4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
b'ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectocin M2
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
molecule tags Hydrolase
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
3AB5A 2PKOA 5H92C 1DOXA 5C2TB 1KFYB 3VRAB 3P63A 3VRBB 3AE8B 1FIQA 3HRDD 1L6VA 3W5UB 1TJEA 2WU5B 3AE4B 3LXFA 1FFUA 1KF6B 2JX5A 4G75A 1KRHA 1UWMA 1XLQA 4FZNA 3AEAB 5GXGB 1L5PA 2JQRB 3FAHA 3AE6B 3DWGC 2ACZB 1N63A 3NS1A 5H8YE 1ROEA 3AV8A 3SFDB 3B2GA 1QLBB 3PO0A 2WLBA 1FRDA 4C7ZA 4FZLA 1I7HA 3NVVA 3NVZA 1TKEA 1N5XA 2AX5A 1JW9D 3CWIA 1PUTA 3NVYA 3P4SB 5C3JB 1F0ZA 1NYRA 3DWMA 4LTUA 5EE9A 2MJDA 3AE9B 2PVGC 1OQRA 3HUIA 1JQ4A 1FMAD 1L6UA 3P4PB 2WU2B 2OHFA 4USAA 2WDQB 1NVID 1AWDA 2L52A 4HRSA 3W5VB 1CZPA 1JROA 4WWMA 2CJNA 5EE0A 4A9AA 4N6EB 2G1EA 1SF0A 1A70A 1FO4A 2E3TA 1ZOYB 2QJLA 3AM9A 1QOAA 3DA4A 1QOGA 2L83A 2DBYA 1E9MA 2W54A 3AE5B 2MJEA 3VR8B 2Q5WD 3AH7A 4US8A 1WWTA 2KMMA 3RPFC 1RWSA 2CJOA 1RYJA 2WQYB 1WYGA 1SIJA 4ZHOA 1XO3A 1OQQA 3EUB2 3AE7B 2K9XA 1DOYA 4N58A 4FXCA 5AUIA 1YJIA 1JWAD 1V8CA 2FBWB 3AEDB 4JX1C 1T3QA 1AYFA 1TKGA 1PFDA 2H89B 2WDVB 3L4PA 4YSZB 4JWSC 1J7BA 3ZYYX 2DWQA 4YT0B 1QOBA 3B2FA 1FRRA 3B9JA 2QIEB 1FM0D 5MPOA 2LEKA 1FXAA 3P4RB 3W9CB 3AECB 4KX6B 1WGKA 2W3SA 1JRPA 2MH7A 1E10A 2B76B 2BS4B 3AMZA 1JWBD 1E6EB 1DGJA 1NEKB 4ZHPA 1TYGB 3BIID 2EKIA 5G5GA 1N61A 1YJJA 3P1MA 2XMXA 1ZP0B 3AEBB 3AEGB 1VLBA 4ITKA 4YSYB 3SR6A 1N60A 2PVOD 4ZOHC 1DOIA 1VDVA 2W55A 3LB8C 1YQ4B 1ZXIA 4G76A 1J7CA 3AEEB 4P6VF 4C80A 3DA3A 1XLOA 2BS3B 1V97A 4IDIA 4YTPB 1NYQA 2WS3B 1QF6A 1XLPA 2XTRA 1YQ3B 4YSXB 1WXQA 1RM6C 4YTNB 1NI3A 1VJKA 4WQMA 2BS2B 4JWUC 3CIRB 2XTQA 1ZUD2 1RFKA 2CU3A 5AUKA 3SFEB 2WDRB 3VR9B 1B9RA 3AEFB 1EWYC 1FXIA 1GPXA 1N62A 