4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
molecule tags Hydrolase
molecule keywords Pectocin M2
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
1R7SA 1FM0D 3W9CB 1FIQA 4C7YA 1NVID 1RWSA 3AE1B 2XTRA 4JWSC 4G75A 4FZNA 1JALA 2K22A 2M56B 1L0VB 1RFKA 2G1EA 1WRIA 1YJIA 1ZP0B 2OHFA 1IUEA 4HROA 1OFFA 4FXCA 4YT0B 1NYQA 3VRBB 2QIEB 1QOAA 1NENB 2WP9B 3W5VB 1FMAD 2BT6A 2K9XA 3AV8A 3EUB2 3FAHA 2H88B 4P6VF 4YSYB 4C80A 2PVOD 1N63A 2PIAA 1CJEA 1AYFA 4ZOHC 4KX6B 2L83A 4WQMA 2WS3B 3SFDB 3AE4B 2AX5A 3AECB 2H89B 3HRDD 3NVZA 1TYGB 5H92C 3AEEB 3RPFC 3L4PA 1NI3A 1QOGA 1WGKA 2WU5B 3P4PB 5AUKA 4HRSA 4US8A 1E7PB 1DOXA 2MJEA 5C2TB 2K5PA 1N5WA 1PFDA 1N60A 5G5HA 2MJDA 2E3TA 3P1MA 3NVWA 4N6EB 1A70A 3VR8B 1N61A 1YQ3B 2W3RA 3DA4A 2FBWB 2KAJA 3DA3A 1JWAD 1TJEA 1ZUD2 3AE7B 5EE3A 3ZYYX 1N5XA 2Q5WD 2MJ3A 1QF6A 1L6UA 1KF6B 1VLBA 1DOYA 1E9MA 1NYRA 3FC4A 3AE5B 3AE6B 1E10A 1GPXA 1VJKA 1OQQA 1J7BA 1KRHA 1V97A 3PO0A 5EE1A 5EE9A 4YTPB 1J7AA 1VDVA 1PDXA 2WDVB 1XLNA 1FRDA 5C3JB 5G5GA 3WCQA 1QOBA 2JX5A 2L52A 2PVGC 3ABVB 1L5PA 3AEGB 3BIID 2B76B 5GXGB 1SB3C 1ZXIA 3AB5A 1FRRA 4JWUC 1XLOA 4JX1C 1ZOYB 5EE0A 1J7CA 4WWMA 3NVVA 4C7ZA 3LB8C 2W3SA 3HVZA 3NRZA 3VRAB 4YSXB 1JRPA 3SR6A 3B2FA 1TKYA 2ACZB 3AMZA 3NVYA 1QT9A 4ITKA 1JW9D 2LEKA 3NS1A 4USAA 1UWMA 1CZPA 2WQYB 2CJNA 1JQ4A 1OQRA 2Y5CA 2EKIA 3AE9B 3AE2B 1ROEA 4YSZB 1PUTA 2BS4B 3AM9A 3ETRA 3B9JA 2XMXA 1E0ZA 1V8CA 4FZMA 1FO4A 4IDIA 3P63A 5H8YE 1KFYB 1RYJA 3LXFA 1WYGA 1I7HA 1GAQB 2PKOA 2DWQA 2KMMA 3B2GA 1RM6C 3AEDB 1FFUA 2DBYA 4ZHOA 1FFVA 1AWDA 2N0SB 1XLPA 1N62A 1TKGA 1FXIA 3AEBB 3VR9B 4G76A 2XTQA 1SF0A 1E6EB 3W5UB 1QOFA 1DOIA 1JWBD 1QLBB 1NEKB 4FZLA 1DGJA 2HTME 3AH7A 1XLQA 3SFEB 1B9RA 1F0ZA 1YQ4B 3CIRB 1XO3A 4YXDB 2WDQB 1WXQA 5MPOA 4LTUA 2CJOA 4A9AA 1T3QA 2WLBA 4N59A 3P4SB 4ZHPA 3P4RB 1JROA 3CWIA 1TKEA 2JQRB 3HUIA 4US9A 2WDRB 2W55A 1WWTA 1YJJA 2BS2B 2WU2B 3DWGC 2W54A 3AEAB 4N58A 3DWMA 1L6VA 1EWYC 2CU3A 2MH7A 2QJLA 3AE3B 3AN1A 3AEFB 2BS3B 4YTNB 3KWLA 1FXAA 5AUIA 3AE8B 4YTMB 1SIJA 3P4QB 2M19A
chains in the Genus database with same CATH superfamily
2JPHA 1THQA 2KMCA 1HTOA 3OJ4B 2VH1A 1STEA 1P4TA 3V8UA 3ZIMA 4XDDA 4FT6A 4P6VF 4YSYB 4A55A 3RNBC 1ZHZA 2DZMA 4GN1A 2LASA 2NBWB 2OOBB 2L3ZA 1MG4A 3TEXA 4ACFA 3PRNA 2WDTB 2JSVX 5JH5C 3OAWA 1JWAD 2GBJA 3L54A 1WM3A 2KACA 4E3CA 2D07B 3Q8FA 3DWOX 3TEZA 2Z0DB 4A8XC 4DDGD 3L08A 4P1BC 2K0LA 5EE9A 2RD0A 1RLFA 3KUCB 2I38A 3I9V1 2AL6A 1XXGA 2YVCA 5EDSA 4HDOA 4N74A 3EA6A 2IPKD 3NG0A 3L0WB 4NJ6A 4OZBA 2KYWA 3A9KA 2DENB 3BS0A 3PQUA 1WGYA 4O49A 3B2FA 3NJTA 3BYTB 2LGDA 3Q14C 1GC6A 1CQVA 3HOEA 1JQ4A 2R2QA 3T24A 5BO4B 1YJ1A 2XMXA 2PTLA 1PGAA 3LK2B 1T0YA 4W9DA 2NBVB 1I7HA 2NR2A 1N62A 2D3AA 2KX0A 5BYSA 5G39A 2JUOA 2LHDA 4N59A 3RZFA 2KVRA 2W55A 2MHJA 1YJJA 1D3ZA 3WAMA 1D5ZC 3HHMA 2LGYA 3U30A 2LGIA 4EUTA 1AN8A 2X8XX 4TQ0A 2L0TA 2QSDA 4C00A 4JE3B 2LZ6A 1R4MB 1FCLA 3KWVA 1H4RA 3U7ZA 2GI9A 1P9DU 2WWZA 4GIVA 4NNJB 2AEHA 2KJRA 4CQNA 4BAXA 5DL6A 2PVOD 3AAEA 4IW0A 2DYMA 5AFUK 4A3OA 1GUAB 3RN9C 2XBBC 1OSMA 1XQQA 2LRWA 3ML8A 5IP4D 3MFGA 4ZRKA 2EELA 2J0MA 3ZNGC 1TIFA 1BH3A 5GTIO 2MJEA 2K5PA 4IM2A 2WX0A 3QIJA 1N60A 2MJDA 3I63C 2KWCA 5IOIA 2Z0EB 3VXWA 1SE9A 2ON8A 4MELA 3ZYYX 3T3NA 1L6UA 4X57B 5LXHA 4FLHA 1VCBA 1HA5A 4IUMB 2CR5A 2KDBA 2MBEA 2NPTA 2J4UP 2Y2XA 3AEGB 2LRUA 2W82A 2BKRB 4PS8A 4II3B 2N7DA 2JXXA 3LK3B 2K8BA 3LYYA 1LO5D 3GZNB 2PORA 2LGXA 4D2KA 1QJPA 2KD0A 2R4PA 1JW9D 3HM3A 4FULA 5D5DA 2BB5A 4MGYE 2WXIA 4RF1A 4HVBA 4FZMA 4DWFA 4FESA 3AU5A 3RNFC 4CHKA 1WYGA 2PE6B 1MPFA 3AA7B 2DWQA 3DBRI 5TSSA 4W9LA 1Q5WB 2BQQA 5DPSA 3N30A 3L17A 4YL8A 2ZVNA 1OEYA 3SHQA 5CX3A 1D6EC 1L2NA 1WJNA 1YNTE 3URYA 2BS2B 4HPMB 4B0MA 3AEAB 1MG8A 1E8WA 1RRBA 3TIXA 3W1YA 4KVGB 2D3CA 4F1SA 2M19A 2ERVA 2JMMA 2KJHB 2B3AA 1ZE3D 1K53A 3W9CB 1QOAA 2YLMA 5FR3A 4AYEC 2PIAA 3Q6BA 3ZLZA 3L16A 3PSEB 2D10A 2H89B 2KDFB 2FAZA 1LXDA 2GLSA 4TKNA 1P7EA 4RH6A 3Q3FA 4PK1A 3IAS1 2OMFA 1L4DB 1F2RI 2WHIA 1PFDA 2ZPYA 1SE3A 4AYMC 3NVWA 1A70A 3M62B 4ZYNA 1AW7A 1ZUD2 2QILA 2XN9C 1I35A 5J18A 5GMVA 1GOZA 2D3GA 1XCQL 4HK2A 3EHVA 3HM6X 3IT4B 3OJ3A 2KZRA 4RFBA 4MSMB 1XD3B 2GOWA 2ICIA 4PT5A 4BBNC 3HW9A 3BYYB 1OTRB 3ZNID 2BYTA 1ZHWA 3U52E 4TSSA 2C7HA 2C9WB 4BOZB 1ET9A 4LNOA 1Q9FA 5EE0A 2V4IB 4WWMA 3NVVA 3LDZE 2W3SA 4YSXB 3POXA 3PHWB 3V61A 4W9IA 4ITKA 2K39A 2KLGA 3NS1A 1UWMA 1V1PB 5D2MB 2V4LA 1T0RC 2LJIA 3AE2B 1SE4A 4UB8O 1PUTA 1V9JA 3PS6A 3ZRFA 2PMVA 3P63A 1FO4A 1ZW7A 4ZHOA 2DBYA 2SAKA 1ZHTA 4K1RB 2FCNA 4GB9A 2KDMA 2PW9A 2ONQA 1NEKB 1UELA 2BYVE 4Q2JA 1UBIA 2XE5A 3X0WA 3QJZA 2MNHA 3VUWA 5KAFO 4K81A 5PRNA 4PYZA 4US9A 2L00B 3C0RB 4G11A 1WRDB 1T1LA 1SJHD 3RBHA 2XE2A 3RNCC 2LVQA 2N9LA 1R7SA 1KLUD 2M8SA 2V1YA 3AI5A 3RD2A 3AA7A 2NTTA 5L83A 4HROA 1NYQA 4IOIE 4AKRA 4JLCA 2N1WA 1WSPA 1XF5L 4MACA 4MGIE 4BKGA 3PQSA 4AWJA 5H92C 3RPFC 4RJWA 1SGHA 2ZNVC 5AUKA 5D94A 5C2TB 2RMMA 5E6JA 1C1YB 3KYCD 5LLIA 3V6EB 1VR9A 1QJ9A 2KAJA 5EE3A 2LVOA 3VE1A 3NZ3A 4K7SA 3QAQA 3Q8EA 1R4MI 3TEYA 3QC8B 1WGDA 1V97A 4A20A 2MBOA 1V5OA 1V5TA 1UF0A 3WU2O 1GFPA 4GGQA 2FCQA 3DQVA 4KKIA 5CTRC 5GXGB 4WJNA 3Q8BA 3V60A 4JWUC 4C7ZA 1YN4A 3LB8C 3NRZA 1WMHB 4NQLB 3PTFC 3DVNV 3O13A 2BYFA 1XT9B 4MEMA 4FSPA 4ASWC 3HIZA 2KHWB 1OQRA 5CHFA 3UPGA 1YMHE 3ZGZA 3PORA 1E7UA 2IO3B 1IGCA 4BKTA 1XLPA 3RCZA 1WFYA 1WE7A 1SIFA 4FHKA 1GFQA 2XE1A 2AQ2B 4KIKA 4FBJB 3K19A 2CJOA 4W9EA 1C9FA 2OEDA 4WWPA 1I4RA 1V80A 2FGQX 4WAFA 4TV3A 5D6JB 2KANA 4REZA 2WXJA 3P4QB 2RSUA 2Y0HA 1MHHE 3ZJUA 4CYEA 1Q10A 3A0HO 2N2MA 1WH3A 1NDDA 3VRBB 2KZ7B 2K9XA 4RM8A 1P1AA 2REXA 2L83A 2AQ3B 4PS7A 4XNLA 4RLCA 4LSFA 4MM3A 2VH2A 3QWZB 2KFKA 4PJ0O 2R4NA 4S17A 3RMKC 2QDFA 4KGRA 5CHVC 4DHJB 3DVGX 2VZKB 3U8ZA 2E3TA 4N6EB 5HKHA 3Q3OC 5FK9C 3R7QA 2ODJA 2LJ5A 2INPE 1C78A 1TBEA 3ENEA 4O1NA 5JXVA 2DHZA 4JQWC 5L95C 2RDHA 2KN5A 3Q3NC 4B6WA 3RYTA 5EE1A 3ZJVA 3TUOA 3BY4B 3I3TB 1P98A 4A6QA 2EMTA 1FEHA 2L52A 4RJXA 4OVVA 2MSED 2Z8LA 1MI0A 3LJ3A 3SD5A 2M4NA 1HXYD 3TSSA 2PRNA 1IZNB 1HZ5A 3KUZA 5DL8A 1IBXA 2D2QA 5C23A 2MBBB 3OG5A 7PRNA 3AE9B 3TJPA 3PZ8A 1TS3A 1ZXHA 2Y5BB 1RYJA 4RL9A 2KQ7A 4L2YA 4I6PA 2QHOA 4WWOA 3AEBB 4GSWA 1B9RA 3PLUA 4WIPA 2M0XA 4XGAB 2ZEQA 5E79O 5BMIA 2G4DB 4ZHPA 1P3QU 5IAAC 1WR1A 4MJSA 3AE8B 2KQSA 4LJOB 2N7EA 4BBNF 3NHEB 3VAWA 3K9PB 2DAFA 2VZKD 1FPYA 2KC1A 1EU3A 1H8CA 1F1HA 1YJIA 1IUEA 4FXCA 2CHZA 3GS2A 2BT6A 2D3BA 2JZZA 2LMCA 2LXAA 3SY7A 1C76A 1FD6A 3B0AA 2D5GA 2WXOA 3AEEB 1WGKA 1R4NI 3DBLI 4HRSA 1E7PB 3V6CB 1J8CA 3BINA 4D65A 2KFKB 2WXQA 3P42A 5FVNA 2G9HD 3EMNX 3T8MA 4IWOA 1R4NB 3DBLB 1E5WA 1VD2A 2OJRA 2YEPB 2R61A 4MH8A 2L76A 4WJPA 4JIOU 3PO0A 3BRZA 2KTRA 4II2B 2JZPA 2K3UA 4AKMA 2NBUA 1WXSA 4GCSA 2O2VA 2RPVA 