLA 1ROEA 5C2TB 3VFKA 3W2DA 2N9KA 2LVQA 2N1WA 4GOCA 4F7ZA 1UWMA 2LRWA 2IGGA 4W9LA 4AUQC 4NJ7A 3QRCA 1V5OA 3GZNB 1OEYJ 5TR5A 1I4QA 2LUMA 5BO4B 4US8A 3KUCB 2KTRB 1V2YA 2FUG1 3AECB 2XTQA 4MM3A 2WDQB 2WX0A 4II2B 3VXWA 1RYJA 2KX3A 4KDLB 1LXDA 4FULA 1TGZB 2ZLDA 3PQSA 2ZJDA 2ERVA 1IGDA 2BYEA 2NBUA 3TL5A 1ZHTA 3DVGY 3PRNA 1PHOA 3DHHC 2XK5A 1SXTA 1BT9A 2BKRB 2CU3A 3PTFC 4IW0A 4XWTA 4K7SA 2A4ZA 2WP9B 2TSSA 1BH3A 1GUAB 3AA7A 3VVWB 4XC2A 2N7JA 3ZDMC 5DL6A 4JCHA 1JCKB 3SY7A 2K3UA 3AA0A 4ICVA 5D6JB 1QLBB 4HPPA 1HTQA 4XDDA 4GN1A 3QA8A 1MG4A 3RNCC 4HROA 2C60A 3HVDA 1YOVB 3J9CA 2HD5B 2UWQA 1WFYA 2LFIA 3LK2A 2R4PA 5DPTA 4Q2JA 1FXTB 2MBEA 2QCZA 2JVCA 1C9FA 1RFKA 3HW9A 3RUIB 2LFUA 2REXA 2LGYA 1GB1A 2MP2A 2WXRA 2R61A 3BYYB 1R4MI 3EFUA 2W80C 4EUTA 1TIFA 2MHJA 3VE2A 4EEWA 4B6WA 2E3TA 2N4FA 4M01A 1KRHA 3Q14C 1F0ZA 4AP4C 4A20A 2M06A 3W1SA 1FO4A 1NI3A 4KGSA 2MWSB 3Q3OC 4RGNA 1L7YA 2X8XX 5AUKA 4IWQA 3Q3MC 3OAWA 1YJJA 3PGSA 5C1ZA 1L4ZB 1UBQA 4KVGB 2OJWA 4HPMB 3ZRFA 2KQ4X 2XE5A 3WAPA 2D5GA 4O3WA 2K39A 5G55A 1GJZA 1SF0A 3MC8A 2F1CX 1TJEA 3AE9B 3IT6B 1XF5L 1FM0D 2WXKA 3H9DA 4MGYE 1IBXA 2BWES 1WYWB 4G0NB 5DCNA 3ML8A 3BVZA 2N2MA 2MQJA 3AN1A 3HK0A 5FVNA 2LI5A 4ASWC 2ZEQA 4CQNA 1N6ZA 2IO3B 3QC8B 1F1HA 2LGSA 1C1YB 3ZDTA 1DYQA 4F8CB 4NJCA 4OVUA 2KFJA 3WALA 2FGQX 1XO3A 3Q8EA 1N5XA 3PPAA
chains in the Genus database with same CATH topology
4RH6A 3ZJUA 2QIEB 1ENFA 1HXYD 2PTLA 2LMCA 1I4PA 1SE3A 3T3OA 2Y3AA 3ZJTA 1YNTE 5E6JA 1AWDA 2OMFA 2K4TA 1AW7A 4Z3TA 1FXAA 3BVMA 3IXSA 3OWEB 3FAHA 4ARIA 1D4BA 5T8IA 2BS4B 2AX5A 1WXQA 5DL5A 3WCQA 2O4VA 3AMZA 5IYUA 2J42A 1V1PB 4GCSA 2QJLA 4KGRA 2JZPA 1C77A 4AYNA 1ZHZA 1FFUA 2IPKD 1GFOA 1FXIA 2W81C 2K0PA 4OW0A 3VRBB 3C8YA 3N9YC 2OHFA 4OZAA 3POXA 1FFVA 5I4DA 1N61A 2NTSA 3AA6A 2LGIA 1D6EC 1THQA 4O3XB 1JWAD 4MM3B 4G76A 2KC0A 3ETRA 2BS2B 5GXGB 1MM4A 1PGBA 1I4RA 3LXFA 1SE4A 2XG6A 3LK41 1D5MC 2BB5A 1QF6A 7PRNA 1QQRA 4XDCA 2MJEA 3JTYA 1P7EA 1PYWD 2XE1A 1TY2A 4RF0A 2KDYA 1E10A 1YQ4B 1N60A 3AE8B 2JQRB 1F2RI 2N0SB 4PT5A 6PRNA 4D2KA 3HUIA 3U4EG 4FSPA 2PORA 1GAQB 1HXUA 1HA5A 1DOIA 2CJNA 1EU4A 2OEDA 4RGMA 3DA4A 1CQVA 3O13A 4EE2A 1ZDVA 2LHEA 3MC0B 4QQ1A 2ODJA 1VZ6A 1PUTA 1QILA 2GB1A 2M0AA 4RJXA 4LSIA 2W55A 1HXXA 1EWCA 2XNAC 2Y5CA 1ACCA 3VE1A 3BWUD 4UDUC 3AE7B 3AAAA 2JXTA 1ZHWA 1HZ5A 1M4VA 3GB1A 3NVVA 4YTPB 3R8BA 3ZQ4A 2QEJC 1QJ9A 5AFUK 1NEKB 1QOFA 1NVID 2KAJA 3HVZA 2YPVA 2YEPB 4L23A 5EE3A 4TQ0A 2KZ7A 1LO5D 5LNK1 1P4TA 1TYGB 1AYFA 4AFKA 2RMMA 3BYTB 3AEDB 2ICIA 2W82A 4HEA1 2BBCA 4O1NA 3B2FA 1KFYB 1C4PA 3POUA 3AE4B 3L4PA 3FYXA 4FRTA 1PDXA 4YSXB 1QOGA 2LHFA 1VLBA 3AA0B 2KXPA 4O4UA 3V8UA 1K51A 4FZLA 3Q8CA 3KLSX 1OSMA 4FXCA 1D5ZC 1UWXA 3SR6A 3LK3A 2M19A 3EMNX 4M0WA 4MT5A 4C7ZA 4A55A 2RDGA 2QTKA 2WDVB 4AQ7A 3URYA 1ET6A 1TZOA 3AB5A 1OQQA 4WURA 1RM6C 4ITKA 4ZHOA 2XTRA 3WI4A 3O0EA 1NYRA 3LK2B 1FRDA 1L0VB 1Q10A 4KX6B 2QSDA 4YSYB 3RFZB 1J7AA 2WXIA 1L0XB 4AZLA 1IUEA 4IKGA 3TEXA 1E7PB 2WXQA 3VZWX 1P7FA 1TKYA 4OHJA 4B0EA 3NVWA 4RCOA 1YMHE 4RJWA 4KKJA 2W54A 1L4DB 3VY8X 4HRSA 2PMVA 3W5UB 1GOZA 2PIAA 4JWUC 1GFQA 4F4BA 2PRNA 2VZKB 1OPFA 2GE4A 4FRXA 3AV8A 1FCLA 1OFFA 3K19A 1T6BX 4AYEC 4D64A 2MH7A 1V1PA 5BMHA 4GHBA 5EE2A 3HRDD 3NRZA 4GLSC 4RF1A 3IAM1 3P1MA 4NAMA 2M07A 4RL9A 1B9RA 3CWIA 1FNWA 2Z8LA 2ZW0A 1GFNA 3TSSA 4XNLA 1HZ6A 3R2TA 4AYID 2JYEA 3H8HA 1E6EB 3VR8B 1JQ4A 1CJEA 5DL8A 4E1SA 5D3IB 2H88B 5FKAC 1F2RC 1YN4A 1R7SA 4AUIA 3V05A 3QRAA 2W3SA 1SE2A 3TEWA 4XWWA 2RPVA 5EE9A 4JE3B 2WXNA 1FCCC 2WS3B 1PFDA 3AA1A 4OZCA 4RFBA 1DOXA 4NZLB 5HG2A 2L32A 2N2LA 1ZHXA 2Q5WD 1TY0A 2BT6A 2J52A 3SFEB 1CZPA 2M56B 2WDRB 4YSZB 3AM9A 3SFDB 1ZXIA 1TS5A 4P16A 4D65A 1XLOA 4ARCA 2DWQA 3LK42 2FGRA 4E1TA 4JX1C 1IBXB 1CK1A 2NMQA 3IT4B 1C4AA 2Y0HA 2HTME 3SEBA 1PGAA 3P4PB 3AH7A 1KF6B 5MPOA 1YQ3B 1V97A 3PORA 1XCQL 4B61A 3I9V1 4NAWB 2I2YA 1GPXA 2MJDA 3SZDA 2AQ3B 3Q69A 4RLCA 1QOAA 1ZE3D 2ZFGA 3AE1B 4ZYSA 2DBYA 3ABVB 1FD6A 1C79A 1L6VA 1ORMA 4FMSA 1ESFA 1JW9D 5H92C 3KWLA 2QMTA 1SBBB 4RGOS 4KR4A 2J53A 4JFBA 2WQYB 3POQA 1JWSD 2XE3A 3T24A 2J4XA 3IAS1 4O3YA 3GP6A 2Y0LA 4DXGA 1IZNA 2PW9A 4A6QA 4OVZA 1SJED 1FMAD 1L6UA 3PO0A 4HKZE 4YT0B 2XMXA 2JWUA 1IGCA 3NSGA 3SYSA 3RBHA 2MHLA 3SZVA 1E9MA 3A2SX 1TS4A 1XCTL 4TQ1A 1MI0A 2GRIA 3P4RB 3NVZA 4IOIE 3TEZA 3U2SC 2NTTA 4D5UA 5H8YE 3NVYA 1NYQA 4R3DA 1ZUD2 3G7GA 3AAEB 3CIRB 4G75A 2BS3B 2WXGA 4WAFA 1Q9GA 5BYSA 4FOZA 1WYGA 3VZUX 2DLBA 1K53A 3W9CB 3AEEB 3BZDB 4RLBA 2EKIA 4MH8A 4N6EB 5G5HA 2PVGC 4KR8A 1ZPSA 3DA3A 2BB6A 3KWVA 3VZTX 1BMLC 3AA7B 1MVKA 3EGRA 4AKRA 2PKOA 1HEZE 1YN3A 3FC4A 2JYTA 2AQ1B 4WWMA 4XNKA 1SB3C 2L52A 1JROA 4YTNB 1STEA 3AA6B 4TMAB 4FZNA 1MHXA 1D5XC 2Y7SA 1NENB 1QOBA 4GDLB 3RPFC 2LHDA 5BMIA 1BXWA 4L2YA 2K5PA 4KGTA 4LTUA 4FSOA 3VRAB 3HWBA 4FESA 3B2GA 3PZ8A 5ADXL 2RDHA 3B9JA 4AS1A 3NZ3A 5G5GA 2EELA 2VZKD 3EA6A 1YJIA 5AFUL 1KLUD 4C69X 1B1ZA 3AEBB 1T5XD 3TZGA 2WXJA 2IGHA 2K0LA 3UU2A 2JU6X 3AE6B 1UUPA 1BXTA 2WXHA 3BVGA 