2PIAA 3AE3B 1IUEA 2M56B 3ETRA 1QT9A 2WP9B 3HVZA 4YXDB 1E0ZA 1GAQB 1SB3C 5EE1A 3NRZA 2W3RA 1NENB 3KWLA 1XLNA 3AE2B 3AN1A 1TKYA 2HTME 4C7YA 2M19A 4FZMA 3FC4A 1J7AA 2K5PA 2BT6A 1CJEA 2H88B 1N5WA 3P4QB 5G5HA 4US9A 1JALA 1WRIA 3AE1B 1PDXA 1R7SA 2KAJA 1FFVA 3WCQA 2MJ3A 5EE3A 1L0VB 2N0SB 4N59A 1QOFA 1E7PB 3NVWA 3ABVB 4YTMB 2Y5CA 2K22A 1OFFA 4HROA
chains in the Genus database with same CATH superfamily
4GCPA 3IG3A 3GS2A 4OW0A 1KFYB 1FIQA 3ZJVA 4FRXA 3Q8EA 3PRZA 3V60A 4IC7B 3FAHA 5H8YE 1YOVB 1MM5A 1D6EC 4BKGA 1TBEA 3RZFA 2HD5B 3ZQ4A 1XXGA 3KVDD 2GLSA 4AS1A 2ZEQA 2JZZA 5CHVC 4KIKB 4LNFA 2OHFA 3H6NA 1K51A 3W2DA 3X23A 1SF0A 1ZOYB 3LK3B 2YVCA 4W9DA 4ZRQA 2MJEA 4HPLB 4MGIE 2VH2A 2Z8LA 3WU2O 2V0GA 3VH4B 3N30A 4NPNA 4OZAA 3X0WA 4U9CA 1V8CA 4KR8A 5ADXL 1AYFA 4DDGD 1H6S1 4K7WA 2QIEB 3DBLI 3BYTB 5MPOA 3W9CB 4TQ0A 2HE7A 3UIPB 1JRPA 1H8CA 4C4VB 1EUVB 4M02A 1OSMA 4NJCA 1E6EB 1UWXA 2EKIA 1WM3A 1TZ1A 2FGQX 3LB8C 1IBXA 4YSXB 1NI3A 2RDBC 3CIRB 3N20C 2PMVA 2KDMA 2XG6A 2M17A 4AJWA 1FCLA 3AE3B 3AA7B 3DBLB 1XCQL 2HJ8A 1N5WA 1TY0A 4WWPA 2KAJA 2JUOA 1D5MC 4EZKA 1L0VB 3ZNGC 3KQ4A 2LASA 2C9WB 3PGRA 1D5ZC 3ABVB 2V1YA 1K8RB 2K22A 1Y56A 2BB5A 1A5RA 2O2VB 2WXKA 5D5DA 2B3AA 2K0LA 3W5UB 3HM3A 1KF6B 2GOWA 4W9IA 5IOIA 4XDCA 2KC1A 1PRNA 3ZNHB 1LM8B 3B2GA 2ERVA 3FILA 3PLVA 4FZLA 1HQRD 3UQAA 3P4SB 4RCOA 2JZPA 3B08A 5FK9C 5EE2A 2RMMA 5EE0A 3QWZB 1ESFA 4KDLB 4L1BA 2DBYA 4EE2A 2R4PA 3PGUA 1E9MA 2O6VD 3AE5B 1RWSA 2DZKA 4ANWA 4EOYA 1Z5SB 1V81A 3QJZA 1ZHTA 2L00B 5AUIA 1VRAB 1R4NI 1T3QA 1P0RA 1M4VA 3KUZA 4IWOA 3QARA 3B9JA 5G55A 5BYQA 1TS5A 2LEKA 1MJDA 2AQ1B 2JRHA 1D3ZA 1Y8RC 2DZJA 3CF6E 5E6OA 4RMAA 1V1PA 4PYUA 2KXPA 4ITKA 5DL5A 5JHAA 3SD5A 3DA3A 1YN4A 4MDKE 5CHWA 1R4NB 2WXRA 3AEFB 3JTYA 4DHJB 3HVZA 1QT9A 4BBNF 1E54A 