2A4ZA 1FNWA 1HZ6A 2BVCA 2J52A 2WXMA 4IWPA 3VDZA 5HHDG 1I4GA 3DCGA 2ZPNA 2GB1A 2KKCA 3A9KB 3B2GA 3N1XC 3A4SC 1FFVA 1RAXA 2KLCA 1TKGA 4KDLB 3U2SC 5TR5A 3CIRB 3IBEA 1M94A 1XO3A 2SEBD 1SEBD 2JT4B 3IAM1 4RGMA 2KXJA 3A9JA 1ORMA 3P4RB 4RMAA 3HUIA 3ZDTA 2WDRB 1WWTA 3FILB 3WI4A 3Q2AC 2QJLA 4YTNB 2F1VA 5G55A 3KZIO 3DWNA 4LSHA 4JL9A 1E8ZA 2K25A 3UQAA 2WXKA 1JALA 1TZ1A 3UU2A 3BVZA 2R4OA 4AZLA 3BZDB 4DXAB 2LHEA 3DBSA 3KUDB 4WH4A 4FJYA 4KX6B 2FIFA 1GNUA 1WZ0A 2Z59B 2WS3B 3PLVA 2L7RA 5D3IB 3VZUX 2RR9A 4DQOC 1NI2A 4P16A 3UAQA 1ESFA 1N5WA 1YQBA 4WJOA 1E0ZA 4GLSC 3A2SX 2GMIC 2M0AA 3AE7B 2INDC 3ONSA 3V05A 2IYDB 1N5XA 2MJ3A 3FC4A 1UGJA 5T8IA 1D4BA 2R88A 2F1TA 4NJ7A 4ICVA 1J7AA 4KIKB 1XLNA 5G38A 4GDKB 5C3JB 2MP2B 1MM5A 2JX5A 2PVGC 4FHJA 2KFJA 1YN5A 4ARCA 2INCC 3HVZA 2WNMA 4N9F4 4FADA 2FGRA 1TKYA 3AMZA 2N9EB 1I42A 1WZ3A 1K8RB 4ZDVA 2M17A 2X9KA 2X27X 4FMSA 2JRHA 1E7VA 5H8YE 4W9HA 2MCNB 2ZNVB 1WE6A 1RM6C 1L4ZB 2O4VA 3GE8C 1F52A 2IY0B 1DGJA 4M8MA 4GF4A 1YQ4B 1KJTA 3PV1A 1TT5B 1HQRD 1BT0A 3PF1A 2A5UA 3C5OA 4LDTD 1V1PA 1YD8U 2KWUB 4LNIA 3DWGC 2FUG1 2J53A 4GHBA 2JF5A 4W9FA 4DXGA 5KAIO 4PYUA 1J19A 1UGMA 4PS3A 4FZNA 2GRIA 4BFRA 1ZP0B 3RUIB 6PRNA 4YT0B 2KXPB 2LD9A 2QIEB 2KT7A 3PVLA 2H88B 5GTHO 3JSVB 1WX8A 3KVFB 3UIOB 4XC2A 2R89A 4AKRB 3ML9A 1WI0A 3QK0A 2G3QB 3FKYA 3T9LA 2O2VB 2ZLDA 3KH0A 1IZNA 5H2FO 2IWVA 2LVPA 3PGUA 2PE9A 4WAAA 2PPHA 2BWFA 4Z3TA 4DDID 2F1CX 3WAPA 4IM0A 3A0BO 1N61A 1YQ3B 2CKHB 3DA3A 2BTEA 1EWCA 1KF6B 1PGBA 4ICUA 2XNAC 3AE6B 3Q8AA 4OVUA 2RGFA 3ZO5B 3VTUA 2WVPA 2KX3A 3JVZX 1VJKA 1WX9A 3MC8A 1J7BA 3PRPB 2I1JA 4YTPB 5B66O 5EE2A 4U9CA 2K8HA 1CMXB 2B76B 4XYCA 4L1BA 3NOBA 1BXTA 4FRXA 4AJYB 1IYFA 3SZDA 2ACZB 3C8YA 4HDQA 4L23A 3VVWB 3VE2A 4PR7A 2LFUA 3BVMA 4IKGA 4WWNA 2JZ3B 2HJ8A 2QEJC 1E54A 5JDPA 2AQ1B 2WXGA 3W5UB 1FNUA 2V3SA 3POQA 1SBBB 3GP7A 4KZCA 4FSOA 3SFEB 1SJED 4GDKA 4HCNB 4EOYA 1WXVA 3TZGA 1T3QA 1OGWA 5TISO 2DZIA 4LK0M 2WU2B 1XCTL 4E1TA 3DWMA 1V6EA 1L6VA 2KWDA 5AUIA 3VZWX 3H7SA 3ZUNA 3SU8X 1SE2A 1X1MA 2L1AA 4C7YA 3IXSA 3BWUD 4RM9A 1IGDA 4IG7B 3R2TA 3Q3JA 3JW0X 1WGGA 1NENB 3SEBA 1V81A 3MJWA 1KLVA 2EMSA 1N6ZA 3JCUO 2MEKA 3UI3A 2N1VA 3SFDB 1JWUD 1VZ8A 3VFKA 4US8A 4NPNA 2V0GA 3SYSA 1VZ7A 3AA1B 1UWXA 2RDGA 2KVZA 3ZQ4A 4RGOS 4GDLA 4G0NB 3N32A 1NYRA 4M01A 4J6IA 4JCHA 3NZSA 3P2BA 4GDLB 1GB1A 1KM7A 3VUYA 4WURA 1VDVA 1PDXA 1FRDA 3MHZA 4KR8A 1KLGD 1IPGA 3G7GA 5E6OA 5IN7A 1EM7A 4M02A 3W2DA 5HFYA 4CTDA 1UBQA 4E71A 5JHAA 3MTNB 3SR6A 2MRPA 5JHBA 2LUEA 1YX5B 2BS4B 2IY1B 2AYOB 2BW2A 3AAAA 3KYDD 2N9KA 4FN2A 4AUIA 3RULA 2KNBA 2XTQA 3AAAB 2ZW0A 1QOFA 2JYEA 1DOIA 4MDKE 4EE2A 1I4QA 2JXTA 5FKAC 1T16A 4FJVB 1Q1OA 3U4EG 3ZXVA 1JROA 4TQ1A 2JWUA 8PRNA 3UGBB 1WX7A 5LXIB 5G26A 3HWBA 2L05A 5E6PA 4F8CB 3NZUA 4C4VA 2WXHA 1WRIA 3AA0B 2WJRA 1OFFA 4LCDE 4NQKE 4HJGE 3AA6A 1FMAD 2K6QA 1H6S1 3N1ZC 1KH0A 1MM4A 3JTYA 4ZRQA 3ZDMC 2INNE 3H7PB 3HRDD 3NVZA 1TYGB 5KHQA 4FUVA 4HXDA 1UH6A 4ZRPA 1TY2A 3ZTCA 2MA9B 3ZJTA 1GB4A 2N2LA 3ZTDA 5ADXK 1FCCC 2HDEA 4UDUC 4LNKA 2FBWB 3R7RA 4DBGA 1OEYJ 3V3XA 5AZHA 3SZVA 4RGNA 3RNEC 2KN4A 1KRHA 5G3AA 2J7QB 3CMMB 2N9PC 4O4UA 1GFMA 2FCSA 3LK41 2IGHA 3EFCA 4WJQA 3GB1A 5AZFA 1A5RA 1VZ6A 1WJUA 2WYQA 1MVKA 4N75A 1PRNA 2MLBA 3T0SA 3R8BA 1TZOA 2FNJB 2WXRA 3DDCB 1MPEA 3V62A 5IKCM 3N9YC 3Q3MC 1WF9A 2AXTO 2FCMA 4FJZA 2K4TA 4KGSA 3R66C 3L10B 2IBIB 2MWSB 2WDQB 3AU4A 2BF8B 4C69X 4AS1A 2JRIB 3H9DA 3VTWA 2YNKA 4B9KA 2XEWA 3A1QA 4JWSC 3DPDA 4IL6O 1M4VA 3NS8A 4AOFA 1NVID 1YIWA 1YS5A 3AE1B 3UF8A 3KVDD 4JGHB 3A33B 3AULA 2MP2A 2Y0LA 5AZGA 4AFKA 4K7WA 4MJSB 4ANWA 4K7UA 1CJEA 2J4XA 3AE4B 3AECB 4FA6A 2Y5PA 4XX5A 3DHHC 2ZJDA 4D64A 2DX5B 5DCNA 5DL7A 2LFIA 2IJ0A 1JMLA 2C60A 4EEWA 3WIMA 2QCZA 3WA0A 1UZXB 4B0EA 1HTQA 1ZDXA 1P0RA 1E9MA 2ZVOA 2MHLA 2HE7A 5JZEB 1C79A 3DHGC 3IHPC 2IGDA 3DZMA 4EZJA 5ADXL 2UYZB 1JWSD 1K52A 1MJDA 3APFA 5G2NA 3WCQA 3ABVB 4QAYA 3TEWA 2V9HA 3AB5A 1FRRA 3HK0A 2N9XA 4XNKA 2MQJA 1T6BX 1UUPA 2YEPF 4W9CA 1L0XB 1QT9A 1LFDA 1RFAA 2LEKA 2LXCA 3ALBA 4HWIB 4KGTA 3AAEB 1I4XA 2DYBA 2NVUI 3H8HA 4IC7B 2W80C 2JWZA 4O4XA 4O3YA 1QQRA 4GXBA 4KDIC 4RCOA 1DYQA 1S1QB 1UNSA 2NCNA 3PGSA 3M63B 4B61A 4LTUA 2I1KA 1I4HA 2MW5A 1D5MC 3CWIA 1TKEA 1ZPSA 4NAWA 2WXNA 2MH7A 3RNGC 3TCAA 4EZLA 2JU6X 2LGSA 2KC0A 1F0ZA 3APDA 3QX1A 2XG6A 3UQBA 4W9JA 3DVGY 4MH0E 3D32A 3ZKJC 3R2IA 1Z2MA 4XWTA 2DAJA 2OHFA 2IO1B 1C77A 3BVGA 4OW0A 2CHWA 3PRMB 3ECIA 4G50A 5BMHA 2Y3AA 1PHOA 2FIDA 1IBXB 1ZHXA 1T0QC 4HPPA 2LUMA 4W9KA 1ZGUB 5AFUL 1VLBA 1TTNA 3KLSX 1TY0A 4DHZB 1QKZA 4A90A 1YN3A 1LGRA 4O3WA 5DPTA 5E6NA 4BOSC 3I57A 2R8AA 4H2AA 2WDVB 2JY6A 4LNNA 4W9GA 4RLBA 3ZNZB 1G6JA 5BMGA 1L5PA 3BIID 2UU7A 3IT6B 2O6VA 2UWQA 1ZOYB 1J7CA 1C4AA 2BYEA 3GZNI 1FXTB 2Y0KA 4AYDC 1HXXA 3CSTA 2Y5CA 2WJQA 2FUHB 2WXPA 3CF6E 1E8YA 3PGEA 1BXWA 1LQBA 3B08A 3O0EA 1ET6A 3U7DA 2R4LA 1K50A 2G45B 1FXIA 4G76A 2V3NA 4LLGM 2PJHA 1QLBB 2Y7SA 1ISNA 4EZKA 3EECA 3Q8CA 1NBFC 2BB6A 2M07A 3E9SA 1S5LO 1WXQA 3H6NA 3LK2A 4K3CA 2WLBA 4LNFA 3EGRA 4XZ4A 4RF0A 4UB6O 3FAHA 3R3MA 3AN1A 1GG3A 3AE3B 3AEFB 1SSNA 5KHOA 3L13A 4JFBA 4P1CC 4G75A 2KTRB 4ZRIA 4BUMX 4J3OD 2M56B 2R2OA 1L0VB 4E1SA 1KOTA 3S2AA 1Y56A 2D11A 1TS5A 4M0WB 1E10A 3EUB2 2M1MA 1TS2A 3LK42 2FE8A 2ZW1A 3VHTC 1AYFA 4LSEA 1C4PA 2AX5A 1BMLC 2ZZPB 1QOGA 4KRAA 3PGRA 2DNFA 2WU5B 3QARA 4BZAA 4D5UA 2IO2B 4PUXA 2LHFA 1P7FA 3O65B 5DPWA 2G4SA 2DZKA 2ASQA 2W3RA 3PPAA 3FILA 4O3XB 4P7IA 2KTFA 1FNVA 1K51A 2MBHA 4IM3A 1WIAA 2KOXA 3OLMD 3SYBA 1OQQA 3A9JB 3NSGA 2OJWA 3AA0A 3TBLD 3UIPB 2PEAA 2QTKA 2N7JA 1ZXIA 1XLOA 2C5LC 1JRPA 1E8XA 4HCPB 2CU1A 4KR4A 3MHSD 3MC0B 1CZPA 2CJNA 5BYQA 2KQ4X 1C4CA 2X38A 2RDBC 4IDIA 1KFYB 4B95A 2N4FA 2IZVB 3VR9B 3QRAA 1SF0A 5HI1A 5C1ZA 5CHWA 4M8NA 1J0GA 1JWBD 1V1OA 5FR6A 2KMAA 4EFOA 4YXDB 2XE3A 1V86A 4A9AA 2KK8A 2CS4A 1WXAA 3Q69A 2JQRB 2L0FA 1Z5SB 4FOZA 4IWQA 3IFWB 3KWLA 4KV2A 4YTMB 2L32A 1WMHA 4MGZE 3WI5A 4F4BA 4LJPB 2IWWA 3VZTX 1FIQA 2XTRA 4MSQB 2ZCBA 4HLEA 5IYUA 2G1EA 2LWPA 3RNAC 4KSLC 5D7GA 3M95A 3W5VB 4A3PA 1F2RC 4C80A 1GFOA 4ZOHC 4TUUA 2DLBA 3AA6B 4WQMA 4NZLB 1UD7A 3PHXB 5GV0A 2K6DB 4XE0A 4S0RA 1EU4A 1WJ6A 3ZVVA 1T0SC 3PRZA 4DK5A 3H1UA 2BGFA 4KKJA 1LM8B 3MJ5A 3X23A 3KW5B 1HE8A 5AEKB 2XK5A 1DOYA 1L7YA 3GP6A 1PYWD 2K0PA 5B5EO 2M06A 1JCKB 2PLPA 2QMTA 2J0JA 4HPLB 4XWWA 1I4PA 5G5GA 1PGXA 1QOBA 3LK3A 3HVDA 4ANUA 3VRAB 2HJ1A 3WALA 1HXTA 2NPTB 4LDTB 4HEA1 2WXFA 2HD5B 5J17A 2JVCA 2RPQA 4F7ZA 3LXFA 3N3KB 2KMMA 4CO7A 1AWDA 3T20A 2KC2A 1QJ8A 1MHXA 3DBRB 1E90A 2NS5A 1VRAB 3M3JA 2HTME 4FZLA 3CSFA 1EO6A 3ZXRA 3H7PA 3EFUA 1ENFA 2WGSA 4NAWB 1T5XD 5MPOA 2YPVA 3FYXA 2KDYA 2DZJA 4GU2A 2W54A 4N58A 2V3PA 1EWYC 3GE3C 2BS3B 3SY9A 1KTKA 1SIJA 2DYOA 1GJZA 3VH3B 3IG3A 