3MFGA 4O3ZA 1HXTA 3ZYYX 2MNHA 3SY9A 3LB8C 1WGKA 3VQIA 4JPSA 2ZW1A 4GCPA 1I7HA 2INPE 2ONQA 3KQ4A 4HJGE 1E0ZA 1SJHD 4IDIA 3FILB 1QKZA 3AEGB 1N63A 2K22A 3U52E 5BYRA 2XN9C 1UNSA 3P4SB 3Q8AA 3AAAB 1FNUA 1J7CA 1XLNA 4A90A 3T0SA 1VDVA 4DQOC 2BYTA 3E9SA 2SEBD 4C80A 3HOLA 1ROEA 5C2TB 5TSSA 4WH4A 3W2DA 2N9KA 3T20A 1ZHYA 2KZ7B 2BW2A 1PRNA 1EWYC 5PRNA 1UWMA 2IJ0A 2IGGA 2JSVX 3UI3A 1PGXA 2L83A 3BK1A 3QRCA 3P42A 4JWSC 2KMMA 3DWGC 1I4QA 1H6S1 2WXMA 2GI9A 2K9XA 2LUMA 2PVOD 2WNMA 4ZRPA 1JWBD 1L5PA 5HFYA 3E56A 4H2AA 4US8A 2Y5PA 3LK3B 2JMMA 2FUG1 3AECB 2AQ2B 2KWDA 2JX5A 4LSHA 1QT9A 2XTQA 2WDQB 2ACZB 2SAKA 3UPGA 4C7YA 3SYBA 1FNVA 2KN4A 1C4CA 1RYJA 4N59A 5D3DA 1TKGA 2IDYA 2INNE 4C56C 2DYMA 4OZBA 2ON8A 2WU2B 3TUOA 2ZLDA 3PQSA 2ERVA 1IGDA 1N5WA 2B76B 3P4QB 4YTMB 5GV0A 5BYQA 2PLPA 4N58A 1GFPA 1FRRA 1TS2A 2X27X 1ZHTA 4FZMA 3MP9A 2WXOA 2J1NA 3PRNA 1PHOA 2E6XA 5FR3A 2Y0KA 3I57A 1SXTA 1BT9A 1TS3A 2CU3A 3HOEA 1WRIA 1WWTA 2WXPA 4XWTA 5HHDG 5HI1A 3KVDD 3AE5B 1DOYA 1G90A 4FT6A 3AAEA 2WP9B 4P6VF 4YWGG 2MJ3A 5BMGA 2G1EA 2LEKA 2TSSA 2WXFA 2J4UP 1F77A 2WLBA 1T3QA 3PZ7A 4ZOHC 1XEEA 1BH3A 4B0MA 1DGJA 4XE0A 3AA7A 1V8CA 3GP7A 4AYDC 1HQRD 4GCQA 2N7JA 3AE2B 1C76A 1J7BA 5DL6A 4AYMC 4JCHA 1JCKB 3P63A 3SY7A 2K3UA 5G26A 3MJ5A 4KRAA 4TSSA 3AA0A 1KLGD 8PRNA 2KACA 2QILA 1QLBB 3DWMA 2F1VA 4GDKB 2Y2XA 3C5OA 2LJIA 1RWSA 4O4XA 1I4GA 4XDDA 1I4HA 4HKQA 3AA1B 4FUVA 3U7ZA 1ZOYB 4KKIA 3MHZA 4HROA 2V3NA 2L1AA 3HVDA 3J9CA 4J3OD 1ZP0B 2I38A 3LYYA 1VJKA 1ZXHA 4US9A 2LFIA 3LK2A 2H89B 4Q2JA 3Q8BA 1E54A 2BTEA 4U9CA 1C9FA 1XXGA 2V0GA 1RFKA 2FE8A 3HW9A 1C78A 2HDEA 5JDPA 2LFUA 4YXDB 1SIJA 4A9AA 2IGDA 5JXVA 3FILA 3AEFB 1GB1A 2WXRA 2R61A 3BYYB 4AKMA 1KTKA 1YN5A 2W80C 5ADXK 2KDMA 1BUIC 3TEYA 3NUHB 1Q9FA 3VE2A 1EM7A 1WSPA 1QJPA 2E3TA 1I4XA 4LK0M 1KRHA 1VRAB 3VR9B 4BUMX 1F0ZA 4REZA 2WXLA 2M06A 1XLPA 4ZRQA 3W1SA 1N62A 1FO4A 1NI3A 4KGSA 4USAA 1JWUD 2X38A 3UAQA 3Q8FA 1XLQA 4DXFA 2G9HD 3VY9X 1K50A 1MPFA 1IZNB 1ET9A 1GFMA 3ZJVA 3T3NA 4RGNA 3EUB2 2XE2A 5AUKA 2N9LA 1Y56A 1SEBD 1YJJA 3PQUA 1L4ZB 4RGTA 1FEHA 4O49A 1SSNA 4LSFA 2KQ4X 2XE5A 2YEPF 2D5GA 4O3WA 1FIQA 3BIID 3NS1A 4A8XC 5C3JB 1SF0A 2FBWB 1TJEA 1UGJA 1JMLA 2V4IB 5D7GA 3AE9B 3IT6B 5EE1A 1XF5L 1QJ8A 1TKEA 4AKRB 5FK9C 2F1TA 1VR9A 1FM0D 1GB4A 2WXKA 5D5DA 4PUXA 4WQMA 1IBXA 1VZ8A 1EU3A 2V3PA 3ZGZA 3BK2A 1AN8A 2KXPB 1A70A 1ZDXA 2WU5B 2CJOA 4LLGM 1YS5A 1JALA 3BVZA 5AUIA 2N2MA 3W5VB 2DYOA 1L0YB 3AN1A 1K52A 3V3XA 5FVNA 1JRPA 1OQRA 4RNAA 5EE0A 2MEKA 4L1BA 4CQNA 2W3RA 1MHHE 3AE3B 5T5FA 4ZHPA 3AEAB 1KH0A 3GS2A 1VZ7A 1MPEA 1MM5A 4LSEA 1DYQA 1V1OA 2YNKA 3R2IA 4NJCA 4WIPA 1JWMD 5DL7A 3WI5A 2FGQX 4MACA 1XO3A 4GF4A 3Q8EA 1N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZN A;  2QIE B;  3NVW A;  1NEN B;  1QOB A;  1QLB B;  2W54 A;  4HRS A;  3DWM A;  3RPF C;  3W5U B;  1AWD A;  4JWU C;  2PIA A;  2K5P A;  1RWS A;  1FXA A;  3FAH A;  3AV8 A;  4LTU A;  3VRA B;  2BS4 B;  2AX5 A;  3B2G A;  3B9J A;  1OFF A;  1WXQ A;  1ZOY B;  2MH7 A;  5G5G A;  3WCQ A;  4HRO A;  3AMZ A;  1YJI A;  1ZP0 B;  2QJL A;  1VJK A;  3HRD D;  3NRZ A;  3AEB B;  3P1M A;  4US9 A;  1B9R A;  2H89 B;  1FFU A;  3CWI A;  1FXI A;  3AE6 B;  3VRB B;  2OHF A;  3ZYY X;  1RFK A;  1E6E B;  3LB8 C;  3VR8 B;  1WGK A;  1JQ4 A;  1CJE A;  1FFV A;  2H88 B;  1N61 A;  4YXD B;  1I7H A;  1SIJ A;  4A9A A;  1E0Z A;  4IDI A;  3AEF B;  1R7S A;  3AEG B;  1JWA D;  1N63 A;  2K22 A;  2W3S A;  3P4S B;  5EE9 A;  4G76 A;  1J7C A;  3ETR A;  2BS2 B;  5GXG B;  1XLN A;  2WS3 B;  1PFD A;  1VDV A;  3LXF A;  4C80 A;  1ROE A;  5C2T B;  1QF6 A;  2E3T A;  1DOX A;  2MJE A;  2Q5W D;  2BT6 A;  3SFE B;  1KRH A;  1CZP A;  3VR9 B;  2M56 B;  1E10 A;  1EWY C;  2WDR B;  4YSZ B;  3AM9 A;  1F0Z A;  1UWM A;  1YQ4 B;  1N5X A;  1N60 A;  1ZXI A;  3AE8 B;  3SFD B;  2JQR B;  1XLP A;  2L83 A;  1FO4 A;  2N0S B;  1N62 A;  1NI3 A;  1XLO A;  4USA A;  2DWQ A;  3HUI A;  1XLQ A;  4JX1 C;  4JWS C;  2KMM A;  3DWG C;  1GAQ B;  2K9X A;  1DOI A;  2CJN A;  2PVO D;  3DA4 A;  1JWB D;  1L5P A;  4US8 A;  3EUB 2;  2HTM E;  5AUK A;  1PUT A;  2W55 A;  2Y5C A;  3P4P B;  3AEC B;  3AH7 A;  1KF6 B;  5MPO A;  1YQ3 B;  1V97 A;  1YJJ A;  2JX5 A;  1QT9 A;  3AE7 B;  2XTQ A;  1GPX A;  2WDQ B;  2ACZ B;  2MJD A;  4YTP B;  1QOA A;  3NVV A;  3AE1 B;  4C7Y A;  2DBY A;  3ABV B;  1NEK B;  1QOF A;  1L6V A;  1NVI D;  1FIQ A;  2KAJ A;  3BII D;  3HVZ A;  3NS1 A;  1RYJ A;  4N59 A;  1JW9 D;  5EE3 A;  1SF0 A;  1TKG A;  5C3J B;  1TYG B;  1TJE A;  2FBW B;  3KWL A;  5H92 C;  1AYF A;  3AE9 B;  5EE1 A;  3AED B;  2WU2 B;  2WQY B;  1TKE A;  4YTM B;  3P4Q B;  1N5W A;  1FM0 D;  2B76 B;  3B2F A;  1KFY B;  3AE4 B;  4WQM A;  3L4P A;  4N58 A;  4YSX B;  1PDX A;  1FRR A;  1QOG A;  1VLB A;  4FZM A;  1A70 A;  4FZL A;  1FMA D;  1L6U A;  3PO0 A;  4FXC A;  2WU5 B;  2CJO A;  4YT0 B;  2XMX A;  3SR6 A;  1JAL A;  5AUI A;  2M19 A;  1E9M A;  3W5V B;  3P4R B;  3NVZ A;  2CU3 A;  1WWT A;  1WRI A;  3AN1 A;  4C7Z A;  1OQR A;  1JRP A;  1NYQ A;  3NVY A;  2WDV B;  3AE5 B;  5EE0 A;  1ZUD 2;  3AB5 A;  1DOY A;  4P6V F;  2WP9 B;  2W3R A;  1OQQ A;  2MJ3 A;  3AE3 B;  4G75 A;  2BS3 B;  2G1E A;  3CIR B;  2LEK A;  1RM6 C;  4ZHP A;  3AEA B;  4ZOH C;  2WLB A;  4ITK A;  4ZHO A;  2XTR A;  1T3Q A;  1WYG A;  1NYR A;  4YSY B;  1FRD A;  1L0V B;  3W9C B;  4KX6 B;  3AEE B;  4N6E B;  2EKI A;  5G5H A;  1J7A A;  1DGJ A;  2PVG C;  5H8Y E;  3DA3 A;  1V8C A;  1IUE A;  2PKO A;  3FC4 A;  1E7P B;  3AE2 B;  1XO3 A;  1SB3 C;  2L52 A;  1JRO A;  1TKY A;  1J7B A;  4WWM A;  4YTN B;  3P63 A; 