2DLBA 2WXJA 4KGTA 4RGTA 4JGHB 4M0WB 1CQVA 1ENFA 3Q3OC 5G5HA 2GBMA 2J4XA 4P16A 2MSED 3L13A 1WXAA 3BRYA 2INCC 1QOFA 4BAXA 3IVFA 2RD0A 4ZDVA 4GDKA 2ON8A 4GN1A 3HRDD 1L6VA 2FNJB 2JF5A 4AUIA 3IT4B 3PV1A 2W9NA 1XLQA 2KX3A 1MFWA 3ECIA 2ACZB 1GFPA 3DQVA 3SFDB 1SBBB 3PGEA 2KTRA 4S17A 3I63C 1LFDA 5JHBA 2XK5A 3MP9A 4AFKA 4TQ1A 2LXCA 1OQRA 2J0JA 4GCSA 1FMAD 4O3ZA 4P1CC 5HI1A 2WVPA 2KVZA 1I42A 1ZDVA 1Q5WB 1KLVA 4WJOA 4O4UA 2LMCA 3VZUX 1TS3A 1YN5A 1GFMA 2JPHA 3URYA 4C69X 1C77A 3QC8B 3BVGA 3KUCB 2IZVB 1GB1A 4FN2A 3VE1A 4JL9A 2MLBA 4OVZA 1KJTA 2G4DB 3P4RB 3N9YC 2MH7A 2R4NA 2KHWB 3AMZA 2R4OA 1JWBD 1LO5D 2IWVA 4KRAA 3PZ8A 2WDTB 4WJQA 4ZOHC 5B5EO 2IGGA 4ICVA 3O0EA 5D94A 2RDHA 1XLPA 1L0XB 1HXXA 4PS8A 1UGJA 5IYUA 2W82A 2YNKA 3A33B 2M56B 2KZRA 5EDSA 2NTSA 4KZ0A 2UWQA 2HTME 2M19A 1T0SC 1T1LA 5D6JB 2NR2A 4A3OA 3T3NA 1R7SA 2ICIA 2MBOA 4BKTA 2BKFA 1WFYA 3ONSA 4GLSC 1E7PB 3RI7C 2CU1A 4WURA 1F52A 3LK3A 2K8CA 2KFKA 3VRBB 1KLUD 3U30A 2ZPYA 3AA6B 3BVMA 3AEAB 2I1KA 3NHEB 4DWFA 1T0QC 1ROEA 3ZUNA 1QKZA 2BYVE 2M8SA 1UGMA 2AX5A 2YEPB 4DK5A 1THQA 3DWMA 2L3ZA 5JXVA 1JQ4A 2HDEA 3A1QB 4I6PA 4DBGA 2JWZA 4E1SA 2MBHA 2J52A 3RYTA 3AXCA 2NVUI 4FT6A 2WXOA 2KT7A 2N2MA 3JSVB 1H4RA 2M07A 5GMVA 2N1WA 2W81C 2C7NB 2JT4B 3D32A 2MRPA 3ZRFA 3MHZA 2VZKD 3A2SX 3UGBB 3UINB 3P42A 1RFAA 3PSEB 4FSOA 1Q1OA 1ORMA 1ZHWA 1QJPA 1KLGD 2IO2B 3PT2B 4KX6B 4GCQA 2IYDB 3BWUD 3QA8A 1V1OA 3R7QA 4GB9A 1IPGA 1MPFA 1EF5A 2KC2A 5G5GA 4DXFA 4XGAB 2DYOA 3M3JA 2KWDA 2PVOD 3BYYB 1FNVA 3SYBA 1ZXIA 1N6ZA 1J7CA 2REXA 3S2AA 3NSGA 3UU2A 3WAPA 3CSTA 4RGMA 1WSPA 1YQ3B 1HTQA 4FHKA 4YTNB 3DBRI 1WJ4A 2V4IB 1WR6E 4M00A 2W80C 3AU5A 2DYBA 1GAQB 4EKUA 1SE9A 4K3BA 1WYWB 2QMTA 3QQ8B 5DCNA 1E8YA 4HCNB 2BT6A 3P4QB 1CK1A 3LDZE 3Q3MC 1PDXA 1TS2A 1P9DU 5KHQA 