3DBHB 2O6VD 2ZCCA 5I4DA 2K22A 3OWEB 1ACCA 1RFKA 3E56A 4MM3B 4KZ0A 3APCA 3QQ8B 3VTVA 2CHXA 3T3OA 2WP9B 3VQIA 4R3DA 4AP4C 3NUHB 2WX1A 4E74A 3RFZB 2KJ6A 3VH4B 2KZ7A 3ZW3A 4HKQA 1YX6B 4MGKE 1NI3A 4M0WA 3TMPB 3P4PB 3J9CA 3WANA 4GCPA 1EUVB 2KDEB 3W1SC 3VR8B 3RT3B 4NY0A 3DA4A 3RZWC 1TJEA 2WXLA 1WGHA 4EKUA 4AJWA 3UINB 2KWVB 5J2RA 1GC7A 3AE5B 3VUXA 1WY8A 4OVZA 2MX2A 2J1NA 3QA8A 3QHTA 4OZAA 3AXCA 2BPSA 2KDIA 5D3DA 2AWTA 3MC9A 2ZFGA 2VRRB 3GOEA 2GBRA 4KSKC 5DL5A 1ZHYA 3EC8A 3KQ4A 3QRCA 3BRYA 1D5XC 1L0YB 3PT2B 2HTHA 4URKA 1TS4A 3NVYA 4HJKA 1C3TA 3VY8X 2I2YA 2E6XA 4DHJD 2IGGA 2EKIA 1ROEA 4BKSA 4GOCA 3B9JA 3ZNHB 3B1LX 4TMAB 2PKOA 4C56C 1FFUA 1HXUA 1B1ZA 4GCQA 4RNAA 2N0SB 3AA1A 2O6VB 4C4VB 1E6EB 1WR6E 3IVFA 1PQSA 3AH7A 5DPRA 4ZRJA 4ANVA 4NJCA 1XLQA 5T5FA 3PZDA 4XDCA 3K9OB 4AUQC 4K3BA 1G90A 3RI7C 3PREA 2J42A 1V2YA 3BK1A 3P4SB 3QCAA 2NTSA 2AL3A 2BBCA 4USAA 4ZYSA 3ETRA 4DHZE 1Q0WB 3VY9X 5BYRA 1FM0D 1RWSA 2C7MB 1OPFA 4G3XB 2KO3A 1WGRA 1XEEA 1F77A 2MBQA 5IO9A 1Y8RC 2BKFA 3AV8A 1V49A 1YOVB 3JSVA 1N63A 4AQ7A 3DBHI 2GBNA 2K8CA 3DVNU 4YWGG 2XK5B 2K1FA 2J0KA 4OHJA 3L4PA 2JQYA 4ANXA 2KXPA 2W81C 2JYTA 1DOXA 2IO0B 2EKEC 2IDYA 4ARIA 5G5HA 3P1MA 3POUA 1HEZE 1MFWA 4I6LB 1ZDVA 4M00A 3WAOA 2Q5WD 1QF6A 4I6NB 4LSIA 1JRUA 1BUIC 1WM2A 1GPXA 1WJ4A 1WYWB 2GBMA 2GBKA 3A4RA 2NMQA 3ZRCA 4QQ1A 4DXFA 4BVUC 1SB3C 3DHIC 3W1SA 4JPSA 1U4AA 3NY5A 4JX1C 1QZEA 2TSSA 4FRTA 1TGZB 3A1QB 5IA7A 2C7NB 5HG2A 4AYID 1QILA 1IP9A 2WQYB 1F9JA 3I5JC 3HOLA 4YSZB 1S3SG 3AM9A 4WQOB 3BK2A 5LNK1 1V8CA 3JYUA 4NAMA 1CK1A 1SXTA 1GAQB 1OQYA 1EF5A 3AEDB 1EF1A 1BT9A 4GMVA 4OZCA 4FQEA 1GFNA 1ZKHA 1AARA 4MT5A 3MP9A 2GE4A 4HKZE 3TL5A 1Q9GA 4AYNA 3C19A 1JWMD 2LI5A 3PZ7A 2QC8A 3SDLC 1WXMA 2W9NA 2CU3A 3DOWA 2BWES 3N20C 4BKSD 1FXAA 4O3ZA 4RGTA 2L8JA 3N1YC
chains in the Genus database with same CATH topology
1MHHE 3ZJUA 1SE2A 4JFBA 2L1AA 4C7YA 1THQA 4G75A 1Q10A 3IXSA 4BUMX 4J3OD 3BWUD 2M56B 1L0VB 4E1SA 1IGDA 2N2MA 1STEA 1P4TA 3V8UA 1Y56A 3R2TA 1TS5A 3VRBB 4XDDA 2KZ7B 1NENB 1E10A 4FT6A 2K9XA 3EUB2 4P6VF 3SEBA 4YSYB 4A55A 1TS2A 3LK42 1ZHZA 2FE8A 2MEKA 2ZW1A 3UI3A 1AYFA 2L83A 4LSEA 2AQ3B 1C4PA 3SFDB 2AX5A 1BMLC 4XNLA 4RLCA 4LSFA 1JWUD 1QOGA 4KRAA 2WU5B 1VZ8A 3TEXA 4D5UA 4US8A 4PUXA 4KGRA 2V0GA 2LHFA 3PRNA 1P7FA 2VZKB 2E3TA 3SYSA 2JSVX 1VZ7A 4N6EB 3AA1B 1UWXA 2W3RA 5FK9C 2ODJA 2RDGA 1JWAD 3ZQ4A 2INPE 3FILA 4RGOS 2KACA 4O3XB 1C78A 3Q8FA 1FNVA 1K51A 4O1NA 1NYRA 5JXVA 3TEZA 4A8XC 4JCHA 2RDHA 4GDLB 3SYBA 1OQQA 2K0LA 3NSGA 3AA0A 5EE9A 5EE1A 3ZJVA 1GB1A 2I38A 3I9V1 3TUOA 4WURA 1VDVA 1PDXA 1XXGA 4A6QA 1FRDA 3MHZA 4KR8A 1KLGD 3G7GA 1FEHA 2L52A 3EA6A 4RJXA 2IPKD 1EM7A 3W2DA 2QTKA 5HFYA 2N7JA 4OZBA 1ZXIA 2Z8LA 1MI0A 1XLOA 1HXYD 3PQUA 2PRNA 3TSSA 1IZNB 1JRPA 4O49A 1HZ5A 3B2FA 3SR6A 5DL8A 3BYTB 1IBXA 4KR4A 1CQVA 3MC0B 1CZPA 2CJNA 3HOEA 7PRNA 1JQ4A 5BYQA 3AE9B 3T24A 2BS4B 3PZ8A 2KQ4X 2XMXA 1TS3A 1ZXHA 1C4CA 2PTLA 2X38A 1PGAA 4B0MA 3LK2B 4IDIA 1KFYB 1RYJA 1I7HA 4RL9A 2BW2A 3AAAA 4L2YA 2N9KA 4AUIA 1N62A 3AEBB 3VR9B 2XTQA 3AAAB 3QRAA 1SF0A 5HI1A 2ZW0A 5BYSA 1QOFA 2JYEA 1DOIA 1JWBD 1V1OA 1B9RA 4WIPA 4EE2A 1I4QA 2JXTA 4YXDB 2XE3A 2LHDA 5FKAC 4A9AA 5BMIA 4N59A 3Q69A 3U4EG 4ZHPA 1JROA 4TQ1A 2JQRB 2JWUA 8PRNA 2W55A 1YJJA 4FOZA 1D5ZC 5G26A 3HWBA 3KWLA 3AE8B 2LGIA 2L32A 4YTMB 3WI5A 4F4BA 1AN8A 3VZTX 4TQ0A 1FIQA 2VZKD 2QSDA 2XTRA 4JE3B 1EU3A 3KWVA 3U7ZA 1FCLA 5IYUA 2GI9A 2WXHA 2G1EA 1WRIA 1YJIA 1IUEA 3AA0B 1OFFA 4FXCA 5D7GA 3W5VB 3GS2A 4HJGE 3AA6A 1FMAD 2BT6A 4CQNA 5DL6A 2LMCA 1F2RC 1H6S1 4C80A 2PVOD 1GFOA 3AAEA 3SY7A 1KH0A 2DYMA 1MM4A 3JTYA 5AFUK 1C76A 4ZOHC 4ZRQA 1FD6A 2D5GA 2DLBA 2WXOA 3AA6B 4WQMA 1OSMA 4NZLB 2INNE 3HRDD 3NVZA 3MFGA 1TYGB 4FUVA 5GV0A 2EELA 3AEEB 1WGKA 4XE0A 4ZRPA 1TY2A 1EU4A 4HRSA 1BH3A 1E7PB 2MJEA 3ZJTA 1GB4A 2N2LA 2K5PA 4D65A 1N60A 2MJDA 5ADXK 1FCCC 2WXQA 3P42A 2HDEA 4UDUC 5FVNA 2G9HD 4KKJA 3EMNX 2FBWB 2ON8A 3ZYYX 3V3XA 3T3NA 3MJ5A 1L6UA 1DOYA 3GP6A 1PYWD 2K0PA 2YEPB 2R61A 3SZVA 4MH8A 2M06A 1JCKB 1HA5A 4RGNA 2KN4A 2PLPA 1KRHA 3PO0A 2QMTA 2J4UP 4XWWA 1I4PA 5G5GA 1PGXA 1QOBA 2Y2XA 3LK3A 2JZPA 3AEGB 4O4UA 1GFMA 2K3UA 3HVDA 4AKMA 2W82A 3LK41 2IGHA 4GCSA 3GB1A 3LK3B 1VZ6A 2RPVA 3LYYA 3VRAB 1LO5D 1FNWA 1HZ6A 2PORA 2J52A 1HXTA 2WXMA 4HEA1 4D2KA 1QJPA 1JW9D 2WXFA 5HHDG 1I4GA 5D5DA 1MVKA 2BB5A 1PRNA 2WXIA 3T0SA 4RF1A 3R8BA 2GB1A 1TZOA 4FZMA 2WXRA 4FESA 1MPEA 3LXFA 1WYGA 3B2GA 1MPFA 3AA7B 2DWQA 2KMMA 1AWDA 3T20A 1FFVA 3N9YC 1QJ8A 5TSSA 1MHXA 1TKGA 1VRAB 2K4TA 4KGSA 3U2SC 2HTME 4FZLA 1ENFA 3CIRB 1XO3A 4NAWB 2SEBD 1T5XD 2WDQB 5MPOA 1SEBD 3IAM1 2YPVA 1D6EC 4RGMA 4C69X 3FYXA 4AS1A 1ORMA 2KDYA 3P4RB 3HUIA 2YNKA 1YNTE 2WDRB 1WWTA 2BS2B 3FILB 3WI4A 3URYA 2W54A 3AEAB 4N58A 4JWSC 2V3PA 1EWYC 2QJLA 4YTNB 2BS3B 2F1VA 3SY9A 1KTKA 1SIJA 2DYOA 1M4VA 2M19A 2ERVA 4LSHA 1NVID 3AE1B 1YS5A 2WXKA 1JALA 5I4DA 2K22A 3OWEB 2JMMA 3KVDD 1ACCA 1RFKA 3E56A 3UU2A 4MM3B 3BVZA 1ZE3D 1K53A 2Y0LA 4AZLA 4AFKA 3W9CB 3T3OA 2WP9B 1QOAA 3BZDB 5FR3A 3VQIA 4R3DA 4AYEC 3NUHB 2LHEA 2PIAA 1CJEA 4WH4A 4KX6B 3RFZB 2J4XA 2KZ7A 2WS3B 3AE4B 3AECB 2H89B 2Y5PA 5D3IB 4HKQA 3VZUX 4DQOC 1NI3A 4D64A 4M0WA 1P7EA 4P16A 4RH6A 3P4PB 3J9CA 3IAS1 2OMFA 4GCPA 5DL7A 3UAQA 1ESFA 1F2RI 1L4DB 1N5WA 1PFDA 1JMLA 2IJ0A 2LFIA 1SE3A 4B0EA 4GLSC 3VR8B 3A2SX 4AYMC 1A70A 3NVWA 1E0ZA 2M0AA 1ZDXA 3DA4A 1AW7A 1TJEA 2WXLA 1ZUD2 3AE7B 3V05A 1N5XA 2MJ3A 2QILA 2XN9C 1E9MA 1UGJA 3FC4A 5T8IA 2MHLA 3AE5B 1C79A 4OVZA 1D4BA 1GOZA 2IGDA 2J1NA 1XCQL 2F1TA 5ADXL 4OZAA 3IT4B 5D3DA 1JWSD 4RFBA 1K52A 1J7AA 2ICIA 4PT5A 1XLNA 4GDKB 3HW9A 3BYYB 5C3JB 2ZFGA 3WCQA 1MM5A 2JX5A 2PVGC 3ABVB 2BYTA 3TEWA 1ZHWA 1YN5A 3U52E 4TSSA 1ET9A 5DL5A 3AB5A 1Q9FA 1ZHYA 1FRRA 2V4IB 3KQ4A 3QRCA 5EE0A 4ARCA 4WWMA 4XNKA 1D5XC 1L0YB 3NVVA 2W3SA 1T6BX 3HVZA 4YSXB 1UUPA 3POXA 2WNMA 2FGRA 2YEPF 1TKYA 3AMZA 1L0XB 1TS4A 3NVYA 1QT9A 4ITKA 3NS1A 2LEKA 3VY8X 1UWMA 2I2YA 2E6XA 1V1PB 2IGGA 2LJIA 2EKIA 3AE2B 2X27X 1SE4A 1ROEA 1PUTA 4FMSA 3B9JA 4KGTA 3AAEB 1I4XA 2PMVA 3P63A 5H8YE 4TMAB 1FO4A 2PKOA 4ZHOA 1RM6C 4C56C 1FFUA 1L4ZB 1ZHTA 1HXUA 1B1ZA 2DBYA 4GCQA 2O4VA 2SAKA 4RNAA 2N0SB 3AA1A 3H8HA 2W80C 4O4XA 4O3YA 2KDMA 1QQRA 2PW9A 1E6EB 2ONQA 4RCOA 1DYQA 1DGJA 1NEKB 3AH7A 4NJCA 1XLQA 5T5FA 4XDCA 4GF4A 1YQ4B 4Q2JA 1HQRD 1UNSA 2XE5A 4B61A 4LTUA 2MNHA 1G90A 3C5OA 1I4HA 2J42A 1V1PA 3BK1A 5PRNA 3P4SB 1D5MC 3CWIA 1TKEA 4US9A 1ZPSA 2NTSA 2BBCA 3DWGC 4USAA 2FUG1 2J53A 3ETRA 4ZYSA 4GHBA 2WXNA 2MH7A 1SJHD 3RBHA 2XE2A 2JU6X 2N9LA 4DXGA 2KC0A 3VY9X 5BYRA 1F0ZA 1R7SA 2XG6A 1FM0D 1KLUD 1RWSA 1OPFA 4FZNA 2GRIA 3R2IA 3AA7A 4XWTA 1XEEA 1ZP0B 1F77A 2NTTA 2OHFA 4HROA 6PRNA 4YT0B 1NYQA 2KXPB 1C77A 2QIEB 3BVGA 4IOIE 4AKRA 4OW0A 