#chains in the Genus database with same CATH topology
 3ZJU A;  2QIE B;  3T3O A;  1SE3 A;  2Y3A A;  3B0A A;  5E6J A;  1AWD A;  4ARI A;  4Z3T A;  3PV1 A;  5T8I A;  2BS4 B;  2AX5 A;  5TIS O;  2PE9 A;  4GCS A;  1C77 A;  2IPK D;  2IWV A;  2W81 C;  4OW0 A;  4OZA A;  2K25 A;  1UF0 A;  4FJV B;  1WGD A;  4O3X B;  3U7D A;  4GDL A;  2FIF A;  2AXT O;  1T1L A;  5IN7 A;  4MM3 B;  4G76 A;  3ETR A;  2BS2 B;  5GXG B;  1MM4 A;  1RAX A;  3LXF A;  3LK4 1;  1D5M C;  7PRN A;  3PLV A;  1P7E A;  1PYW D;  4AWJ A;  1TY2 A;  2LXA A;  3RMK C;  1E10 A;  1YQ4 B;  3S2A A;  1F2R I;  2KDB A;  3Q3N C;  6PRN A;  3X23 A;  4D2K A;  4FSP A;  1GAQ B;  1ZKH A;  1HA5 A;  2CJN A;  2GOW A;  2OED A;  3DA4 A;  3VUW A;  2LHE A;  2ODJ A;  5D7G A;  2XNA C;  2KYW A;  3L0W B;  1EWC A;  2XK5 B;  4UDU C;  4FQE A;  2L05 A;  1HZ5 A;  1M4V A;  3NVV A;  5AFU K;  3ZXR A;  4W9H A;  2KAJ A;  3HVZ A;  2YPV A;  4L23 A;  5EE3 A;  4TQ0 A;  5LNK 1;  1P4T A;  5KAF O;  2RMM A;  2GBN A;  3I3T B;  2ICI A;  2FCS A;  3B2F A;  1KFY B;  1C4P A;  3FYX A;  1VLB A;  3AA0 B;  3JYU A;  2KJH B;  3PGE A;  2M19 A;  3BRY A;  2D07 B;  4A55 A;  1ET6 A;  3V61 A;  1RM6 C;  4ITK A;  1K8R B;  1NYR A;  3LK2 B;  1L0V B;  3BIN A;  2ZVN A;  2PJH A;  4MH0 E;  1E7P B;  2WXQ A;  1TKY A;  2R8A A;  4B0E A;  2M4N A;  4ICU A;  3D32 A;  2BGF A;  2MP2 B;  1F9J A;  4KKJ A;  1L4D B;  3Q3J A;  4MDK E;  3W1Y A;  4F4B A;  1OPF A;  1OFF A;  4WJP A;  2MH7 A;  5BMH A;  3DBR I;  5EE2 A;  3HRD D;  1E8Z A;  3IHP C;  3NRZ A;  3IAM 1;  3Q3F A;  2Z8L A;  1HZ6 A;  4AYI D;  2JYE A;  2HTH A;  3A9K A;  4E1S A;  3WIM A;  5J2R A;  1WXM A;  3TEW A;  2L00 B;  2J7Q B;  2G45 B;  2W9N A;  3UF8 A;  4TUU A;  1E7V A;  2AL3 A;  2N2L A;  2BT6 A;  1CZP A;  2LAS A;  1OGW A;  2KQ7 A;  4YSZ B;  3AM9 A;  3SFD B;  2ZPY A;  1OQY A;  2IY0 B;  1IBX B;  2DNF A;  3HHM A;  4KZC A;  1G6J A;  3NG0 A;  3AH7 A;  1KF6 B;  5MPO A;  4N75 A;  1XCQ L;  4FHJ A;  2AQ3 B;  4RLC A;  4K1R B;  5JH5 C;  2VH1 A;  2DHZ A;  3ABV B;  5J18 A;  2Z59 B;  3H7P A;  1ESF A;  1JW9 D;  3ZO5 B;  3AU5 A;  4J6I A;  5H92 C;  2QMT A;  3PRM B;  3PVL A;  4RGO S;  2LVP A;  2J53 A;  3POQ A;  2XE3 A;  3A4R A;  1S5L O;  1T0S C;  1WRD B;  4O3Y A;  1VCB A;  4HDQ A;  1IZN A;  4HKZ E;  1IGC A;  1TS4 A;  1LGR A;  2FNJ B;  3NVZ A;  2NTT A;  3DBR B;  3VUX A;  4R3D A;  1WH3 A;  1ZUD 2;  4I6N B;  3AAE B;  3AXC A;  1WYG A;  3VZU X;  3AEE B;  4N6E B;  4MH8 A;  1MVK A;  4AKR A;  5B5E O;  1HEZ E;  2PKO A;  1LFD A;  1Q0W B;  2R2Q A;  2MBO A;  2JZ3 B;  4XNK A;  2L52 A;  3N1Z C;  1CMX B;  5IP4 D;  5G38 A;  3MC9 A;  4WJO A;  1WJU A;  1J19 A;  1NEN B;  5BMI A;  4GDL B;  1QZE A;  3EC8 A;  4W9D A;  2NCN A;  4NNJ B;  5GTI O;  1WX9 A;  2AEH A;  3HWB A;  3QCA A;  3VH3 B;  1UGM A;  3B9J A;  4AS1 A;  3NZ3 A;  3EA6 A;  1MFW A;  3GE3 C;  4C69 X;  3AEB B;  3TZG A;  3SU8 X;  2JU6 X;  2GLS A;  3AE6 B;  3BVG A;  3MFG A;  2M1M A;  2JZZ A;  3OJ4 B;  4JPS A;  2INP E;  2ZPN A;  3KQ4 A;  3N32 A;  2GBM A;  1SGH A;  3FIL B;  1TBE A;  2JXX A;  3U52 E;  1FNU A;  1P9D U;  1VDV A;  4MEM A;  2BVC A;  2RPQ A;  4WH4 A;  2ASQ A;  3T20 A;  2BW2 A;  1UD7 A;  1PRN A;  2GMI C;  5C23 A;  5PRN A;  2IJ0 A;  3B08 A;  2KVZ A;  2K8H A;  3H7S A;  5D94 A;  1H6S 1;  2GI9 A;  2K9X A;  2WNM A;  4ZRP A;  2FID A;  4DWF A;  5HFY A;  2KFK A;  2AQ2 B;  3U8Z A;  3T9L A;  3UPG A;  3NS8 A;  2KDE B;  2XEW A;  2IDY A;  5CHW A;  5KHO A;  4OZB A;  4LDT B;  2ON8 A;  2LRU A;  2WU2 B;  3TBL D;  2WHI A;  4NY0 A;  1GFP A;  2KHW B;  3RNB C;  2WXO A;  5FR3 A;  2R88 A;  4BOZ B;  5HI1 A;  3HOE A;  2WXP A;  2WVP A;  4EFO A;  4JL9 A;  4GIV A;  4FT6 A;  2G1E A;  2WXF A;  3PZ7 A;  4ZOH C;  1XEE A;  2L3Z A;  4IG7 B;  4B0M A;  3PS6 A;  4XE0 A;  1I35 A;  3DHG C;  2ZNV C;  4GCQ A;  3UIO B;  2J0K A;  1Y8R C;  3P63 A;  3DBS A;  4TSS A;  3MJ5 A;  2FCN A;  5E6P A;  2F1V A;  2Y2X A;  2R89 A;  1WGR A;  2LWP A;  1MJD A;  4EKU A;  1GC6 A;  3MHZ A;  2V3N A;  2L1A A;  2I38 A;  2KT7 A;  1VJK A;  1ZXH A;  4US9 A;  5B66 O;  3Q8B A;  1E54 A;  2KZR A;  2BTE A;  3PRZ A;  2G4D B;  5LXH A;  1V81 A;  2PPH A;  1UBI A;  3AEF B;  4XZ4 A;  3TIX A;  2GBJ A;  1MG8 A;  1KTK A;  3APC A;  5ADX K;  2KDM A;  5LXI B;  2IO0 B;  3TEY A;  2K6D B;  3NUH B;  1Q9F A;  1EM7 A;  4A3P A;  2PEA A;  3H7P B;  4M8N A;  4LK0 