4TUUA 2IY1B 1YS5A 2FE8A 5BYSA 4PUXA 1UUPA 2D10A 3ZW3A 3T0SA 4J6IA 3ZLZA 2JRIB 3DBRB 2RR9A 4M01A 2OEDA 1BXWA 3L10B 4WWNA 2J0KA 5GV0A 1KM7A 3OAWA 3A0HO 3VY8X 2C7MB 4RM9A 1IZNB 3MHSD 1C78A 1FRDA 1ET9A 3C0RB 4DHZB 4JIOU 1T5XD 2GI9A 4LTUA 5J18A 2KNBA 3RNAC 2PVGC 3U7DA 2D3AA 3AI5A 2L52A 4KSLC 1RAXA 5IA7A 3Q2AC 2QJLA 3AM9A 2GBRA 2XE1A 2BWFA 2BTEA 3VH3B 3AA1B 4XWTA 3L16A 1FEHA 5D7GA 4D65A 4LSEA 3UAQA 2AQ2B 2BKRB 1YJIA 1P7EA 3ZO5B 4JX1C 3A9KA 3HWBA 1TKGA 1PFDA 1OEYJ 2ZNVC 4ANVA 2KZ7B 1P7FA 3FKYA 4XX5A 2N9XA 2KJRA 1EU4A 3VDZA 4IM3A 2LFIA 5KAFO 1TYGB 3BIID 1OGWA 3E56A 4BVUC 1L0YB 1N60A 4CHKA 2XE5A 4LSHA 1UF0A 2IBIB 4F4BA 4W9FA 2KDEB 4KSKC 1EF1A 1I4GA 4MSQB 4BKSA 2ZZPB 3RT3B 1VZ6A 1RFKA 3RNGC 5J17A 4PS7A 5G39A 2PIAA 4RF1A 2BWES 2N7JA 4NAWB 3W1YA 1BMLC 1E8ZA 1SB3C 1NENB 2K5PA 4HWIB 2VH1A 4RGOS 4EFOA 2IGHA 2LUEA 4FA6A 5BMHA 3V6EB 2M06A 2O6VA 3JVZX 1WZ3A 4ZHPA 1DOXA 1WI0A 1M94A 4GDLB 1Q9GA 3QHTA 3TBLD 2ZPNA 3DHHC 3DOWA 4ZRKA 4FZNA 2K1FA 4E3CA 4B0MA 3NS1A 4BOSC 4KKJA 2BBCA 3PRPB 4MJSB 1F2RC 1YX6B 2N7EA 4C7ZA 3NVZA 3I9V1 4FLHA 4CYEA 3QCAA 1F0ZA 2KK8A 3TZGA 1NYRA 5EE9A 3VHTC 4DXAB 1C4CA 3SZDA 4O3WA 3NUHB 2MW5A 2Y0HA 1FO4A 3POUA 2GB1A 3PTFC 4FSPA 1ZKHA 2L83A 3VUWA 4IW0A 1HTOA 1ISNA 5CTRC 4W9LA 2INNE 1WWTA 4HLEA 5E6NA 5AZHA 1WYGA 1SIJA 4ZHOA 3ZXRA 2K9XA 2UU7A 4AKMA 4LSIA 4JQWC 3IFWB 4KZCA 3SHQA 1I4QA 3AEDB 2A4ZA 3ZYYX 3PRNA 3M62B 2KDYA 1JCKB 4XYCA 2Y0KA 2RGFA 4W9KA 3ZDTA 1NEKB 2D3GA 1BT9A 2RSUA 3V62A 1T16A 5CHFA 1V5TA 3PREA 1AN8A 2QDFA 3C5OA 4C80A 4AKRA 4MSMB 2CHWA 3NOBA 3Q8AA 5GTHO 4WQMA 3TEWA 2XTQA 4LNNA 2L8JA 1EWYC 2F1VA 3IHPC 2Z59B 2WXHA 1FPYA 1V9JA 3BY4B 3NZUA 3Q6BA 1PGXA 2JYEA 2NMQA 3BS0A 1D4BA 3GP7A 2Z0EB 2G4SA 2WHIA 1GFQA 1QJ8A 1T0YA 1WJUA 3O13A 4QAYA 1STEA 4XNKA 2K6QA 4HK2A 