3AV8A 2H88B 1N63A 1WSPA 1XF5L 4MACA 4AQ7A 5BMHA 4AKRB 3PQSA 2Y3AA 1PHOA 4YWGG 5H92C 1IBXB 3RPFC 1ZHXA 4RJWA 2ZLDA 3L4PA 2KXPA 2W81C 1IZNA 2JYTA 4OHJA 5AUKA 1DOXA 5C2TB 2RMMA 4Z3TA 2IDYA 5E6JA 2LUMA 4ARIA 5G5HA 3P1MA 3POUA 1N61A 1YQ3B 1HEZE 1VR9A 1QJ9A 2KAJA 3DA3A 1ZDVA 5EE3A 5AFUL 1EWCA 2BTEA 3VE1A 2Q5WD 1QF6A 1VLBA 4LSIA 1KF6B 3KLSX 3NZ3A 1PGBA 3Q8EA 2XNAC 1TY0A 1BUIC 1QKZA 3AE6B 3TEYA 3Q8AA 4A90A 1GPXA 1YN3A 1VJKA 4O3WA 3I57A 1J7BA 1V97A 2NMQA 4YTPB 4H2AA 5EE2A 2WDVB 1GFPA 4U9CA 4QQ1A 4RLBA 4DXFA 5BMGA 1L5PA 3BIID 4KKIA 2B76B 5GXGB 1SB3C 3IT6B 3W1SA 4JPSA 3Q8BA 4JWUC 4JX1C 1ZOYB 1J7CA 2TSSA 4FRTA 4L1BA 4C7ZA 1YN4A 3LB8C 3NRZA 1BXTA 4FRXA 1C4AA 3SZDA 2ACZB 2Y0KA 3C8YA 4AYDC 1HXXA 4FSPA 4AYID 3O13A 1QILA 4L23A 5HG2A 2WQYB 1OQRA 3VE2A 2Y5CA 3UPGA 3HOLA 1YMHE 4YSZB 3ZGZA 3PORA 3AM9A 2LFUA 3BK2A 5LNK1 1V8CA 2WXPA 3BVMA 1BXWA 3O0EA 1ET6A 4NAMA 1CK1A 4IKGA 1SXTA 1K50A 1GAQB 2QEJC 3AEDB 1IGCA 1BT9A 1E54A 1XLPA 4OZCA 1FXIA 5JDPA 4G76A 2V3NA 4LLGM 2AQ1B 2WXGA 3W5UB 1FNUA 1GFNA 1QLBB 2Y7SA 1GFQA 2XE1A 3POQA 1SBBB 3GP7A 3SFEB 4FSOA 2AQ2B 3Q8CA 1SJED 2BB6A 4MT5A 3MP9A 2M07A 2GE4A 1WXQA 3E9SA 4HKZE 3K19A 3LK2A 3TZGA 2CJOA 1C9FA 1Q9GA 1T3QA 2OEDA 2WLBA 1I4RA 3EGRA 4AYNA 1JWMD 2FGQX 3PZ7A 4RF0A 4LK0M 4WAFA 2WU2B 1XCTL 4E1TA 3DWMA 3FAHA 1L6VA 2CU3A 3AN1A 3AE3B 2KWDA 3AEFB 1FXAA 5AUIA 1SSNA 4REZA 4O3ZA 4RGTA 2WXJA 3P4QB 3VZWX 2Y0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7S A;  1FM0 D;  3W9C B;  1FIQ A;  4C7Y A;  1NVI D;  1RWS A;  3AE1 B;  2XTR A;  4JWS C;  4G75 A;  4FZN A;  1JAL A;  2K22 A;  2M56 B;  1L0V B;  1RFK A;  2G1E A;  1WRI A;  1YJI A;  1ZP0 B;  2OHF A;  1IUE A;  4HRO A;  1OFF A;  4FXC A;  4YT0 B;  1NYQ A;  3VRB B;  2QIE B;  1QOA A;  1NEN B;  2WP9 B;  3W5V B;  1FMA D;  2BT6 A;  2K9X A;  3AV8 A;  3EUB 2;  3FAH A;  2H88 B;  4P6V F;  4YSY B;  4C80 A;  2PVO D;  1N63 A;  2PIA A;  1CJE A;  1AYF A;  4ZOH C;  4KX6 B;  2L83 A;  4WQM A;  2WS3 B;  3SFD B;  3AE4 B;  2AX5 A;  3AEC B;  2H89 B;  3HRD D;  3NVZ A;  1TYG B;  5H92 C;  3AEE B;  3RPF C;  3L4P A;  1NI3 A;  1QOG A;  1WGK A;  2WU5 B;  3P4P B;  5AUK A;  4HRS A;  4US8 A;  1E7P B;  1DOX A;  2MJE A;  5C2T B;  2K5P A;  1N5W A;  1PFD A;  1N60 A;  5G5H A;  2MJD A;  2E3T A;  3P1M A;  3NVW A;  4N6E B;  1A70 A;  3VR8 B;  1N61 A;  1YQ3 B;  2W3R A;  3DA4 A;  2FBW B;  2KAJ A;  3DA3 A;  1JWA D;  1TJE A;  1ZUD 2;  3AE7 B;  5EE3 A;  3ZYY X;  1N5X A;  2Q5W D;  2MJ3 A;  1QF6 A;  1L6U A;  1KF6 B;  1VLB A;  1DOY A;  1E9M A;  1NYR A;  3FC4 A;  3AE5 B;  3AE6 B;  1E10 A;  1GPX A;  1VJK A;  1OQQ A;  1J7B A;  1KRH A;  1V97 A;  3PO0 A;  5EE1 A;  5EE9 A;  4YTP B;  1J7A A;  1VDV A;  1PDX A;  2WDV B;  1XLN A;  1FRD A;  5C3J B;  5G5G A;  3WCQ A;  1QOB A;  2JX5 A;  2L52 A;  2PVG C;  3ABV B;  1L5P A;  3AEG B;  3BII D;  2B76 B;  5GXG B;  1SB3 C;  1ZXI A;  3AB5 A;  1FRR A;  4JWU C;  1XLO A;  4JX1 C;  1ZOY B;  5EE0 A;  1J7C A;  4WWM A;  3NVV A;  4C7Z A;  3LB8 C;  2W3S A;  3HVZ A;  3NRZ A;  3VRA B;  4YSX B;  1JRP A;  3SR6 A;  3B2F A;  1TKY A;  2ACZ B;  3AMZ A;  3NVY A;  1QT9 A;  4ITK A;  1JW9 D;  2LEK A;  3NS1 A;  4USA A;  1UWM A;  1CZP A;  2WQY B;  2CJN A;  1JQ4 A;  1OQR A;  2Y5C A;  2EKI A;  3AE9 B;  3AE2 B;  1ROE A;  4YSZ B;  1PUT A;  2BS4 B;  3AM9 A;  3ETR A;  3B9J A;  2XMX A;  1E0Z A;  1V8C A;  4FZM A;  1FO4 A;  4IDI A;  3P63 A;  5H8Y E;  1KFY B;  1RYJ A;  3LXF A;  1WYG A;  1I7H A;  1GAQ B;  2PKO A;  2DWQ A;  2KMM A;  3B2G A;  1RM6 C;  3AED B;  1FFU A;  2DBY A;  4ZHO A;  1FFV A;  1AWD A;  2N0S B;  1XLP A;  1N62 A;  1TKG A;  1FXI A;  3AEB B;  3VR9 B;  4G76 A;  2XTQ A;  1SF0 A;  1E6E B;  3W5U B;  1QOF A;  1DOI A;  1JWB D;  1QLB B;  1NEK B;  4FZL A;  1DGJ A;  2HTM E;  3AH7 A;  1XLQ A;  3SFE B;  1B9R A;  1F0Z A;  1YQ4 B;  3CIR B;  1XO3 A;  4YXD B;  2WDQ B;  1WXQ A;  5MPO A;  4LTU A;  2CJO A;  4A9A A;  1T3Q A;  2WLB A;  4N59 A;  3P4S B;  4ZHP A;  3P4R B;  1JRO A;  3CWI A;  1TKE A;  2JQR B;  3HUI A;  4US9 A;  2WDR B;  2W55 A;  1WWT A;  1YJJ A;  2BS2 B;  2WU2 B;  3DWG C;  2W54 A;  3AEA B;  4N58 A;  3DWM A;  1L6V A;  1EWY C;  2CU3 A;  2MH7 A;  2QJL A;  3AE3 B;  3AN1 A;  3AEF B;  2BS3 B;  4YTN B;  3KWL A;  1FXA A;  5AUI A;  3AE8 B;  4YTM B;  1SIJ A;  3P4Q B;  2M19 A; 
#chains in the Genus database with same CATH topology
 2JPH A;  1THQ A;  2KMC A;  1HTO A;  3OJ4 B;  2VH1 A;  1STE A;  1P4T A;  3V8U A;  3ZIM A;  4XDD A;  4FT6 A;  4P6V F;  4YSY B;  4A55 A;  3RNB C;  1ZHZ A;  2DZM A;  4GN1 A;  2LAS A;  2NBW B;  2OOB B;  2L3Z A;  1MG4 A;  3TEX A;  4ACF A;  3PRN A;  2WDT B;  2JSV X;  5JH5 C;  3OAW A;  1JWA D;  2GBJ A;  3L54 A;  1WM3 A;  2KAC A;  4E3C A;  2D07 B;  3Q8F A;  3DWO X;  3TEZ A;  2Z0D B;  4A8X C;  4DDG D;  3L08 A;  4P1B C;  2K0L A;  5EE9 A;  2RD0 A;  1RLF A;  3KUC B;  2I38 A;  3I9V 1;  2AL6 A;  1XXG A;  2YVC A;  5EDS A;  4HDO A;  4N74 A;  3EA6 A;  2IPK D;  3NG0 A;  3L0W B;  4NJ6 A;  4OZB A;  2KYW A;  3A9K A;  2DEN B;  3BS0 A;  3PQU A;  1WGY A;  4O49 A;  3B2F A;  3NJT A;  3BYT B;  2LGD A;  3Q14 C;  1GC6 A;  1CQV A;  3HOE A;  1JQ4 A;  2R2Q A;  3T24 A;  5BO4 B;  1YJ1 A;  2XMX A;  2PTL A;  1PGA A;  3LK2 B;  1T0Y A;  4W9D A;  2NBV B;  1I7H A;  2NR2 A;  1N62 A;  2D3A A;  2KX0 A;  5BYS A;  5G39 A;  2JUO A;  2LHD A;  4N59 A;  3RZF A;  2KVR A;  2W55 A;  2MHJ A;  1YJJ A;  1D3Z A;  3WAM A;  1D5Z C;  3HHM A;  2LGY A;  3U30 A;  2LGI A;  4EUT A;  1AN8 A;  2X8X X;  4TQ0 A;  2L0T A;  2QSD A;  4C00 A;  4JE3 B;  2LZ6 A;  1R4M B;  1FCL A;  3KWV A;  1H4R A;  3U7Z A;  2GI9 A;  1P9D U;  2WWZ A;  4GIV A;  4NNJ B;  2AEH A;  2KJR A;  4CQN A;  4BAX A;  5DL6 A;  2PVO D;  3AAE A;  4IW0 A;  2DYM A;  5AFU K;  4A3O A;  1GUA B;  3RN9 C;  2XBB C;  1OSM A;  1XQQ A;  2LRW A;  3ML8 A;  5IP4 D;  3MFG A;  4ZRK A;  2EEL A;  2J0M A;  3ZNG C;  1TIF A;  1BH3 A;  5GTI O;  2MJE A;  2K5P A;  4IM2 A;  2WX0 A;  3QIJ A;  1N60 A;  2MJD A;  3I63 C;  2KWC A;  5IOI A;  2Z0E B;  3VXW A;  1SE9 A;  2ON8 A;  4MEL A;  3ZYY X;  3T3N A;  1L6U A;  4X57 B;  5LXH A;  4FLH A;  1VCB A;  1HA5 A;  4IUM B;  2CR5 A;  2KDB A;  2MBE A;  2NPT A;  2J4U P;  2Y2X A;  3AEG B;  2LRU A;  2W82 A;  2BKR B;  4PS8 A;  4II3 B;  2N7D A;  2JXX A;  3LK3 B;  2K8B A;  3LYY A;  1LO5 D;  3GZN B;  2POR A;  2LGX A;  4D2K A;  1QJP A;  2KD0 A;  2R4P A;  1JW9 D;  3HM3 A;  4FUL A;  5D5D A;  2BB5 A;  4MGY E;  2WXI A;  4RF1 A;  4HVB A;  4FZM A;  4DWF A;  4FES A;  3AU5 A;  3RNF C;  4CHK A;  1WYG A;  2PE6 B;  1MPF A;  3AA7 B;  2DWQ A;  3DBR I;  5TSS A;  4W9L A;  1Q5W B;  2BQQ A;  5DPS A;  3N30 A;  3L17 A;  4YL8 A;  2ZVN A;  1OEY A;  3SHQ A;  5CX3 A;  1D6E C;  1L2N