M;  1V6E A;  3VR9 B;  3C0R B;  4HDO A;  2WXL A;  4USA A;  1Q5W B;  2X38 A;  3SDL C;  2C5L C;  3VY9 X;  2HE7 A;  1IZN B;  2C7H A;  3EEC A;  4DHZ B;  1WY8 A;  2KKC A;  4RGT A;  2IY1 B;  4O49 A;  1SSN A;  3BII D;  4A8X C;  1WJ4 A;  5C3J B;  1KOT A;  1UGJ A;  2V4I B;  2MBH A;  2L0F A;  1TKE A;  4AKR B;  4HLE A;  1VR9 A;  5D5D A;  4LDT D;  4PUX A;  3HM3 A;  2WX1 A;  3BK2 A;  1AN8 A;  2WU5 B;  2MBQ A;  1YS5 A;  1JAL A;  1V80 A;  1L0Y B;  1K52 A;  3V3X A;  3L08 A;  3HIZ A;  3AEA B;  1XD3 B;  1VZ7 A;  3UQA A;  3EFC A;  1HTO A;  1MM5 A;  2YNK A;  2PE6 B;  2I1K A;  3WI5 A;  2KWC A;  4RH6 A;  1HXY D;  2G3Q B;  2LMC A;  2PTL A;  3UGB B;  4GDK A;  1AW7 A;  1NDD A;  3IXS A;  3FAH A;  3DZM A;  3WCQ A;  4URK A;  1WXS A;  4PJ0 O;  4KGR A;  2JZP A;  4AYN A;  4BAX A;  2M8S A;  1FFU A;  3CF6 E;  1FXI A;  2CS4 A;  3VTV A;  3DBH I;  3C8Y A;  2OHF A;  2FCQ A;  2R4L A;  1OEY A;  5E79 O;  5I4D A;  2NTS A;  2KFK B;  1PQS A;  1JWA D;  4BBN F;  4ZDV A;  3RNE C;  2XG6 A;  2BB5 A;  1QQR A;  4XDC A;  2XE1 A;  4W9C A;  2KDY A;  1N60 A;  2D2Q A;  2J0M A;  1IPG A;  2BQQ A;  2N0S B;  4PT5 A;  4MGZ E;  1KJT A;  4DXA B;  2BYF A;  4LNO A;  4W9I A;  4I6L B;  2BWF A;  4RGM A;  1Q1O A;  4EE2 A;  1CQV A;  3O13 A;  3A0B O;  2KQS A;  4JIO U;  4QQ1 A;  2GB1 A;  1PUT A;  1QIL A;  3ZW3 A;  2DZM A;  2KJR A;  1ZHW A;  3QIJ A;  2IND C;  1OTR B;  1QOF A;  4N9F 4;  4IL6 O;  3NJT A;  3BYT B;  4HEA 1;  2BBC A;  2DX5 B;  3L4P A;  3PSE B;  4WAF A;  3Q8C A;  3V8U A;  2KXP A;  3DVG X;  4FXC A;  3V6C B;  1D5Z C;  1UWX A;  3EMN X;  4FJY A;  4MT5 A;  4FAD A;  4MSM B;  5E6N A;  3TMP B;  1WXV A;  3M95 A;  4WUR A;  2CU1 A;  3DBH B;  3DVN U;  4OVV A;  3IBE A;  4PS7 A;  4KSK C;  1Q10 A;  5LLI A;  4WWO A;  1WR1 A;  1L0X B;  4AZL A;  2WXI A;  1IUE A;  1WGH A;  4W9F A;  2L7R A;  3R7R A;  3V6E B;  3VZW X;  5IKC M;  2ZZP B;  3NVW A;  2YVC A;  1YMH E;  2W54 A;  3W5U B;  4JWU C;  2PRN A;  3AV8 A;  1EUV B;  1T6B X;  4AYE C;  1V1P A;  2L8J A;  3RUL A;  3P1M A;  3R66 C;  4RL9 A;  3CWI A;  2WJR A;  1GFN A;  3X0W A;  4XNL A;  3A4S C;  4IM0 A;  3R2T A;  2DYB A;  3H8H A;  1E6E B;  3VR8 B;  1Z2M A;  2H88 B;  3LJ3 A;  1R4M B;  3WU2 O;  1YN4 A;  3RNA C;  3A9J B;  2W3S A;  1SE2 A;  3T8M A;  1ISN A;  2RPV A;  5JZE B;  5EE9 A;  4BFR A;  4N74 A;  3AA1 A;  1DOX A;  5HG2 A;  2KAN A;  2M0X A;  3SFE B;  2Q5W D;  2J52 A;  3ZXV A;  2JF5 A;  1ZXI A;  2CHX A;  1TS5 A;  4P16 A;  4D65 A;  2D3A A;  3KYC D;  4ARC A;  2FGR A;  4E1T A;  4HCP B;  2R2O A;  3APD A;  1HE8 A;  3PLU A;  3SEB A;  3V62 A;  1V97 A;  3POR A;  1J8C A;  3I9V 1;  3OG5 A;  1GPX A;  3WA0 A;  4ZYS A;  2O2V A;  3NOB A;  1FD6 A;  1C79 A;  4NJ6 A;  4KR4 A;  3QAR A;  1UH6 A;  1V86 A;  4CYE A;  2EKE C;  3T24 A;  3UQB A;  1H4R A;  3ZNZ B;  4LNF A;  4DXG A;  3KYD D;  1SJE D;  1L6U A;  3PO0 A;  3GE8 C;  3SYS A;  3RBH A;  3SZV A;  3EHV A;  3U2S C;  4D5U A;  3K9P B;  2MX2 A;  4P7I A;  1AAR A;  3G7G A;  3CIR B;  4G75 A;  4TV3 A;  4IM2 A;  5DPS A;  3BZD B;  5G5H A;  4RLB A;  2PVG C;  4EZL A;  3AU4 A;  5H8Y E;  1WM2 A;  3AA7 B;  1XT9 B;  4JGH B;  1YN3 A;  4FBJ B;  2N7D A;  2NVU I;  4JLC A;  4WWN A;  4WWM A;  1SB3 C;  1YJ1 A;  4HK2 A;  4YTN B;  1STE A;  3JVZ X;  2Y7S A;  1QOB A;  3RPF C;  1BXW A;  3K9O B;  4KGT A;  4FSO A;  4FES A;  2FUH B;  3PZ8 A;  3BS0 A;  5G5G A;  4JQW C;  3A0H O;  5AFU L;  1KLU D;  4E74 A;  3OLM D;  1UEL A;  1T5X D;  2LUE A;  2WXJ A;  3VDZ A;  3ALB A;  2HJ1 A;  2V3S A;  4C4V A;  2WXH A;  4O3Z A;  1HXT A;  3ZYY X;  4K3B A;  4MEL A;  4HJG E;  5EDS A;  1E0Z A;  2ONQ A;  2K22 A;  4DDI D;  1D3Z A;  3Q2A C;  5BYR A;  3Q8A A;  1J7C A;  4YL8 A;  4C80 A;  5TSS A;  3MHS D;  4KIK A;  2YLM A;  1GC7 A;  1EWY C;  1U4A A;  2JSV X;  1PGX A;  2L83 A;  3BK1 A;  4B9K A;  3P42 A;  4TKN A;  3IVF A;  4JWS C;  2KMM A;  3DWG C;  2WXM A;  2RSU A;  2PVO D;  1TTN A;  3E56 A;  2JMM A;  1QT9 A;  3DOW A;  1EF1 A;  3DWO X;  2QHO A;  3JW0 X;  3SYB A;  4HXD A;  2KN4 A;  1C4C A;  4N59 A;  2AL6 A;  4CO7 A;  4MSQ B;  1I42 A;  3QWZ B;  3TUO A;  1IYF A;  2PLP A;  1TS2 A;  4WQO B;  2K8C A;  2R4N A;  3AI5 A;  3PF1 A;  5G3A A;  1TS3 A;  5HHD G;  3KVD D;  2ZNV B;  5D2M B;  1DOY A;  1G90 A;  5BMG A;  3M63 B;  1F77 A;  2WLB A;  4BBN C;  1DGJ A;  3DWN A;  1V8C A;  4DHZ E;  3GP7 A;  2AYO B;  2BF8 B;  1C76 A;  3H1U A;  4X57 B;  5IA7 A;  2ZCC A;  5G26 A;  1KLG D;  2C7M B;  4GMV A;  8PRN A;  2QIL A;  1RLF A;  3PHX B;  4O4X A;  4KZ0 A;  4FJZ A;  4HKQ A;  3AA1 B;  4FUV A;  1ZOY B;  2KWU B;  2KN5 A;  4ZYN A;  1SIF A;  2H89 B;  4M8M A;  2V9H A;  3R7Q A;  4U9C A;  4DK5 A;  3ZRC A;  3IG3 A;  4FN2 A;  1XXG A;  2V0G A;  1C78 A;  1WX8 A;  5JDP A;  1S3S G;  1LQB A;  1SIJ A;  4YXD B;  4AJY B;  5JXV A;  1T0R C;  4AKM A;  3WAN A;  2K1F A;  2MBB B;  1WSP A;  2O2V B;  3AUL A;  4ANV A;  4BUM X;  4QAY A;  4REZ A;  3VUY A;  2I1J A;  1JWU D;  2X9K A;  3UAQ A;  1XLQ A;  4DXF