4L23A 3RBHA 1MPEA 2D3CA 4DQOC 3SZVA 4LNIA 1IGDA 4B6WA 2A5UA 1R4MB 1OEYA 2PE9A 2MA9B 3PO0A 3ML9A 3SY9A 3DZMA 1WH3A 2FCSA 4DHJD 5DPTA 3Q3JA 3TUOA 1P98A 2MEKA 2BVCA 2KQ4X 1PGBA 4ZYSA 4E1TA 3RULA 3U7ZA 3DBSA 5C1ZA 1V5OA 1CZPA 1WRDB 4IL6O 5L83A 2ONQA 4FJVB 5ADXK 2V4LA 3Q69A 4D5UA 1DYQA 1ZDXA 2CJOA 4EUTA 3A9JB 1OQQA 1K53A 4N58A 1C1YB 2WXIA 2JXTA 2WDVB 3BRZA 2DWQA 2JWUA 1TT5B 2XEWA 3KVFB 2BQQA 1GC6A 4WIPA 4RJWA 3O65B 1DGJA 3I57A 2XMXA 4YSYB 2ZCCA 2ZW1A 4RM8A 4F7ZA 1NDDA 3H7PB 1EU3A 4AYEC 5DPSA 3BVZA 4K81A 2BS2B 3Q14C 4DXGA 5AUKA 2XN9C 1N62A 1C9FA 1E0ZA 4HEA1 2C7HA 1WXSA 2LHFA 3AA0A 4R3DA 4RJXA 2Y7SA 4AP4C 2KWUB 5IN7A 2QHOA 2OJRA 4BUMX 1ET6A 5EE3A 1GG3A 3LYYA 1PYWD 2KJ6A 2LGDA 5H92C 2KANA 5C23A 3VRAB 1KH0A 1WY8A 4W9EA 5IP4D 2INPE 3DHGC 1PQSA 2KYWA 2LRWA 4K1RB 3TSSA 2RDGA 3LJ3A 1ZE3D 4RFBA 3HVDA 3ZRCA 1WGDA 3VVWB 2I2YA 3NVVA 1GUAB 1HEZE 1TKEA 2PTLA 3HHMA 3VQIA 4YWGG 4LDTD 3C19A 3UPGA 2KDIA 1JRUA 3PQUA 2LGXA 1WMHA 1Z2MA 1S1QB 4KV2A 1F9JA 3IAM1 3PZDA 4HRSA 3W1SC 4XWWA 4N6EB 4WJPA 2AEHA 3ML8A 1QOGA 3VR8B 4HDOA 4OZCA 1VR9A 1V80A 3GB1A 2GMIC 5AFUL 1NI2A 3R7RA 3AE7B 3U2SC 2BYEA 3AU4A 2LJ5A 1WIAA 4KDIC 2SAKA 2MP2A 3RN9C 1OQYA 4QQ1A 1Q9FA 2K8HA 1LXDA 2WXMA 1C76A 3UI3A 4W9GA 4P1BC 1ZP0B 3SR6A 1G6JA 2AL6A 3AAAA 2M1MA 4GXBA 2FCQA 1SGHA 4EZJA 4GDLA 4P6VF 1WJNA 5JDPA 4JPSA 2J53A 3VZWX 2KDBA 2WS3B 3B0AA 2D2QA 1ZUD2 3RNFC 1JWUD 1F77A 4W9CA 2NPTA 1L4DB 4WJNA 4K7SA 2WP9B 2KMAA 1S5LO 3AAEB 3NRZA 3AN1A 3FC4A 1B1ZA 5LXHA 2MBBB 3ZNZB 3V61A 1BXTA 4IKGA 4I6NB 1KOTA 3NG0A 4E71A 4FESA 4A55A 4EEWA 1Q0WB 3LK42 1TGZB 3KLSX 1SIFA 2LGYA 2X38A 4KGSA 2L05A 4A6QA 3AE4B 3LXFA 3WI5A 1E8XA 1LGRA 3RZWC 2WXNA 4LDTB 1WGRA 3BK2A 3WA0A 1GB4A 2IO0B 2K0PA 2M0XA 4H2AA 4KIKA 1WXMA 2KWCA 3PZ7A 4D2KA 1JROA 2ZW0A 4LNKA 