A;  1WJN A;  1YNT E;  3URY A;  2BS2 B;  4HPM B;  4B0M A;  3AEA B;  1MG8 A;  1E8W A;  1RRB A;  3TIX A;  3W1Y A;  4KVG B;  2D3C A;  4F1S A;  2M19 A;  2ERV A;  2JMM A;  2KJH B;  2B3A A;  1ZE3 D;  1K53 A;  3W9C B;  1QOA A;  2YLM A;  5FR3 A;  4AYE C;  2PIA A;  3Q6B A;  3ZLZ A;  3L16 A;  3PSE B;  2D10 A;  2H89 B;  2KDF B;  2FAZ A;  1LXD A;  2GLS A;  4TKN A;  1P7E A;  4RH6 A;  3Q3F A;  4PK1 A;  3IAS 1;  2OMF A;  1L4D B;  1F2R I;  2WHI A;  1PFD A;  2ZPY A;  1SE3 A;  4AYM C;  3NVW A;  1A70 A;  3M62 B;  4ZYN A;  1AW7 A;  1ZUD 2;  2QIL A;  2XN9 C;  1I35 A;  5J18 A;  5GMV A;  1GOZ A;  2D3G A;  1XCQ L;  4HK2 A;  3EHV A;  3HM6 X;  3IT4 B;  3OJ3 A;  2KZR A;  4RFB A;  4MSM B;  1XD3 B;  2GOW A;  2ICI A;  4PT5 A;  4BBN C;  3HW9 A;  3BYY B;  1OTR B;  3ZNI D;  2BYT A;  1ZHW A;  3U52 E;  4TSS A;  2C7H A;  2C9W B;  4BOZ B;  1ET9 A;  4LNO A;  1Q9F A;  5EE0 A;  2V4I B;  4WWM A;  3NVV A;  3LDZ E;  2W3S A;  4YSX B;  3POX A;  3PHW B;  3V61 A;  4W9I A;  4ITK A;  2K39 A;  2KLG A;  3NS1 A;  1UWM A;  1V1P B;  5D2M B;  2V4L A;  1T0R C;  2LJI A;  3AE2 B;  1SE4 A;  4UB8 O;  1PUT A;  1V9J A;  3PS6 A;  3ZRF A;  2PMV A;  3P63 A;  1FO4 A;  1ZW7 A;  4ZHO A;  2DBY A;  2SAK A;  1ZHT A;  4K1R B;  2FCN A;  4GB9 A;  2KDM A;  2PW9 A;  2ONQ A;  1NEK B;  1UEL A;  2BYV E;  4Q2J A;  1UBI A;  2XE5 A;  3X0W A;  3QJZ A;  2MNH A;  3VUW A;  5KAF O;  4K81 A;  5PRN A;  4PYZ A;  4US9 A;  2L00 B;  3C0R B;  4G11 A;  1WRD B;  1T1L A;  1SJH D;  3RBH A;  2XE2 A;  3RNC C;  2LVQ A;  2N9L A;  1R7S A;  1KLU D;  2M8S A;  2V1Y A;  3AI5 A;  3RD2 A;  3AA7 A;  2NTT A;  5L83 A;  4HRO A;  1NYQ A;  4IOI E;  4AKR A;  4JLC A;  2N1W A;  1WSP A;  1XF5 L;  4MAC A;  4MGI E;  4BKG A;  3PQS A;  4AWJ A;  5H92 C;  3RPF C;  4RJW A;  1SGH A;  2ZNV C;  5AUK A;  5D94 A;  5C2T B;  2RMM A;  5E6J A;  1C1Y B;  3KYC D;  5LLI A;  3V6E B;  1VR9 A;  1QJ9 A;  2KAJ A;  5EE3 A;  2LVO A;  3VE1 A;  3NZ3 A;  4K7S A;  3QAQ A;  3Q8E A;  1R4M I;  3TEY A;  3QC8 B;  1WGD A;  1V97 A;  4A20 A;  2MBO A;  1V5O A;  1V5T A;  1UF0 A;  3WU2 O;  1GFP A;  4GGQ A;  2FCQ A;  3DQV A;  4KKI A;  5CTR C;  5GXG B;  4WJN A;  3Q8B A;  3V60 A;  4JWU C;  4C7Z A;  1YN4 A;  3LB8 C;  3NRZ A;  1WMH B;  4NQL B;  3PTF C;  3DVN V;  3O13 A;  2BYF A;  1XT9 B;  4MEM A;  4FSP A;  4ASW C;  3HIZ A;  2KHW B;  1OQR A;  5CHF A;  3UPG A;  1YMH E;  3ZGZ A;  3POR A;  1E7U A;  2IO3 B;  1IGC A;  4BKT A;  1XLP A;  3RCZ A;  1WFY A;  1WE7 A;  1SIF A;  4FHK A;  1GFQ A;  2XE1 A;  2AQ2 B;  4KIK A;  4FBJ B;  3K19 A;  2CJO A;  4W9E A;  1C9F A;  2OED A;  4WWP A;  1I4R A;  1V80 A;  2FGQ X;  4WAF A;  4TV3 A;  5D6J B;  2KAN A;  4REZ A;  2WXJ A;  3P4Q B;  2RSU A;  2Y0H A;  1MHH E;  3ZJU A;  4CYE A;  1Q10 A;  3A0H O;  2N2M A;  1WH3 A;  1NDD A;  3VRB B;  2KZ7 B;  2K9X A;  4RM8 A;  1P1A A;  2REX A;  2L83 A;  2AQ3 B;  4PS7 A;  4XNL A;  4RLC A;  4LSF A;  4MM3 A;  2VH2 A;  3QWZ B;  2KFK A;  4PJ0 O;  2R4N A;  4S17 A;  3RMK C;  2QDF A;  4KGR A;  5CHV C;  4DHJ B;  3DVG X;  2VZK B;  3U8Z A;  2E3T A;  4N6E B;  5HKH A;  3Q3O C;  5FK9 C;  3R7Q A;  2ODJ A;  2LJ5 A;  2INP E;  1C78 A;  1TBE A;  3ENE A;  4O1N A;  5JXV A;  2DHZ A;  4JQW C;  5L95 C;  2RDH A;  2KN5 A;  3Q3N C;  4B6W A;  3RYT A;  5EE1 A;  3ZJV A;  3TUO A;  3BY4 B;  3I3T B;  1P98 A;  4A6Q A;  2EMT A;  1FEH A;  2L52 A;  4RJX A;  4OVV A;  2MSE D;  2Z8L A;  1MI0 A;  3LJ3 A;  3SD5 A;  2M4N A;  1HXY D;  3TSS A;  2PRN A;  1IZN B;  1HZ5 A;  3KUZ A;  5DL8 A;  1IBX A;  2D2Q A;  5C23 A;  2MBB B;  3OG5 A;  7PRN A;  3AE9 B;  3TJP A;  3PZ8 A;  1TS3 A;  1ZXH A;  2Y5B B;  1RYJ A;  4RL9 A;  2KQ7 A;  4L2Y A;  4I6P A;  2QHO A;  4WWO A;  3AEB B;  4GSW A;  1B9R A;  3PLU A;  4WIP A;  2M0X A;  4XGA B;  2ZEQ A;  5E79 O;  5BMI A;  2G4D B;  4ZHP A;  1P3Q U;  5IAA C;  1WR1 A;  4MJS A;  3AE8 B;  2KQS A;  4LJO B;  2N7E A;  4BBN F;  3NHE B;  3VAW A;  3K9P B;  2DAF A;  2VZK D;  1FPY A;  2KC1 A;  1EU3 A;  1H8C A;  1F1H A;  1YJI A;  1IUE A;  4FXC A;  2CHZ A;  3GS2 A;  2BT6 A;  2D3B A;  2JZZ A;  2LMC A;  2LXA A;  3SY7 A;  1C76 A;  1FD6 A;  3B0A A;  2D5G A;  2WXO A;  3AEE B;  1WGK A;  1R4N I;  3DBL I;  4HRS A;  1E7P B;  3V6C B;  1J8C A;  3BIN A;  4D65 A;  2KFK B;  2WXQ A;  3P42 A;  5FVN A;  2G9H D;  3EMN X;  3T8M A;  4IWO A;  1R4N B;  3DBL B;  1E5W A;  1VD2 A;  2OJR A;  2YEP B;  2R61 A;  4MH8 A;  2L76 A;  4WJP A;  4JIO U;  3PO0 A;  3BRZ A;  2KTR A;  4II2 B;  2JZP A;  2K3U A;  4AKM A;  2NBU A;  1WXS A;  4GCS A;  2O2V A;  2RPV A;  2A4Z A;  1FNW A;  1HZ6 A;  2BVC A;  2J52 A;  2WXM A;  4IWP A;  3VDZ A;  5HHD G;  1I4G A;  3DCG A;  2ZPN A;  2GB1 A;  2KKC A;  3A9K B;  3B2G A;  3N1X C;  3A4S C;  1FFV A;  1RAX A;  2KLC A;  1TKG A;  4KDL B;  3U2S C;  5TR5 A;  3CIR B;  3IBE A;  1M94 A;  1XO3 A;  2SEB D;  1SEB D;  2JT4 B;  3IAM 1;  4RGM A;  2KXJ A;  3A9J A;  1ORM A;  3P4R B;  4RMA A;  3HUI A;  3ZDT A;  2WDR B;  1WWT A;  3FIL B;  3WI4 A;  3Q2A C;  2QJL A;  4YTN B;  2F1V A;  5G55 A;  3KZI O;  3DWN A;  4LSH A;  4JL9 A;  1E8Z A;  2K25 A;  3UQA A;  2WXK A;  1JAL A;  1TZ1 A;  3UU2 A;  3BVZ A;  2R4O A;  4AZL A;  3BZD B;  4DXA B;  2LHE A;  3DBS A;  3KUD B;  4WH4 A;  4FJY A;  4KX6 B;  2FIF A;  1GNU A;  1WZ0 A;  2Z59 B;  2WS3 B;  3PLV A;  2L7R A;  5D3I B;  3VZU X;  2RR9 A;  4DQO C;  1NI2 A;  4P16 A;  3UAQ A;  1ESF A;  1N5W A;  1YQB A;  4WJO A;  1E0Z A;  4GLS C;  3A2S X;  2GMI C;  2M0A A;  3AE7 B;  2IND C;  3ONS A;  3V05 A;  2IYD B;  1N5X A;  2MJ3 A;  3FC4 A;  1UGJ A;  5T8I A;  1D4B A;  2R88 A;  2F1T A;  4NJ7 A;  4ICV A;  1J7A A;  4KIK B;  1XLN A;  5G38 A;  4GDK B;  5C3J B;  2MP2 B;  1MM5 A;  2JX5 A;  2PVG C;  4FHJ A;  2KFJ A;  1YN5 A;  4ARC A;  2INC C;  3HVZ A;  2WNM A;  4N9F 4;  4FAD A;  2FGR A;  1TKY A;  3AMZ A;  2N9E B;  1I42 A;  1WZ3 A;  1K8R B;  4ZDV A;  2M17 A;  2X9K A;  2X27 X;  4FMS A;  2JRH A;  1E7V A;  5H8Y E;  4W9H A;  2MCN B;  2ZNV B;  1WE6 A;  1RM6 C;  1L4Z B;  2O4V A;  3GE8 C;  1F52 A;  2IY0 B;  1DGJ A;  4M8M A;  4GF4 A;  1YQ4 B;  1KJT A;  3PV1 A;  1TT5 B;  1HQR D;  1BT0 A;  3PF1 A;  2A5U A;  3C5O A;  4LDT D;  1V1P A;  1YD8 U;  2KWU B;  4LNI A;  3DWG C;  2FUG 1;  2J53 A;  4GHB A;  2JF5 A;  4W9F A;  4DXG A;  5KAI O;  4PYU A;  1J19 A;  1UGM A;  4PS3 A;  4FZN A;  2GRI A;  4BFR A;  1ZP0 B;  3RUI B;  6PRN A;  4YT0 B;  2KXP B;  2LD9 A;  2QIE B;  2KT7 A;  3PVL A;  2H88 B;  5GTH O;  3JSV B;  1WX8 A;  3KVF B;  3UIO B;  4XC2 A;  2R89 A;  4AKR B;  3ML9 A;  1WI0 A;  3QK0 A;  2G3Q B;  3FKY A;  3T9L A;  2O2V B;  2ZLD A;  3KH0 A;  1IZN A;  5H2F O;  2IWV A;  2LVP A;  3PGU A;  2PE9 A;  4WAA A;  2PPH A;  2BWF A;  4Z3T A;  4DDI D;  2F1C X;  3WAP A;  4IM0 