A;  4NQK E;  1K50 A;  4RMA A;  1MPF A;  1GFM A;  1ZGU B;  3ZJV A;  3T3N A;  3EUB 2;  1SEB D;  2NBV B;  3PQU A;  3ZNG C;  1WXA A;  3RCZ A;  1FEH A;  1FIQ A;  3NS1 A;  4K3C A;  1JML A;  2IWW A;  2LJ5 A;  5EE1 A;  1QJ8 A;  4MGI E;  4ZRK A;  2KMC A;  1WE6 A;  1VZ8 A;  2RDB C;  2CJO A;  3W5V B;  1WJ6 A;  1OQR A;  5EE0 A;  4DBG A;  2MEK A;  1MHH E;  4W9E A;  2JWZ A;  1WIA A;  4ZHP A;  1KH0 A;  3GS2 A;  1MPE A;  1SE9 A;  3WAM A;  4P1B C;  3N1X C;  1V1O A;  4GB9 A;  1JWM D;  2IBI B;  2KK8 A;  4AJW A;  4MAC A;  1ENF A;  4BVU C;  3QQ8 B;  1I4P A;  1C3T A;  2K8B A;  1YNT E;  2DZJ A;  3BVM A;  1FXA A;  4ANX A;  1D4B A;  2L76 A;  4KV2 A;  1WXQ A;  5DL5 A;  2O4V A;  3AMZ A;  5IYU A;  4KIK B;  2DAF A;  2QJL A;  3KW5 B;  3RN9 C;  3VRB B;  3POX A;  2D10 A;  3ZIM A;  2Z0D B;  3ZUN A;  3A9K B;  1FFV A;  4ZRJ A;  1Z5S B;  4GU2 A;  1N61 A;  2LGI A;  2WWZ A;  4A3O A;  2JRI B;  1RRB A;  4DHJ B;  2N7E A;  2KC0 A;  1I4R A;  1SE4 A;  5DPW A;  1QF6 A;  1P0R A;  2MJE A;  1WR6 E;  3RZW C;  1NBF C;  2HJ8 A;  3AE8 B;  2OJR A;  5IO9 A;  4ANU A;  1WZ0 A;  3HUI A;  4HPL B;  3U4E G;  2KO3 A;  1WMH A;  3H6N A;  3GZN I;  1HXU A;  2KMA A;  1DOI A;  4E71 A;  3MC0 B;  2O6V A;  4RJX A;  1HXX A;  2INC C;  4G50 A;  2ZVO A;  3AE7 B;  3AAA A;  2JXT A;  3GB1 A;  3R8B A;  4FLH A;  3ZQ4 A;  1QJ9 A;  1TZ1 A;  3C19 A;  1NVI D;  2KZ7 A;  2KLG A;  2KX0 A;  2ZCB A;  4G3X B;  3A33 B;  1LM8 B;  3AED B;  2D3G A;  3DVN V;  3AE4 B;  4YSX B;  2D11 A;  1QOG A;  3RYT A;  5GTH O;  1K51 A;  4FZL A;  3KLS X;  3LK3 A;  4M0W A;  4C7Z A;  5CHF A;  2WDV B;  2KWV B;  4MGK E;  3N1Y C;  1E8W A;  2XTR A;  3WI4 A;  3O0E A;  3KUD B;  5E6O A;  3RNF C;  5L83 A;  3ZGZ A;  3RFZ B;  2KVR A;  2LGD A;  1P7F A;  3ZVV A;  4OHJ A;  4PS3 A;  2D3B A;  1VD2 A;  5GMV A;  4RJW A;  2PMV A;  1GOZ A;  2PIA A;  1GFQ A;  2GE4 A;  2D3C A;  1FCL A;  2MSE D;  3K19 A;  1WGY A;  3UIN B;  1NI2 A;  3ZNI D;  4GHB A;  4GLS C;  4RF1 A;  4W9K A;  4K7W A;  2KDI A;  4NAM A;  2M07 A;  2BYV E;  4RM8 A;  1WZ3 A;  2KLC A;  2MCN B;  1CJE A;  3RI7 C;  3QRA A;  3NZU A;  3QX1 A;  2WXN A;  1FCC C;  1PFD A;  4DHJ D;  4OZC A;  4RFB A;  2CR5 A;  2DZI A;  4F1S A;  2L32 A;  1ZHX A;  1TY0 A;  2N9P C;  3CMM B;  1H8C A;  1XLO A;  4LJP B;  2DWQ A;  4JX1 C;  2MA9 B;  1CK1 A;  2NMQ A;  1X1M A;  3IT4 B;  1C4A A;  2Y0H A;  2HTM E;  1PGA A;  3P4P B;  1YQ3 B;  2I2Y A;  5AEK B;  2ZFG A;  3AE1 B;  3CSF A;  2KOX A;  2GBK A;  4IWO A;  1ORM A;  4FMS A;  1V9J A;  4GGQ A;  1SBB B;  2KNB A;  2WQY B;  2VRR B;  2J4X A;  3IAS 1;  4IC7 B;  2Y0L A;  2PW9 A;  4A6Q A;  4OVZ A;  2XMX A;  2JWU A;  2MLB A;  5J17 A;  1XCT L;  2MHL A;  2IO1 B;  4IOI E;  2OOB B;  2BS3 B;  3A1Q A;  5BYS A;  1K53 A;  2V4L A;  4UB6 O;  2EKI A;  3KWV A;  3VZT X;  1BML C;  4WJN A;  3GOE A;  2AQ1 B;  1JRO A;  4CTD A;  4TMA B;  4FZN A;  1MHX A;  4LNN A;  1D5X C;  1WM3 A;  2K5P A;  3L54 A;  4WWP A;  4LTU A;  3VRA B;  4C00 A;  3B2G A;  1YJI A;  2CHZ A;  3U30 A;  2K0L A;  3VAW A;  1BXT A;  3ZTD A;  1XQQ A;  4BKT A;  3SY9 A;  3LB8 C;  1WGK A;  1WMH B;  3VQI A;  4XX5 A;  2C9W B;  2ZW1 A;  4GCP A;  2MRP A;  4IDI A;  2O6V B;  2EMS A;  1N63 A;  2VH2 A;  4NQL B;  1UNS A;  3N30 A;  3P4S B;  3AAA B;  1XLN A;  4LCD E;  4A90 A;  2BYT A;  3E9S A;  2LGX A;  2WYQ A;  1ZHY A;  2KZ7 B;  3Q6B A;  3DPD A;  3JCU O;  3UI3 A;  2Y5B B;  3OJ3 A;  1JWB D;  1L5P A;  4DDG D;  1WE7 A;  4H2A A;  2Y5P A;  3LK3 B;  4M0W B;  4IWP A;  2KWD A;  2JX5 A;  4LSH A;  2DAJ A;  2ACZ B;  2SAK A;  2QDF A;  4C7Y A;  2XBB C;  4ACF A;  2JQY A;  1FNV A;  1IP9 A;  2N9X A;  4FHK A;  1P1A A;  1TKG A;  5D3D A;  2INN E;  3O65 B;  4C56 C;  2DYM A;  4YTM B;  3P4Q B;  1N5W A;  2B76 B;  5GV0 A;  2NBW B;  3B1L X;  5BYQ A;  2KXJ A;  4N58 A;  5HKH A;  1FRR A;  2X27 X;  2V1Y A;  4FZM A;  2RGF A;  3MP9 A;  2WJQ A;  2J1N A;  1E8X A;  3KZI O;  4PK1 A;  2C7N B;  2E6X A;  2Y0K A;  3I57 A;  4BKS A;  1WWT A;  1WRI A;  3TJP A;  1YQB A;  3AE5 B;  3AAE A;  4P6V F;  2LXC A;  4YWG G;  2MJ3 A;  1R4N I;  3RD2 A;  2JY6 A;  2LEK A;  5JHB A;  3PZD A;  2J4U P;  1T3Q A;  2NS5 A;  1V5T A;  1WJN A;  4B95 A;  4EZJ A;  1WI0 A;  4K7U A;  1P3Q U;  2KTF A;  4AYD C;  1A5R A;  1HQR D;  3AE2 B;  1J7B A;  4AYM C;  2R4O A;  1RFA A;  4KRA A;  1GG3 A;  2KAC A;  1ZW7 A;  3DWM A;  4GDK B;  5AZF A;  4S0R A;  3C5O A;  2LJI A;  1RWS A;  3TCA A;  1I4G A;  1I4H A;  3MJW A;  4FA6 A;  3U7Z A;  4KKI A;  3QK0 A;  4KDI C;  4J3O D;  1ZP0 B;  3LYY A;  3ECI A;  2KC1 A;  2J0J A;  2RD0 A;  2CKH B;  2LVO A;  3VH4 B;  2NPT A;  2FE8 A;  2HDE A;  4A9A A;  2IGD A;  3FIL A;  3ML9 A;  4RM9 A;  1F52 A;  1YN5 A;  1BUI C;  2O6V D;  4LJO B;  2JUO A;  5L95 C;  1QJP A;  5KAI O;  1I4X A;  2AWT A;  4ZRI A;  1VRA B;  3L16 A;  1XLP A;  2L0T A;  3PHW B;  4ZRQ A;  1N62 A;  2IZV B;  3BRZ A;  3Q8F A;  2G9H D;  1ET9 A;  1KM7 A;  3ONS A;  2XE2 A;  2N9L A;  1Y56 A;  4XYC A;  1R4N B;  