3DCGA 2L76A 4AYID 2F1CX 1WF9A 3GOEA 4HVBA 3RPFC 3BZDB 5BO4B 4XDDA 3UQBA 3H9DA 4MM3B 1U4AA 3EGRA 2N9PC 2M4NA 2PEAA 3DVNV 1S3SG 4B0EA 1UH6A 1G90A 3APDA 1MM4A 2UYZB 2CS4A 4NQKE 1TZOA 4YL8A 2AWTA 4C4VA 3B2FA 5CX3A 2WXGA 1FM0D 3ZNID 4PS3A 1ZHYA 3MC0B 4O3YA 3KYDD 5HHDG 3DWNA 1GOZA 1YJJA 4ANUA 4PT5A 3MTNB 4GU2A 2V3NA 3JW0X 3AULA 2LVQA 4NAMA 5T8IA 2KN5A 5D2MB 4HKZE 2DYMA 3AA7A 2Y3AA 1IBXB 5AZGA 1P3QU 1TKYA 5TISO 1C79A 1J7AA 2IPKD 4BZAA 2NTTA 3PS6A 1FFVA 1C3TA 4FRTA 2O2VA 2AXTO 2OOBB 5C2TB 3TEYA 2R61A 4RH6A 3TMPB 3PF1A 2K8BA 1IYFA 2LZ6A 2PPHA 1N63A 2BF8B 3V8UA 4XNLA 1HA5A 2D5GA 3CWIA 2ZCBA 3FILB 4G3XB 2WXPA 3L08A 3R3MA 3TEZA 5J2RA 3HIZA 2D11A 3RNEC 1WJ6A 2GBNA 2QCZA 3RUIB 4O49A 2YLMA 1L7YA 2NBWB 3NY5A 2OMFA 3LK2B 3K9PB 4CTDA 2Q5WD 4WH4A 3ZXVA 2JZ3B 2NBUA 4D64A 2FUHB 1XO3A 2DZMA 4PYZA 5JZEB 3DVGX 2KLCA 5GTIO 3DVGY 2FBWB 5HG2A 2EMSA 2WXQA 5BMGA 3WANA 1XT9B 1J0GA 1XCTL 2W3SA 2V3SA 2LVOA 3HOLA 1JMLA 2ASQA 3SU8X 1YN3A 4BBNC 5FR6A 5E6PA 2L1AA 1V1PB 1GFOA 2INDC 4G76A 4HPMB 4BFRA 4YTPB 1NYQA 2ZVOA 3OJ3A 3TCAA 4GF4A 3U4EG 3G7GA 4B9KA 3L17A 3APFA 2R89A 1YQBA 4M0WA 4AWJA 2JU6X 4KR4A 4KGRA 2G3QB 3VZTX 5FVNA 3ALBA 1FNUA 4M8NA 3CMMB 4C56C 4IOIE 4ARIA 3N1YC 3PGSA 1CMXB 4P7IA 1OTRB 4DHZE 2K25A 2MHJA 3AB5A 2IDYA 1E8WA 4IM0A 4MH8A 3AE8B 2KD0A 1TJEA 1FFUA 1UWMA 4GDKB 1C4PA 3EC8A 2LUMA 1OPFA 4A20A 1HXTA 1N5XA 4F8CB 1JW9D 1TIFA 3PHXB 3NVYA 3B1LX 2KTRB 4XZ4A 1SSNA 2XE2A 4ZRJA 1VZ7A 2XK5B 2XBBC 5L95C 2QEJC 3RNBC 2WDQB 1AWDA 3W5VB 1J8CA 1LQBA 4WWMA 2N9KA 1WX7A 4G0NB 5JH5C 1QOAA 1SE2A 4LLGM 3VY9X 4RLCA 3N3KB 4LJPB 4WAFA 3IBEA 2PE6B 2ZFGA 2IGDA 4A3PA 3SDLC 3GZNB 4LNOA 3EA6A 3APCA 1FD6A 3WAMA 1MI0A 2KVRA 3K9OB 3ZVVA 4F1SA 3W1SA 2KOXA 2N4FA 4NQLB 2NBVB 3L4PA 1L2NA 1YX5B 4GOCA 1P1AA 2BPSA 1WGKA 