A;  3A0B O;  1N61 A;  1YQ3 B;  2CKH B;  3DA3 A;  2BTE A;  1EWC A;  1KF6 B;  1PGB A;  4ICU A;  2XNA C;  3AE6 B;  3Q8A A;  4OVU A;  2RGF A;  3ZO5 B;  3VTU A;  2WVP A;  2KX3 A;  3JVZ X;  1VJK A;  1WX9 A;  3MC8 A;  1J7B A;  3PRP B;  2I1J A;  4YTP B;  5B66 O;  5EE2 A;  4U9C A;  2K8H A;  1CMX B;  2B76 B;  4XYC A;  4L1B A;  3NOB A;  1BXT A;  4FRX A;  4AJY B;  1IYF A;  3SZD A;  2ACZ B;  3C8Y A;  4HDQ A;  4L23 A;  3VVW B;  3VE2 A;  4PR7 A;  2LFU A;  3BVM A;  4IKG A;  4WWN A;  2JZ3 B;  2HJ8 A;  2QEJ C;  1E54 A;  5JDP A;  2AQ1 B;  2WXG A;  3W5U B;  1FNU A;  2V3S A;  3POQ A;  1SBB B;  3GP7 A;  4KZC A;  4FSO A;  3SFE B;  1SJE D;  4GDK A;  4HCN B;  4EOY A;  1WXV A;  3TZG A;  1T3Q A;  1OGW A;  5TIS O;  2DZI A;  4LK0 M;  2WU2 B;  1XCT L;  4E1T A;  3DWM A;  1V6E A;  1L6V A;  2KWD A;  5AUI A;  3VZW X;  3H7S A;  3ZUN A;  3SU8 X;  1SE2 A;  1X1M A;  2L1A A;  4C7Y A;  3IXS A;  3BWU D;  4RM9 A;  1IGD A;  4IG7 B;  3R2T A;  3Q3J A;  3JW0 X;  1WGG A;  1NEN B;  3SEB A;  1V81 A;  3MJW A;  1KLV A;  2EMS A;  1N6Z A;  3JCU O;  2MEK A;  3UI3 A;  2N1V A;  3SFD B;  1JWU D;  1VZ8 A;  3VFK A;  4US8 A;  4NPN A;  2V0G A;  3SYS A;  1VZ7 A;  3AA1 B;  1UWX A;  2RDG A;  2KVZ A;  3ZQ4 A;  4RGO S;  4GDL A;  4G0N B;  3N32 A;  1NYR A;  4M01 A;  4J6I A;  4JCH A;  3NZS A;  3P2B A;  4GDL B;  1GB1 A;  1KM7 A;  3VUY A;  4WUR A;  1VDV A;  1PDX A;  1FRD A;  3MHZ A;  4KR8 A;  1KLG D;  1IPG A;  3G7G A;  5E6O A;  5IN7 A;  1EM7 A;  4M02 A;  3W2D A;  5HFY A;  4CTD A;  1UBQ A;  4E71 A;  5JHA A;  3MTN B;  3SR6 A;  2MRP A;  5JHB A;  2LUE A;  1YX5 B;  2BS4 B;  2IY1 B;  2AYO B;  2BW2 A;  3AAA A;  3KYD D;  2N9K A;  4FN2 A;  4AUI A;  3RUL A;  2KNB A;  2XTQ A;  3AAA B;  2ZW0 A;  1QOF A;  2JYE A;  1DOI A;  4MDK E;  4EE2 A;  1I4Q A;  2JXT A;  5FKA C;  1T16 A;  4FJV B;  1Q1O A;  3U4E G;  3ZXV A;  1JRO A;  4TQ1 A;  2JWU A;  8PRN A;  3UGB B;  1WX7 A;  5LXI B;  5G26 A;  3HWB A;  2L05 A;  5E6P A;  4F8C B;  3NZU A;  4C4V A;  2WXH A;  1WRI A;  3AA0 B;  2WJR A;  1OFF A;  4LCD E;  4NQK E;  4HJG E;  3AA6 A;  1FMA D;  2K6Q A;  1H6S 1;  3N1Z C;  1KH0 A;  1MM4 A;  3JTY A;  4ZRQ A;  3ZDM C;  2INN E;  3H7P B;  3HRD D;  3NVZ A;  1TYG B;  5KHQ A;  4FUV A;  4HXD A;  1UH6 A;  4ZRP A;  1TY2 A;  3ZTC A;  2MA9 B;  3ZJT A;  1GB4 A;  2N2L A;  3ZTD A;  5ADX K;  1FCC C;  2HDE A;  4UDU C;  4LNK A;  2FBW B;  3R7R A;  4DBG A;  1OEY J;  3V3X A;  5AZH A;  3SZV A;  4RGN A;  3RNE C;  2KN4 A;  1KRH A;  5G3A A;  2J7Q B;  3CMM B;  2N9P C;  4O4U A;  1GFM A;  2FCS A;  3LK4 1;  2IGH A;  3EFC A;  4WJQ A;  3GB1 A;  5AZF A;  1A5R A;  1VZ6 A;  1WJU A;  2WYQ A;  1MVK A;  4N75 A;  1PRN A;  2MLB A;  3T0S A;  3R8B A;  1TZO A;  2FNJ B;  2WXR A;  3DDC B;  1MPE A;  3V62 A;  5IKC M;  3N9Y C;  3Q3M C;  1WF9 A;  2AXT O;  2FCM A;  4FJZ A;  2K4T A;  4KGS A;  3R66 C;  3L10 B;  2IBI B;  2MWS B;  2WDQ B;  3AU4 A;  2BF8 B;  4C69 X;  4AS1 A;  2JRI B;  3H9D A;  3VTW A;  2YNK A;  4B9K A;  2XEW A;  3A1Q A;  4JWS C;  3DPD A;  4IL6 O;  1M4V A;  3NS8 A;  4AOF A;  1NVI D;  1YIW A;  1YS5 A;  3AE1 B;  3UF8 A;  3KVD D;  4JGH B;  3A33 B;  3AUL A;  2MP2 A;  2Y0L A;  5AZG A;  4AFK A;  4K7W A;  4MJS B;  4ANW A;  4K7U A;  1CJE A;  2J4X A;  3AE4 B;  3AEC B;  4FA6 A;  2Y5P A;  4XX5 A;  3DHH C;  2ZJD A;  4D64 A;  2DX5 B;  5DCN A;  5DL7 A;  2LFI A;  2IJ0 A;  1JML A;  2C60 A;  4EEW A;  3WIM A;  2QCZ A;  3WA0 A;  1UZX B;  4B0E A;  1HTQ A;  1ZDX A;  1P0R A;  1E9M A;  2ZVO A;  2MHL A;  2HE7 A;  5JZE B;  1C79 A;  3DHG C;  3IHP C;  2IGD A;  3DZM A;  4EZJ A;  5ADX L;  2UYZ B;  1JWS D;  1K52 A;  1MJD A;  3APF A;  5G2N A;  3WCQ A;  3ABV B;  4QAY A;  3TEW A;  2V9H A;  3AB5 A;  1FRR A;  3HK0 A;  2N9X A;  4XNK A;  2MQJ A;  1T6B X;  1UUP A;  2YEP F;  4W9C A;  1L0X B;  1QT9 A;  1LFD A;  1RFA A;  2LEK A;  2LXC A;  3ALB A;  4HWI B;  4KGT A;  3AAE B;  1I4X A;  2DYB A;  2NVU I;  3H8H A;  4IC7 B;  2W80 C;  2JWZ A;  4O4X A;  4O3Y A;  1QQR A;  4GXB A;  4KDI C;  4RCO A;  1DYQ A;  1S1Q B;  1UNS A;  2NCN A;  3PGS A;  3M63 B;  4B61 A;  4LTU A;  2I1K A;  1I4H A;  2MW5 A;  1D5M C;  3CWI A;  1TKE A;  1ZPS A;  4NAW A;  2WXN A;  2MH7 A;  3RNG C;  3TCA A;  4EZL A;  2JU6 X;  2LGS A;  2KC0 A;  1F0Z A;  3APD A;  3QX1 A;  2XG6 A;  3UQB A;  4W9J A;  3DVG Y;  4MH0 E;  3D32 A;  3ZKJ C;  3R2I A;  1Z2M A;  4XWT A;  2DAJ A;  2OHF A;  2IO1 B;  1C77 A;  3BVG A;  4OW0 A;  2CHW A;  3PRM B;  3ECI A;  4G50 A;  5BMH A;  2Y3A A;  1PHO A;  2FID A;  1IBX B;  1ZHX A;  1T0Q C;  4HPP A;  2LUM A;  4W9K A;  1ZGU B;  5AFU L;  1VLB A;  1TTN A;  3KLS X;  1TY0 A;  4DHZ B;  1QKZ A;  4A90 A;  1YN3 A;  1LGR A;  4O3W A;  5DPT A;  5E6N A;  4BOS C;  3I57 A;  2R8A A;  4H2A A;  2WDV B;  2JY6 A;  4LNN A;  4W9G A;  4RLB A;  3ZNZ B;  1G6J A;  5BMG A;  1L5P A;  3BII D;  2UU7 A;  3IT6 B;  2O6V A;  2UWQ A;  1ZOY B;  1J7C A;  1C4A A;  2BYE A;  3GZN I;  1FXT B;  2Y0K A;  4AYD C;  1HXX A;  3CST A;  2Y5C A;  2WJQ A;  2FUH B;  2WXP A;  3CF6 E;  1E8Y A;  3PGE A;  1BXW A;  1LQB A;  3B08 A;  3O0E A;  1ET6 A;  3U7D A;  2R4L A;  1K50 A;  2G45 B;  1FXI A;  4G76 A;  2V3N A;  4LLG M;  2PJH A;  1QLB B;  2Y7S A;  1ISN A;  4EZK A;  3EEC A;  3Q8C A;  1NBF C;  2BB6 A;  2M07 A;  3E9S A;  1S5L O;  1WXQ A;  3H6N A;  3LK2 A;  4K3C A;  2WLB A;  4LNF A;  3EGR A;  4XZ4 A;  4RF0 A;  4UB6 O;  3FAH A;  3R3M A;  3AN1 A;  1GG3 A;  3AE3 B;  3AEF B;  1SSN A;  5KHO A;  3L13 A;  4JFB A;  4P1C C;  4G75 A;  2KTR B;  4ZRI A;  4BUM X;  4J3O D;  2M56 B;  2R2O A;  1L0V B;  4E1S A;  1KOT A;  3S2A A;  1Y56 A;  2D11 A;  1TS5 A;  4M0W B;  1E10 A;  3EUB 2;  2M1M A;  1TS2 A;  3LK4 2;  2FE8 A;  2ZW1 A;  3VHT C;  1AYF A;  4LSE A;  1C4P A;  2AX5 A;  1BML C;  2ZZP B;  1QOG A;  4KRA A;  3PGR A;  2DNF A;  2WU5 B;  3QAR A;  4BZA A;  4D5U A;  2IO2 B;  4PUX A;  2LHF A;  1P7F A;  3O65 B;  5DPW A;  2G4S A;  2DZK A;  2ASQ A;  2W3R A;  3PPA A;  3FIL A;  4O3X B;  4P7I A;  2KTF A;  1FNV A;  1K51 A;  2MBH A;  4IM3 A;  1WIA A;  2KOX A;  3OLM D;  3SYB A;  1OQQ A;  3A9J B;  3NSG A;  2OJW A;  3AA0 A;  3TBL D;  3UIP B;  2PEA A;  2QTK A;  2N7J A;  1ZXI A;  1XLO A;  2C5L C;  1JRP A;  1E8X A;  4HCP B;  2CU1 A;  4KR4 A;  3MHS D;  3MC0 B;  1CZP A;  2CJN A;  5BYQ A;  2KQ4 X;  1C4C A;  2X38 A;  2RDB C;  4IDI A;  1KFY B;  4B95 A;  2N4F A;  2IZV B;  3VR9 B;  3QRA A;  1SF0 A;  5HI1 A;  5C1Z A;  5CHW A;  4M8N A;  1J0G A;  1JWB D;  1V1O A;  5FR6 A;  2KMA A;  4EFO A;  4YXD B;  2XE3 A;  1V86 A;  4A9A A;  2KK8 A;  2CS4 A;  1WXA A;  3Q69 A;  2JQR B;  2L0F A;  1Z5S B;  4FOZ A;  4IWQ A;  3IFW B;  3KWL A;  4KV2 A;  4YTM B;  2L32 A;  1WMH A;  4MGZ E;  3WI5 A;  4F4B A;  4LJP B;  