1T16 A;  2WDT B;  1L2N A;  4ANW A;  2LZ6 A;  4LSF A;  2YEP F;  3A1Q B;  3L13 A;  3N20 C;  3VHT C;  2FBW B;  3NHE B;  3HM6 X;  2M17 A;  1TT5 B;  5FK9 C;  2F1T A;  1GB4 A;  3DHI C;  4HVB A;  4WQM A;  1EU3 A;  2V3P A;  1A70 A;  2KXP B;  1ZDX A;  5IAA C;  4S17 A;  4LLG M;  4LNK A;  5AUI A;  4WJQ A;  3PT2 B;  2DYO A;  3PRE A;  3ZKJ C;  3M3J A;  5CX3 A;  4NAW A;  1JRP A;  4RNA A;  4IUM B;  4L1B A;  2W3R A;  3AE3 B;  5T5F A;  2DEN B;  4LSE A;  4WIP A;  3R2I A;  2CHW A;  3SHQ A;  5DL7 A;  4GF4 A;  2KJ6 A;  2N1V A;  3V60 A;  4II3 B;  3ZJT A;  1P98 A;  3KUZ A;  2OMF A;  2K4T A;  3OWE B;  1V49 A;  2J42 A;  3QJZ A;  1V1P B;  3KH0 A;  2K6Q A;  1ZHZ A;  1GFO A;  2K0P A;  3N9Y C;  2UU7 A;  5FR6 A;  3FKY A;  3AA6 A;  1D6E C;  1THQ A;  3RT3 B;  2LD9 A;  2N9E B;  4W9J A;  4BKG A;  4MJS A;  5JHA A;  2JT4 B;  1PGB A;  1WF9 A;  3SD5 A;  2NR2 A;  4NPN A;  3UIP B;  3R3M A;  4PYZ A;  3JTY A;  4RF0 A;  2JRH A;  1M94 A;  2JQR B;  3QHT A;  5CTR C;  2DZK A;  2POR A;  3I63 C;  2A5U A;  1EU4 A;  3MTN B;  4GSW A;  1ZDV A;  4K81 A;  2M0A A;  1VZ6 A;  3PGR A;  2W55 A;  2Y5C A;  3JSV A;  4LSI A;  1ACC A;  3VE1 A;  3BWU D;  4BOS C;  3BY4 B;  4YTP B;  1YD8 U;  3NZS A;  2KC2 A;  2QEJ C;  1NEK B;  2YEP B;  1E8Y A;  1LO5 D;  1TYG B;  4HJK A;  1AYF A;  4AFK A;  4GXB A;  3VTW A;  2KDF B;  5IOI A;  2W82 A;  4O1N A;  3PGU A;  3POU A;  4FRT A;  1PDX A;  2LHF A;  4O4U A;  5H2F O;  1BT0 A;  1OSM A;  4E3C A;  3SR6 A;  2KD0 A;  2KTR A;  2IO2 B;  1E7U A;  3M62 B;  2FCM A;  4LNI A;  2RDG A;  2QTK A;  4AQ7 A;  3URY A;  1TZO A;  1J0G A;  3AB5 A;  2JPH A;  1OQQ A;  3IFW B;  4WAA A;  4ZHO A;  4YSY B;  1FRD A;  4KX6 B;  2QSD A;  1J7A A;  5AZH A;  1YX5 B;  4IKG A;  3TEX A;  2NPT B;  5DPR A;  3APF A;  3L17 A;  2GBR A;  4RCO A;  4KSL C;  3I5J C;  4HRS A;  3VY8 X;  1YX6 B;  1GNU A;  1E90 A;  1T0Q C;  2VZK B;  4FRX A;  4PR7 A;  4I6P A;  4D64 A;  3P2B A;  5G2N A;  1B9R A;  1T0Y A;  3WAO A;  1FNW A;  5G39 A;  4C4V B;  2ZW0 A;  3TSS A;  3DQV A;  1JQ4 A;  5DL8 A;  5D3I B;  5FKA C;  1EF5 A;  1F2R C;  3VTU A;  4M02 A;  1R7S A;  4AUI A;  3V05 A;  2B3A A;  3W1S C;  4XWW A;  3ZTC A;  4JE3 B;  1WGG A;  1E5W A;  2WS3 B;  4NZL B;  2BKF A;  3LDZ E;  1KLV A;  3ZNH B;  2EMT A;  2M56 B;  2WDR B;  5AZG A;  3PRP B;  4UB8 O;  4PYU A;  3LK4 2;  4M00 A;  4HCN B;  1S1Q B;  1JRU A;  3DBL I;  1WX7 A;  2QC8 A;  4B61 A;  4NAW B;  3L10 B;  2MJD A;  3SZD A;  3RZF A;  3Q69 A;  1QOA A;  1ZE3 D;  4BKS D;  2DBY A;  1L6V A;  1EO6 A;  4P1C C;  3KWL A;  4CHK A;  3CST A;  4JFB A;  3RNG C;  1JWS D;  2RR9 A;  5KHQ A;  3DCG A;  3GP6 A;  2MW5 A;  1FMA D;  4YT0 B;  3NSG A;  1E9M A;  3A2S X;  4TQ1 A;  1MI0 A;  2GRI A;  3P4R B;  3TEZ A;  3NVY A;  1NYQ A;  4BZA A;  4EZK A;  2WXG A;  1Q9G A;  4FOZ A;  2DLB A;  3W9C B;  4KR8 A;  1ZPS A;  3DA3 A;  2BB6 A;  2WGS A;  3EGR A;  1YIW A;  2FAZ A;  2JYT A;  3FC4 A;  3KVF B;  3N3K B;  4W9G A;  4G11 A;  3AA6 B;  2LHD A;  4EOY A;  4L2Y A;  4PS8 A;  2G4S A;  4HWI B;  4MJS B;  5ADX L;  2RDH A;  3QAQ A;  3DDC B;  3ENE A;  2EEL A;  2VZK D;  1B1Z A;  4XGA B;  2IGH A;  3UU2 A;  1UUP A;  4IM3 A;  2IYD B;  2MNH A;  1UZX B;  4AOF A;  1FPY A;  2BPS A;  2UYZ B;  1I7H A;  1SJH D;  3DBL B;  3ZLZ A;  1QKZ A;  3A9J A;  3AEG B;  3JSV B;  2Z0E B;  2XN9 C;  3NY5 A;  5CHV C;  3T0S A;  4DQO C;  2SEB D;  3HOL A;  1ROE A;  5C2T B;  3VFK A;  3W2D A;  2N9K A;  2LVQ A;  2N1W A;  4GOC A;  4F7Z A;  1UWM A;  2LRW A;  2IGG A;  4W9L A;  4AUQ C;  4NJ7 A;  3QRC A;  1V5O A;  3GZN B;  1OEY J;  5TR5 A;  1I4Q A;  2LUM A;  5BO4 B;  4US8 A;  3KUC B;  2KTR B;  1V2Y A;  2FUG 1;  3AEC B;  2XTQ A;  4MM3 A;  2WDQ B;  2WX0 A;  4II2 B;  3VXW A;  1RYJ A;  2KX3 A;  4KDL B;  1LXD A;  4FUL A;  1TGZ B;  2ZLD A;  3PQS A;  2ZJD A;  2ERV A;  1IGD A;  2BYE A;  2NBU A;  3TL5 A;  1ZHT A;  3DVG Y;  3PRN A;  1PHO A;  3DHH C;  2XK5 A;  1SXT A;  1BT9 A;  2BKR B;  2CU3 A;  3PTF C;  4IW0 A;  4XWT A;  4K7S A;  2A4Z A;  2WP9 B;  2TSS A;  1BH3 A;  1GUA B;  3AA7 A;  3VVW B;  4XC2 A;  2N7J A;  3ZDM C;  5DL6 A;  4JCH A;  1JCK B;  3SY7 A;  2K3U A;  3AA0 A;  4ICV A;  5D6J B;  1QLB B;  4HPP A;  1HTQ A;  4XDD A;  4GN1 A;  3QA8 A;  1MG4 A;  3RNC C;  4HRO A;  2C60 A;  3HVD A;  1YOV B;  3J9C A;  2HD5 B;  2UWQ A;  1WFY A;  2LFI A;  3LK2 A;  2R4P A;  5DPT A;  4Q2J A;  1FXT B;  2MBE A;  2QCZ A;  2JVC A;  1C9F A;  1RFK A;  3HW9 A;  3RUI B;  2LFU A;  2REX A;  2LGY A;  1GB1 A;  2MP2 A;  2WXR A;  2R61 A;  3BYY B;  1R4M I;  3EFU A;  2W80 C;  4EUT A;  1TIF A;  2MHJ A;  3VE2 A;  4EEW A;  4B6W A;  2E3T A;  2N4F A;  4M01 A;  1KRH A;  3Q14 C;  1F0Z A;  4AP4 C;  4A20 A;  2M06 A;  3W1S A;  1FO4 A;  1NI3 A;  4KGS A;  2MWS B;  3Q3O C;  4RGN A;  1L7Y A;  2X8X X;  5AUK A;  4IWQ A;  3Q3M C;  3OAW A;  1YJJ A;  3PGS A;  5C1Z A;  1L4Z B;  1UBQ A;  4KVG B;  2OJW A;  4HPM B;  3ZRF A;  2KQ4 X;  2XE5 A;  3WAP A;  2D5G A;  4O3W A;  2K39 A;  5G55 A;  1GJZ A;  1SF0 A;  3MC8 A;  2F1C X;  1TJE A;  3AE9 B;  3IT6 B;  1XF5 L;  1FM0 D;  2WXK A;  3H9D A;  4MGY E;  1IBX A;  2BWE S;  1WYW B;  4G0N B;  5DCN A;  3ML8 A;  3BVZ A;  2N2M A;  2MQJ A;  3AN1 A;  3HK0 A;  5FVN A;  2LI5 A;  4ASW C;  2ZEQ A;  4CQN A;  1N6Z A;  2IO3 B;  3QC8 B;  1F1H A;  2LGS A;  1C1Y B;  3ZDT A;  1DYQ A;  4F8C B;  4NJC A;  4OVU A;  2KFJ A;  3WAL A;  2FGQ X;  1XO3 A;  3Q8E A;  1N5X A;  3PPA A; 