2IWW A;  3VZT X;  1FIQ A;  2XTR A;  4MSQ B;  2ZCB A;  4HLE A;  5IYU A;  2G1E A;  2LWP A;  3RNA C;  4KSL C;  5D7G A;  3M95 A;  3W5V B;  4A3P A;  1F2R C;  4C80 A;  1GFO A;  4ZOH C;  4TUU A;  2DLB A;  3AA6 B;  4WQM A;  4NZL B;  1UD7 A;  3PHX B;  5GV0 A;  2K6D B;  4XE0 A;  4S0R A;  1EU4 A;  1WJ6 A;  3ZVV A;  1T0S C;  3PRZ A;  4DK5 A;  3H1U A;  2BGF A;  4KKJ A;  1LM8 B;  3MJ5 A;  3X23 A;  3KW5 B;  1HE8 A;  5AEK B;  2XK5 A;  1DOY A;  1L7Y A;  3GP6 A;  1PYW D;  2K0P A;  5B5E O;  2M06 A;  1JCK B;  2PLP A;  2QMT A;  2J0J A;  4HPL B;  4XWW A;  1I4P A;  5G5G A;  1PGX A;  1QOB A;  3LK3 A;  3HVD A;  4ANU A;  3VRA B;  2HJ1 A;  3WAL A;  1HXT A;  2NPT B;  4LDT B;  4HEA 1;  2WXF A;  2HD5 B;  5J17 A;  2JVC A;  2RPQ A;  4F7Z A;  3LXF A;  3N3K B;  2KMM A;  4CO7 A;  1AWD A;  3T20 A;  2KC2 A;  1QJ8 A;  1MHX A;  3DBR B;  1E90 A;  2NS5 A;  1VRA B;  3M3J A;  2HTM E;  4FZL A;  3CSF A;  1EO6 A;  3ZXR A;  3H7P A;  3EFU A;  1ENF A;  2WGS A;  4NAW B;  1T5X D;  5MPO A;  2YPV A;  3FYX A;  2KDY A;  2DZJ A;  4GU2 A;  2W54 A;  4N58 A;  2V3P A;  1EWY C;  3GE3 C;  2BS3 B;  3SY9 A;  1KTK A;  1SIJ A;  2DYO A;  1GJZ A;  3VH3 B;  3IG3 A;  3DBH B;  2O6V D;  2ZCC A;  5I4D A;  2K22 A;  3OWE B;  1ACC A;  1RFK A;  3E56 A;  4MM3 B;  4KZ0 A;  3APC A;  3QQ8 B;  3VTV A;  2CHX A;  3T3O A;  2WP9 B;  3VQI A;  4R3D A;  4AP4 C;  3NUH B;  2WX1 A;  4E74 A;  3RFZ B;  2KJ6 A;  3VH4 B;  2KZ7 A;  3ZW3 A;  4HKQ A;  1YX6 B;  4MGK E;  1NI3 A;  4M0W A;  3TMP B;  3P4P B;  3J9C A;  3WAN A;  4GCP A;  1EUV B;  2KDE B;  3W1S C;  3VR8 B;  3RT3 B;  4NY0 A;  3DA4 A;  3RZW C;  1TJE A;  2WXL A;  1WGH A;  4EKU A;  4AJW A;  3UIN B;  2KWV B;  5J2R A;  1GC7 A;  3AE5 B;  3VUX A;  1WY8 A;  4OVZ A;  2MX2 A;  2J1N A;  3QA8 A;  3QHT A;  4OZA A;  3AXC A;  2BPS A;  2KDI A;  5D3D A;  2AWT A;  3MC9 A;  2ZFG A;  2VRR B;  3GOE A;  2GBR A;  4KSK C;  5DL5 A;  1ZHY A;  3EC8 A;  3KQ4 A;  3QRC A;  3BRY A;  1D5X C;  1L0Y B;  3PT2 B;  2HTH A;  4URK A;  1TS4 A;  3NVY A;  4HJK A;  1C3T A;  3VY8 X;  2I2Y A;  2E6X A;  4DHJ D;  2IGG A;  2EKI A;  1ROE A;  4BKS A;  4GOC A;  3B9J A;  3ZNH B;  3B1L X;  4TMA B;  2PKO A;  4C56 C;  1FFU A;  1HXU A;  1B1Z A;  4GCQ A;  4RNA A;  2N0S B;  3AA1 A;  2O6V B;  4C4V B;  1E6E B;  1WR6 E;  3IVF A;  1PQS A;  3AH7 A;  5DPR A;  4ZRJ A;  4ANV A;  4NJC A;  1XLQ A;  5T5F A;  3PZD A;  4XDC A;  3K9O B;  4AUQ C;  4K3B A;  1G90 A;  3RI7 C;  3PRE A;  2J42 A;  1V2Y A;  3BK1 A;  3P4S B;  3QCA A;  2NTS A;  2AL3 A;  2BBC A;  4USA A;  4ZYS A;  3ETR A;  4DHZ E;  1Q0W B;  3VY9 X;  5BYR A;  1FM0 D;  1RWS A;  2C7M B;  1OPF A;  4G3X B;  2KO3 A;  1WGR A;  1XEE A;  1F77 A;  2MBQ A;  5IO9 A;  1Y8R C;  2BKF A;  3AV8 A;  1V49 A;  1YOV B;  3JSV A;  1N63 A;  4AQ7 A;  3DBH I;  2GBN A;  2K8C A;  3DVN U;  4YWG G;  2XK5 B;  2K1F A;  2J0K A;  4OHJ A;  3L4P A;  2JQY A;  4ANX A;  2KXP A;  2W81 C;  2JYT A;  1DOX A;  2IO0 B;  2EKE C;  2IDY A;  4ARI A;  5G5H A;  3P1M A;  3POU A;  1HEZ E;  1MFW A;  4I6L B;  1ZDV A;  4M00 A;  3WAO A;  2Q5W D;  1QF6 A;  4I6N B;  4LSI A;  1JRU A;  1BUI C;  1WM2 A;  1GPX A;  1WJ4 A;  1WYW B;  2GBM A;  2GBK A;  3A4R A;  2NMQ A;  3ZRC A;  4QQ1 A;  4DXF A;  4BVU C;  1SB3 C;  3DHI C;  3W1S A;  4JPS A;  1U4A A;  3NY5 A;  4JX1 C;  1QZE A;  2TSS A;  4FRT A;  1TGZ B;  3A1Q B;  5IA7 A;  2C7N B;  5HG2 A;  4AYI D;  1QIL A;  1IP9 A;  2WQY B;  1F9J A;  3I5J C;  3HOL A;  4YSZ B;  1S3S G;  3AM9 A;  4WQO B;  3BK2 A;  5LNK 1;  1V8C A;  3JYU A;  4NAM A;  1CK1 A;  1SXT A;  1GAQ B;  1OQY A;  1EF5 A;  3AED B;  1EF1 A;  1BT9 A;  4GMV A;  4OZC A;  4FQE A;  1GFN A;  1ZKH A;  1AAR A;  4MT5 A;  3MP9 A;  2GE4 A;  4HKZ E;  3TL5 A;  1Q9G A;  4AYN A;  3C19 A;  1JWM D;  2LI5 A;  3PZ7 A;  2QC8 A;  3SDL C;  1WXM A;  2W9N A;  2CU3 A;  3DOW A;  2BWE S;  3N20 C;  4BKS D;  1FXA A;  4O3Z A;  4RGT A;  2L8J A;  3N1Y C; 
#chains in the Genus database with same CATH homology
 1MHH E;  3ZJU A;  1SE2 A;  4JFB A;  2L1A A;  4C7Y A;  1THQ A;  4G75 A;  1Q10 A;  3IXS A;  4BUM X;  4J3O D;  3BWU D;  2M56 B;  1L0V B;  4E1S A;  1IGD A;  2N2M A;  1STE A;  1P4T A;  3V8U A;  1Y56 A;  3R2T A;  1TS5 A;  3VRB B;  4XDD A;  2KZ7 B;  1NEN B;  1E10 A;  4FT6 A;  2K9X A;  3EUB 2;  4P6V F;  3SEB A;  4YSY B;  4A55 A;  1TS2 A;  3LK4 2;  1ZHZ A;  2FE8 A;  2MEK A;  2ZW1 A;  3UI3 A;  1AYF A;  2L83 A;  4LSE A;  2AQ3 B;  1C4P A;  3SFD B;  2AX5 A;  1BML C;  4XNL A;  4RLC A;  4LSF A;  1JWU D;  1QOG A;  4KRA A;  2WU5 B;  1VZ8 A;  3TEX A;  4D5U A;  4US8 A;  4PUX A;  4KGR A;  2V0G A;  2LHF A;  3PRN A;  1P7F A;  2VZK B;  2E3T A;  3SYS A;  2JSV X;  1VZ7 A;  4N6E B;  3AA1 B;  1UWX A;  2W3R A;  5FK9 C;  2ODJ A;  2RDG A;  1JWA D;  3ZQ4 A;  2INP E;  3FIL A;  4RGO S;  2KAC A;  4O3X B;  1C78 A;  3Q8F A;  1FNV A;  1K51 A;  4O1N A;  1NYR A;  5JXV A;  3TEZ A;  4A8X C;  4JCH A;  2RDH A;  4GDL B;  3SYB A;  1OQQ A;  2K0L A;  3NSG A;  3AA0 A;  5EE9 A;  5EE1 A;  3ZJV A;  1GB1 A;  2I38 A;  3I9V 1;  3TUO A;  4WUR A;  1VDV A;  1PDX A;  1XXG A;  4A6Q A;  1FRD A;  3MHZ A;  4KR8 A;  1KLG D;  3G7G A;  1FEH A;  2L52 A;  3EA6 A;  4RJX A;  2IPK D;  1EM7 A;  3W2D A;  2QTK A;  5HFY A;  2N7J A;  4OZB A;  1ZXI A;  2Z8L A;  1MI0 A;  1XLO A;  1HXY D;  3PQU A;  2PRN A;  3TSS A;  1IZN B;  1JRP A;  4O49 A;  1HZ5 A;  3B2F A;  3SR6 A;  5DL8 A;  3BYT B;  1IBX A;  4KR4 A;  1CQV A;  3MC0 B;  1CZP A;  2CJN A;  3HOE A;  7PRN A;  1JQ4 A;  5BYQ A;  3AE9 B;  3T24 A;  2BS4 B;  3PZ8 A;  2KQ4 X;  2XMX A;  1TS3 A;  1ZXH A;  1C4C A;  2PTL A;  2X38 A;  1PGA A;  4B0M A;  3LK2 B;  4IDI A;  1KFY B;  1RYJ A;  1I7H A;  4RL9 A;  2BW2 A;  3AAA A;  4L2Y A;  2N9K A;  4AUI A;  1N62 A;  3AEB B;  3VR9 B;  2XTQ A;  3AAA B;  3QRA A;  1SF0 A;  5HI1 A;  2ZW0 A;  5BYS A;  1QOF A;  2JYE A;  1DOI A;  1JWB D;  1V1O A;  1B9R A;  4WIP A;  4EE2 A;  1I4Q A;  2JXT A;  4YXD B;  2XE3 A;  2LHD A;  5FKA C;  4A9A A;  5BMI A;  4N59 A;  3Q69 A;  3U4E G;  4ZHP A;  1JRO A;  4TQ1 A;  2JQR B;  2JWU A;  8PRN A;  2W55 A;  1YJJ A;  4FOZ A;  1D5Z C;  5G26 A;  3HWB A;  3KWL A;  3AE8 B;  2LGI A;  2L32 A;  4YTM B;  3WI5 A;  4F4B A;  1AN8 A;  3VZT X;  4TQ0 A;  1FIQ A;  2VZK D;  2QSD A;  2XTR A;  4JE3 B;  1EU3 A;  3KWV A;  3U7Z A;  1FCL A;  5IYU A;  2GI9 A;  2WXH A;  2G1E A;  1WRI A;  1YJI A;  1IUE A;  3AA0 B;  1OFF A;  4FXC A;  5D7G A;  3W5V B;  3GS2 A;  4HJG E;  3AA6 A;  1FMA D;  2BT6 A;  4CQN A;  5DL6 A;  2LMC A;  1F2R C;  1H6S 1;  4C80 A;  2PVO D;  1GFO A;  3AAE A;  3SY7 A;  1KH0 A;  2DYM A;  1MM4 A;  3JTY A;  5AFU K;  1C76 A;  4ZOH C;  4ZRQ A;  1FD6 A;  2D5G A;  2DLB A;  2WXO A;  3AA6 B;  4WQM A;  1OSM A;  4NZL B;  2INN