#chains in the Genus database with same CATH homology
 4RH6 A;  3ZJU A;  2QIE B;  1ENF A;  1HXY D;  2PTL A;  2LMC A;  1I4P A;  1SE3 A;  3T3O A;  2Y3A A;  3ZJT A;  1YNT E;  5E6J A;  1AWD A;  2OMF A;  2K4T A;  1AW7 A;  4Z3T A;  1FXA A;  3BVM A;  3IXS A;  3OWE B;  3FAH A;  4ARI A;  1D4B A;  5T8I A;  2BS4 B;  2AX5 A;  1WXQ A;  5DL5 A;  3WCQ A;  2O4V A;  3AMZ A;  5IYU A;  2J42 A;  1V1P B;  4GCS A;  2QJL A;  4KGR A;  2JZP A;  1C77 A;  4AYN A;  1ZHZ A;  1FFU A;  2IPK D;  1GFO A;  1FXI A;  2W81 C;  2K0P A;  4OW0 A;  3VRB B;  3C8Y A;  3N9Y C;  2OHF A;  4OZA A;  3POX A;  1FFV A;  5I4D A;  1N61 A;  2NTS A;  3AA6 A;  2LGI A;  1D6E C;  1THQ A;  4O3X B;  1JWA D;  4MM3 B;  4G76 A;  2KC0 A;  3ETR A;  2BS2 B;  5GXG B;  1MM4 A;  1PGB A;  1I4R A;  3LXF A;  1SE4 A;  2XG6 A;  3LK4 1;  1D5M C;  2BB5 A;  1QF6 A;  7PRN A;  1QQR A;  4XDC A;  2MJE A;  3JTY A;  1P7E A;  1PYW D;  2XE1 A;  1TY2 A;  4RF0 A;  2KDY A;  1E10 A;  1YQ4 B;  1N60 A;  3AE8 B;  2JQR B;  1F2R I;  2N0S B;  4PT5 A;  6PRN A;  4D2K A;  3HUI A;  3U4E G;  4FSP A;  2POR A;  1GAQ B;  1HXU A;  1HA5 A;  1DOI A;  2CJN A;  1EU4 A;  2OED A;  4RGM A;  3DA4 A;  1CQV A;  3O13 A;  4EE2 A;  1ZDV A;  2LHE A;  3MC0 B;  4QQ1 A;  2ODJ A;  1VZ6 A;  1PUT A;  1QIL A;  2GB1 A;  2M0A A;  4RJX A;  4LSI A;  2W55 A;  1HXX A;  1EWC A;  2XNA C;  2Y5C A;  1ACC A;  3VE1 A;  3BWU D;  4UDU C;  3AE7 B;  3AAA A;  2JXT A;  1ZHW A;  1HZ5 A;  1M4V A;  3GB1 A;  3NVV A;  4YTP B;  3R8B A;  3ZQ4 A;  2QEJ C;  1QJ9 A;  5AFU K;  1NEK B;  1QOF A;  1NVI D;  2KAJ A;  3HVZ A;  2YPV A;  2YEP B;  4L23 A;  5EE3 A;  4TQ0 A;  2KZ7 A;  1LO5 D;  5LNK 1;  1P4T A;  1TYG B;  1AYF A;  4AFK A;  2RMM A;  3BYT B;  3AED B;  2ICI A;  2W82 A;  4HEA 1;  2BBC A;  4O1N A;  3B2F A;  1KFY B;  1C4P A;  3POU A;  3AE4 B;  3L4P A;  3FYX A;  4FRT A;  1PDX A;  4YSX B;  1QOG A;  2LHF A;  1VLB A;  3AA0 B;  2KXP A;  4O4U A;  3V8U A;  1K51 A;  4FZL A;  3Q8C A;  3KLS X;  1OSM A;  4FXC A;  1D5Z C;  1UWX A;  3SR6 A;  3LK3 A;  2M19 A;  3EMN X;  4M0W A;  4MT5 A;  4C7Z A;  4A55 A;  2RDG A;  2QTK A;  2WDV B;  4AQ7 A;  3URY A;  1ET6 A;  1TZO A;  3AB5 A;  1OQQ A;  4WUR A;  1RM6 C;  4ITK A;  4ZHO A;  2XTR A;  3WI4 A;  3O0E A;  1NYR A;  3LK2 B;  1FRD A;  1L0V B;  1Q10 A;  4KX6 B;  2QSD A;  4YSY B;  3RFZ B;  1J7A A;  2WXI A;  1L0X B;  4AZL A;  1IUE A;  4IKG A;  3TEX A;  1E7P B;  2WXQ A;  3VZW X;  1P7F A;  1TKY A;  4OHJ A;  4B0E A;  3NVW A;  4RCO A;  1YMH E;  4RJW A;  4KKJ A;  2W54 A;  1L4D B;  3VY8 X;  4HRS A;  2PMV A;  3W5U B;  1GOZ A;  2PIA A;  4JWU C;  1GFQ A;  4F4B A;  2PRN A;  2VZK B;  1OPF A;  2GE4 A;  4FRX A;  3AV8 A;  1FCL A;  1OFF A;  3K19 A;  1T6B X;  4AYE C;  4D64 A;  2MH7 A;  1V1P A;  5BMH A;  4GHB A;  5EE2 A;  3HRD D;  3NRZ A;  4GLS C;  4RF1 A;  3IAM 1;  3P1M A;  4NAM A;  2M07 A;  4RL9 A;  1B9R A;  3CWI A;  1FNW A;  2Z8L A;  2ZW0 A;  1GFN A;  3TSS A;  4XNL A;  1HZ6 A;  3R2T A;  4AYI D;  2JYE A;  3H8H A;  1E6E B;  3VR8 B;  1JQ4 A;  1CJE A;  5DL8 A;  4E1S A;  5D3I B;  2H88 B;  5FKA C;  1F2R C;  1YN4 A;  1R7S A;  4AUI A;  3V05 A;  3QRA A;  2W3S A;  1SE2 A;  3TEW A;  4XWW A;  2RPV A;  5EE9 A;  4JE3 B;  2WXN A;  1FCC C;  2WS3 B;  1PFD A;  3AA1 A;  4OZC A;  4RFB A;  1DOX A;  4NZL B;  5HG2 A;  2L32 A;  2N2L A;  1ZHX A;  2Q5W D;  1TY0 A;  2BT6 A;  2J52 A;  3SFE B;  1CZP A;  2M56 B;  2WDR B;  4YSZ B;  3AM9 A;  3SFD B;  1ZXI A;  1TS5 A;  4P16 A;  4D65 A;  1XLO A;  4ARC A;  2DWQ A;  3LK4 2;  2FGR A;  4E1T A;  4JX1 C;  1IBX B;  1CK1 A;  2NMQ A;  3IT4 B;  1C4A A;  2Y0H A;  2HTM E;  3SEB A;  1PGA A;  3P4P B;  3AH7 A;  1KF6 B;  5MPO A;  1YQ3 B;  1V97 A;  3POR A;  1XCQ L;  4B61 A;  3I9V 1;  4NAW B;  2I2Y A;  1GPX A;  2MJD A;  3SZD A;  2AQ3 B;  3Q69 A;  4RLC A;  1QOA A;  1ZE3 D;  2ZFG A;  3AE1 B;  4ZYS A;  2DBY A;  3ABV B;  1FD6 A;  1C79 A;  1L6V A;  1ORM A;  4FMS A;  1ESF A;  1JW9 D;  5H92 C;  3KWL A;  2QMT A;  1SBB B;  4RGO S;  4KR4 A;  2J53 A;  4JFB A;  2WQY B;  3POQ A;  1JWS D;  2XE3 A;  3T24 A;  2J4X A;  3IAS 1;  4O3Y A;  3GP6 A;  2Y0L A;  4DXG A;  1IZN A;  2PW9 A;  4A6Q A;  4OVZ A;  1SJE D;  1FMA D;  1L6U A;  3PO0 A;  4HKZ E;  4YT0 B;  2XMX A;  2JWU A;  1IGC A;  3NSG A;  3SYS A;  3RBH A;  2MHL A;  3SZV A;  1E9M A;  3A2S X;  1TS4 A;  1XCT L;  4TQ1 A;  1MI0 A;  2GRI A;  3P4R B;  3NVZ A;  4IOI E;  3TEZ A;  3U2S C;  2NTT A;  4D5U A;  5H8Y E;  3NVY A;  1NYQ A;  4R3D A;  1ZUD 2;  3G7G A;  3AAE B;  3CIR B;  4G75 A;  2BS3 B;  2WXG A;  4WAF A;  1Q9G A;  5BYS A;  4FOZ A;  1WYG A;  3VZU X;  2DLB A;  1K53 A;  3W9C B;  3AEE B;  3BZD B;  4RLB A;  2EKI A;  4MH8 A;  4N6E B;  5G5H A;  2PVG C;  4KR8 A;  1ZPS A;  3DA3 A;  2BB6 A;  3KWV A;  3VZT X;  1BML C;  3AA7 B;  1MVK A;  3EGR A;  4AKR A;  2PKO A;  1HEZ E;  1YN3 A;  3FC4 A;  2JYT A;  2AQ1 B;  4WWM A;  4XNK A;  1SB3 C;  2L52 A;  1JRO A;  4YTN B;  1STE A;  3AA6 B;  4TMA B;  4FZN A;  1MHX A;  1D5X C;  2Y7S A;  1NEN B;  1QOB A;  4GDL B;  3RPF C;  2LHD A;  5BMI A;  1BXW A;  4L2Y A;  2K5P A;  4KGT A;  4LTU A;  4FSO A;  3VRA B;  3HWB A;  4FES A;  3B2G A;  3PZ8 A;  5ADX L;  2RDH A;  3B9J A;  4AS1 A;  3NZ3 A;  5G5G A;  2EEL A;  2VZK D;  3EA6 A;  1YJI A;  5AFU L;  1KLU D;  4C69 X;  1B1Z A;  3AEB B;  1T5X D;  3TZG A;  2WXJ A;  2IGH A;  2K0L A;  3UU2 A;  2JU6 X;  3AE6 B;  1UUP A;  1BXT A;  2WXH A;  3BVG A;  3MFG A;  4O3Z A;  1HXT A;  3ZYY X;  2MNH A;  3SY9 A;  3LB8 C;  1WGK A;  3VQI A;  4JPS A;  2ZW1 A;  4GCP A;  1I7H A;  2INP E;  2ONQ A;  3KQ4 A;  4HJG E;  1E0Z A;  1SJH D;  4IDI A;  3FIL B;  1QKZ A;  3AEG B;  1N63 A;  2K22 A;  3U52 E;  5BYR A;  2XN9 C;  1UNS A;  3P4S B;  3Q8A A;  3AAA B;  1FNU A;  1J7C A;  1XLN A;  4A90 A;  3T0S A;  1VDV A;  4DQO C;  2BYT A;  3E9S A;  2SEB D;  4C80 A;  3HOL A;  1ROE A;  5C2T B;  5TSS A;  4WH4 A;  3W2D A;  2N9K A;  3T20 A;  1ZHY A;  2KZ7 B;  2BW2 A;  1PRN A;  1EWY C;  5PRN A;  1UWM A;  2IJ0 A;  2IGG A;  2JSV X;  3UI3 A;  1PGX A;  2L83 A;  3BK1 A;  3QRC A;  3P42 A;  4JWS C;  2KMM A;  3DWG C;  1I4Q A;  1H6S 1;  2WXM A;  2GI9 A;  2K9X A;  2LUM A;  2PVO D;  2WNM A;  4ZRP A;  1JWB D;  1L5P A;  5HFY A;  3E56 A;  4H2A A;  4US8 A;  2Y5P A;  3LK3 B;  2JMM A;  2FUG 1;  3AEC B;  2AQ2 B;  2KWD A;  2JX5 A;  4LSH A;  1QT9 A;  2XTQ A;  2WDQ B;  2ACZ B;  2SAK A;  3UPG A;  4C7Y A;  3SYB A;  1FNV A;  2KN4 A;  1C4C A;  1RYJ A;  4N59 A;  5D3D A;  1TKG A;  2IDY A;  2INN E;  4C56 C;  2DYM A;  4OZB A;  2ON8 A;  2WU2 B;  3TUO A;  2ZLD A;  3PQS A;  2ERV A;  1IGD A;  1N5W A;  2B76 B;  3P4Q B;  4YTM B;  5GV0 A;  5BYQ A;  2PLP A;  4N58 A;  1GFP A;  1FRR A;  1TS2 A;  2X27 X;  1ZHT A;  4FZM A;  3MP9 A;  2WXO A;  2J1N A;  3PRN A;  1PHO A;  2E6X A;  5FR3 A;  2Y0K A;  3I57 A;  1SXT A;  1BT9 A;  1TS3 A;  2CU3 A;  3HOE A;  1WRI A;  1WWT A;  2WXP A;  4XWT A;  5HHD G;  5HI1 A;  3KVD D;  3AE5 B;  1DOY A;  1G90 A;  4FT6 A;  3AAE A;  2WP9 B;  4P6V F;  4YWG G;  2MJ3 A;  5BMG A;  2G1E A;  2LEK A;  2TSS A;  2WXF A;  2J4U P;  1F77 A;  2WLB A;  1T3Q A;  3PZ7 A;  4ZOH C;  1XEE A;  1BH3 A;  4B0M A;  1DGJ A;  4XE0 A;  3AA7 A;  1V8C A;  3GP7 A;  4AYD C;  1HQR D;  4GCQ A;  2N7J A;  3AE2 B;  1C76 A;  1J7B A;  5DL6 A;  4AYM C;  4JCH A;  1JCK B;  3P63 A;  3SY7 A;  2K3U A;  5G26 A;  3MJ5 A;  4KRA A;  4TSS A;  3AA0 A;  1KLG D;  8PRN A;  2KAC A;  2QIL A;  1QLB B;  3DWM A;  2F1V A;  4GDK B;  2Y2X A;  3C5O A;  2LJI A;  1RWS A;  4O4X A;  1I4G A;  4XDD A;  1I4H A;  4HKQ A;  3AA1 B;  4FUV A;  3U7Z A;  1ZOY B;  4KKI A;  3MHZ A;  4HRO A;  2V3N A;  2L1A A;  3HVD A;  3J9C A;  4J3O D;  1ZP0 B;  2I38 A;  3LYY A;  1VJK A;  1ZXH A;  4US9 A;  2LFI A;  3LK2 A;  2H89 B;  4Q2J A;  3Q8B A;  1E54 A;  2BTE A;  4U9C A;  1C9F A;  1XXG A;  2V0G A;  1RFK A;  2FE8 A;  3HW9 A;  1C78 A;  2HDE A;  5JDP A;  2LFU A;  4YXD B;  1SIJ A;  4A9A A;  2IGD A;  5JXV A;  3FIL A;  3AEF B;  1GB1 A;  2WXR A;  2R61 A;  3BYY B;  4AKM A;  1KTK A;  1YN5 A;  2W80 C;  5ADX K;  2KDM A;  1BUI C;  3TEY A;  3NUH B;  1Q9F A;  3VE2 A;  1EM7 A;  1WSP A;  1QJP A;  2E3T A;  1I4X A;  4LK0 M;  1KRH A;  1VRA B;  3VR9 B;  4BUM X;  1F0Z A;  4REZ A;  2WXL A;  2M06 A;  1XLP A;  4ZRQ A;  3W1S A;  1N62 A;  1FO4 A;  1NI3 A;  4KGS A;  4USA A;  1JWU D;  2X38 A;  3UAQ A;  3Q8F A;  1XLQ A;  4DXF A;  2G9H D;  3VY9 X;  1K50 A;  1MPF A;  1IZN B;  1ET9 A;  1GFM A;  3ZJV A;  3T3N A;  4RGN A;  3EUB 2;  2XE2 A;  5AUK A;  2N9L A;  1Y56 A;  1SEB D;  1YJJ A;  3PQU A;  1L4Z B;  4RGT A;  1FEH A;  4O49 A;  1SSN A;  4LSF A;  2KQ4 X;  2XE5 A;  2YEP F;  2D5G A;  4O3W A;  1FIQ A;  3BII D;  3NS1 A;  4A8X C;  5C3J B;  1SF0 A;  2FBW B;  1TJE A;  1UGJ A;  1JML A;  2V4I B;  5D7G A;  3AE9 B;  3IT6 B;  5EE1 A;  1XF5 L;  1QJ8 A;  1TKE A;  4AKR B;  5FK9 C;  2F1T A;  1VR9 A;  1FM0 D;  1GB4 A;  2WXK A;  5D5D A;  4PUX A;  4WQM A;  1IBX A;  1VZ8 A;  1EU3 A;  2V3P A;  3ZGZ A;  3BK2 A;  1AN8 A;  2KXP B;  1A70 A;  1ZDX A;  2WU5 B;  2CJO A;  4LLG M;  1YS5 A;  1JAL A;  3BVZ A;  5AUI A;  2N2M A;  3W5V B;  2DYO A;  1L0Y B;  3AN1 A;  1K52 A;  3V3X A;  5FVN A;  1JRP A;  1OQR A;  4RNA A;  5EE0 A;  2MEK A;  4L1B A;  4CQN A;  2W3R A;  1MHH E;  3AE3 B;  5T5F A;  4ZHP A;  3AEA B;  1KH0 A;  3GS2 A;  1VZ7 A;  1MPE A;  1MM5 A;  4LSE A;  1DYQ A;  1V1O A;  2YNK A;  3R2I A;  4NJC A;  4WIP A;  1JWM D;  5DL7 A;  3WI5 A;  2FGQ X;  4MAC A;  1XO3 A;  4GF4 A;  3Q8E A;  1N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...