E;  3HRD D;  3NVZ A;  3MFG A;  1TYG B;  4FUV A;  5GV0 A;  2EEL A;  3AEE B;  1WGK A;  4XE0 A;  4ZRP A;  1TY2 A;  1EU4 A;  4HRS A;  1BH3 A;  1E7P B;  2MJE A;  3ZJT A;  1GB4 A;  2N2L A;  2K5P A;  4D65 A;  1N60 A;  2MJD A;  5ADX K;  1FCC C;  2WXQ A;  3P42 A;  2HDE A;  4UDU C;  5FVN A;  2G9H D;  4KKJ A;  3EMN X;  2FBW B;  2ON8 A;  3ZYY X;  3V3X A;  3T3N A;  3MJ5 A;  1L6U A;  1DOY A;  3GP6 A;  1PYW D;  2K0P A;  2YEP B;  2R61 A;  3SZV A;  4MH8 A;  2M06 A;  1JCK B;  1HA5 A;  4RGN A;  2KN4 A;  2PLP A;  1KRH A;  3PO0 A;  2QMT A;  2J4U P;  4XWW A;  1I4P A;  5G5G A;  1PGX A;  1QOB A;  2Y2X A;  3LK3 A;  2JZP A;  3AEG B;  4O4U A;  1GFM A;  2K3U A;  3HVD A;  4AKM A;  2W82 A;  3LK4 1;  2IGH A;  4GCS A;  3GB1 A;  3LK3 B;  1VZ6 A;  2RPV A;  3LYY A;  3VRA B;  1LO5 D;  1FNW A;  1HZ6 A;  2POR A;  2J52 A;  1HXT A;  2WXM A;  4HEA 1;  4D2K A;  1QJP A;  1JW9 D;  2WXF A;  5HHD G;  1I4G A;  5D5D A;  1MVK A;  2BB5 A;  1PRN A;  2WXI A;  3T0S A;  4RF1 A;  3R8B A;  2GB1 A;  1TZO A;  4FZM A;  2WXR A;  4FES A;  1MPE A;  3LXF A;  1WYG A;  3B2G A;  1MPF A;  3AA7 B;  2DWQ A;  2KMM A;  1AWD A;  3T20 A;  1FFV A;  3N9Y C;  1QJ8 A;  5TSS A;  1MHX A;  1TKG A;  1VRA B;  2K4T A;  4KGS A;  3U2S C;  2HTM E;  4FZL A;  1ENF A;  3CIR B;  1XO3 A;  4NAW B;  2SEB D;  1T5X D;  2WDQ B;  5MPO A;  1SEB D;  3IAM 1;  2YPV A;  1D6E C;  4RGM A;  4C69 X;  3FYX A;  4AS1 A;  1ORM A;  2KDY A;  3P4R B;  3HUI A;  2YNK A;  1YNT E;  2WDR B;  1WWT A;  2BS2 B;  3FIL B;  3WI4 A;  3URY A;  2W54 A;  3AEA B;  4N58 A;  4JWS C;  2V3P A;  1EWY C;  2QJL A;  4YTN B;  2BS3 B;  2F1V A;  3SY9 A;  1KTK A;  1SIJ A;  2DYO A;  1M4V A;  2M19 A;  2ERV A;  4LSH A;  1NVI D;  3AE1 B;  1YS5 A;  2WXK A;  1JAL A;  5I4D A;  2K22 A;  3OWE B;  2JMM A;  3KVD D;  1ACC A;  1RFK A;  3E56 A;  3UU2 A;  4MM3 B;  3BVZ A;  1ZE3 D;  1K53 A;  2Y0L A;  4AZL A;  4AFK A;  3W9C B;  3T3O A;  2WP9 B;  1QOA A;  3BZD B;  5FR3 A;  3VQI A;  4R3D A;  4AYE C;  3NUH B;  2LHE A;  2PIA A;  1CJE A;  4WH4 A;  4KX6 B;  3RFZ B;  2J4X A;  2KZ7 A;  2WS3 B;  3AE4 B;  3AEC B;  2H89 B;  2Y5P A;  5D3I B;  4HKQ A;  3VZU X;  4DQO C;  1NI3 A;  4D64 A;  4M0W A;  1P7E A;  4P16 A;  4RH6 A;  3P4P B;  3J9C A;  3IAS 1;  2OMF A;  4GCP A;  5DL7 A;  3UAQ A;  1ESF A;  1F2R I;  1L4D B;  1N5W A;  1PFD A;  1JML A;  2IJ0 A;  2LFI A;  1SE3 A;  4B0E A;  4GLS C;  3VR8 B;  3A2S X;  4AYM C;  1A70 A;  3NVW A;  1E0Z A;  2M0A A;  1ZDX A;  3DA4 A;  1AW7 A;  1TJE A;  2WXL A;  1ZUD 2;  3AE7 B;  3V05 A;  1N5X A;  2MJ3 A;  2QIL A;  2XN9 C;  1E9M A;  1UGJ A;  3FC4 A;  5T8I A;  2MHL A;  3AE5 B;  1C79 A;  4OVZ A;  1D4B A;  1GOZ A;  2IGD A;  2J1N A;  1XCQ L;  2F1T A;  5ADX L;  4OZA A;  3IT4 B;  5D3D A;  1JWS D;  4RFB A;  1K52 A;  1J7A A;  2ICI A;  4PT5 A;  1XLN A;  4GDK B;  3HW9 A;  3BYY B;  5C3J B;  2ZFG A;  3WCQ A;  1MM5 A;  2JX5 A;  2PVG C;  3ABV B;  2BYT A;  3TEW A;  1ZHW A;  1YN5 A;  3U52 E;  4TSS A;  1ET9 A;  5DL5 A;  3AB5 A;  1Q9F A;  1ZHY A;  1FRR A;  2V4I B;  3KQ4 A;  3QRC A;  5EE0 A;  4ARC A;  4WWM A;  4XNK A;  1D5X C;  1L0Y B;  3NVV A;  2W3S A;  1T6B X;  3HVZ A;  4YSX B;  1UUP A;  3POX A;  2WNM A;  2FGR A;  2YEP F;  1TKY A;  3AMZ A;  1L0X B;  1TS4 A;  3NVY A;  1QT9 A;  4ITK A;  3NS1 A;  2LEK A;  3VY8 X;  1UWM A;  2I2Y A;  2E6X A;  1V1P B;  2IGG A;  2LJI A;  2EKI A;  3AE2 B;  2X27 X;  1SE4 A;  1ROE A;  1PUT A;  4FMS A;  3B9J A;  4KGT A;  3AAE B;  1I4X A;  2PMV A;  3P63 A;  5H8Y E;  4TMA B;  1FO4 A;  2PKO A;  4ZHO A;  1RM6 C;  4C56 C;  1FFU A;  1L4Z B;  1ZHT A;  1HXU A;  1B1Z A;  2DBY A;  4GCQ A;  2O4V A;  2SAK A;  4RNA A;  2N0S B;  3AA1 A;  3H8H A;  2W80 C;  4O4X A;  4O3Y A;  2KDM A;  1QQR A;  2PW9 A;  1E6E B;  2ONQ A;  4RCO A;  1DYQ A;  1DGJ A;  1NEK B;  3AH7 A;  4NJC A;  1XLQ A;  5T5F A;  4XDC A;  4GF4 A;  1YQ4 B;  4Q2J A;  1HQR D;  1UNS A;  2XE5 A;  4B61 A;  4LTU A;  2MNH A;  1G90 A;  3C5O A;  1I4H A;  2J42 A;  1V1P A;  3BK1 A;  5PRN A;  3P4S B;  1D5M C;  3CWI A;  1TKE A;  4US9 A;  1ZPS A;  2NTS A;  2BBC A;  3DWG C;  4USA A;  2FUG 1;  2J53 A;  3ETR A;  4ZYS A;  4GHB A;  2WXN A;  2MH7 A;  1SJH D;  3RBH A;  2XE2 A;  2JU6 X;  2N9L A;  4DXG A;  2KC0 A;  3VY9 X;  5BYR A;  1F0Z A;  1R7S A;  2XG6 A;  1FM0 D;  1KLU D;  1RWS A;  1OPF A;  4FZN A;  2GRI A;  3R2I A;  3AA7 A;  4XWT A;  1XEE A;  1ZP0 B;  1F77 A;  2NTT A;  2OHF A;  4HRO A;  6PRN A;  4YT0 B;  1NYQ A;  2KXP B;  1C77 A;  2QIE B;  3BVG A;  4IOI E;  4AKR A;  4OW0 A;  3AV8 A;  2H88 B;  1N63 A;  1WSP A;  1XF5 L;  4MAC A;  4AQ7 A;  5BMH A;  4AKR B;  3PQS A;  2Y3A A;  1PHO A;  4YWG G;  5H92 C;  1IBX B;  3RPF C;  1ZHX A;  4RJW A;  2ZLD A;  3L4P A;  2KXP A;  2W81 C;  1IZN A;  2JYT A;  4OHJ A;  5AUK A;  1DOX A;  5C2T B;  2RMM A;  4Z3T A;  2IDY A;  5E6J A;  2LUM A;  4ARI A;  5G5H A;  3P1M A;  3POU A;  1N61 A;  1YQ3 B;  1HEZ E;  1VR9 A;  1QJ9 A;  2KAJ A;  3DA3 A;  1ZDV A;  5EE3 A;  5AFU L;  1EWC A;  2BTE A;  3VE1 A;  2Q5W D;  1QF6 A;  1VLB A;  4LSI A;  1KF6 B;  3KLS X;  3NZ3 A;  1PGB A;  3Q8E A;  2XNA C;  1TY0 A;  1BUI C;  1QKZ A;  3AE6 B;  3TEY A;  3Q8A A;  4A90 A;  1GPX A;  1YN3 A;  1VJK A;  4O3W A;  3I57 A;  1J7B A;  1V97 A;  2NMQ A;  4YTP B;  4H2A A;  5EE2 A;  2WDV B;  1GFP A;  4U9C A;  4QQ1 A;  4RLB A;  4DXF A;  5BMG A;  1L5P A;  3BII D;  4KKI A;  2B76 B;  5GXG B;  1SB3 C;  3IT6 B;  3W1S A;  4JPS A;  3Q8B A;  4JWU C;  4JX1 C;  1ZOY B;  1J7C A;  2TSS A;  4FRT A;  4L1B A;  4C7Z A;  1YN4 A;  3LB8 C;  3NRZ A;  1BXT A;  4FRX A;  1C4A A;  3SZD A;  2ACZ B;  2Y0K A;  3C8Y A;  4AYD C;  1HXX A;  4FSP A;  4AYI D;  3O13 A;  1QIL A;  4L23 A;  5HG2 A;  2WQY B;  1OQR A;  3VE2 A;  2Y5C A;  3UPG A;  3HOL A;  1YMH E;  4YSZ B;  3ZGZ A;  3POR A;  3AM9 A;  2LFU A;  3BK2 A;  5LNK 1;  1V8C A;  2WXP A;  3BVM A;  1BXW A;  3O0E A;  1ET6 A;  4NAM A;  1CK1 A;  4IKG A;  1SXT A;  1K50 A;  1GAQ B;  2QEJ C;  3AED B;  1IGC A;  1BT9 A;  1E54 A;  1XLP A;  4OZC A;  1FXI A;  5JDP A;  4G76 A;  2V3N A;  4LLG M;  2AQ1 B;  2WXG A;  3W5U B;  1FNU A;  1GFN A;  1QLB B;  2Y7S A;  1GFQ A;  2XE1 A;  3POQ A;  1SBB B;  3GP7 A;  3SFE B;  4FSO A;  2AQ2 B;  3Q8C A;  1SJE D;  2BB6 A;  4MT5 A;  3MP9 A;  2M07 A;  2GE4 A;  1WXQ A;  3E9S A;  4HKZ E;  3K19 A;  3LK2 A;  3TZG A;  2CJO A;  1C9F A;  1Q9G A;  1T3Q A;  2OED A;  2WLB A;  1I4R A;  3EGR A;  4AYN A;  1JWM D;  2FGQ X;  3PZ7 A;  4RF0 A;  4LK0 M;  4WAF A;  2WU2 B;  1XCT L;  4E1T A;  3DWM A;  3FAH A;  1L6V A;  2CU3 A;  3AN1 A;  3AE3 B;  2KWD A;  3AEF B;  1FXA A;  5AUI A;  1SSN A;  4REZ A;  4O3Z A;  4RGT A;  2WXJ A;  3P4Q B;  3VZW X;  2Y0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...