2JXXA 2GBKA 2G9HD 3Q8CA 2I38A 1F2RI 1IP9A 1L4ZB 3T9LA 3DPDA 1NBFC 1SJHD 4ASWC 2R8AA 2PW9A 3GE8C 3U8ZA 5HFYA 3ZIMA 1V97A 2IO1B 1WGGA 4MEMA 1RM6C 1VJKA 3NS8A 4JWUC 1RLFA 2LHDA 4UB8O 3DVNU 2FIFA 1SE4A 5EE1A 4C7YA 3WALA 3KWLA 3AE2B 3GP6A 2YEPF 4ARCA 5DL7A 2MNHA 1EWCA 1JALA 4FUVA 4FULA 3EECA 2WGSA 4B61A 1UBQA 2XE3A 4MT5A 1I35A 4N59A 3VUXA 4YTMB 3AA6A 5LXIB 2PORA 3NZSA 3DWOX 3N32A 1V86A 2D07B 2JX5A 2RPQA 1FXTB 1KRHA 1R4MI 2KFKB 3T3OA 2KN4A 4S0RA 2AQ3B 2G45B 1WR1A 2HTHA 2KLGA 3KWVA 3AV8A 4FADA 3NJTA 4MM3A 1WXVA 1WX8A 3A1QA 3P2BA 3KW5B 2MJDA 3ZJTA 3IAS1 3VAWA 2JSVX 3AE9B 3HUIA 4IG7B 3KUDB 2KJHB 2QSDA 4USAA 1NVID 3OWEB 3JSVA 4II2B 2ZLDA 3BINA 1BH3A 4GGQA 2LI5A 3EFUA 2QTKA 2MQJA 2WQYB 2ZJDA 5G2NA 2R2OA 2Z0DB 3U52E 3Q8FA 2WXLA 3ZJUA 4FJZA 2Y5BB 2BGFA 3CSFA 1FXAA 1YIWA 3AECB 4MGKE 2KQ7A 3UF8A 1C4AA 1WM2A 2J4UP 4FJYA 5PRNA 3VFKA 4I6LB 4G11A 4K7UA 4WWOA 3AEGB 4JLCA 2RPVA 4AJYB 2LGSA 3SY7A 2W55A 3HM6X 1SEBD 3L54A 1I4XA 5IO9A 2YPVA 2CU3A 2R88A 2WDRB 2JY6A 1P4TA 2X27X 5AEKB 2E6XA 2WWZA 3PVLA 5LNK1 4E74A 2W3RA 4GIVA 4BKSD 1QQRA 1BUIC 1V6EA 3ZTDA 3TIXA 3L0WB 1CJEA 1UNSA 4US9A 1WRIA 3AE1B 1KTKA 2FCNA 1FCCC 4FHJA 5I4DA 1HXYD 1OFFA 4HROA 1VD2A 2X8XX 1AW7A 5AZFA 3LK2A 1MHHE 5KHOA 2WU5B 2O4VA 2PRNA 4O3XB 4LK0M 1IZNA 1E7UA 4N75A 1F1HA 4N74A 1QLBB 4AZLA 2DAFA 1UELA 1I7HA 1EM7A 3PLUA 1I4HA 3R66C 1YMHE 2HJ1A 5C3JB 2WYQA 3VTUA 2IO3B 2BYTA 2AL3A 3WIMA 2L0FA 3H7SA 1L6UA 4HPPA 2LWPA 4II3B 3KZIO 5D3DA 2OJWA 1A70A 4A8XC 3LK41 1ZHXA 4UB6O 3AA1A 1E7VA 1GNUA 1QILA 4RL9A 2W54A 1J19A 4J3OD 3RNCC 4RLBA 2NS5A 4TMAB 2Y0LA 4MELA 3FYXA 2GRIA 2N7DA 4KVGB 4UDUC 2J7QB 5LLIA 1ACCA 2KZ7A 3A4SC 4ICUA 2DAJA 4RNAA 1QOBA 2XNAC 2KTFA 3IT6B 2J0MA 1FRRA 3A9KB 1E10A 4K3CA 3EMNX 2B76B 3IXSA 3KYCD 3AEBB 2WXFA 1TTNA 2JQYA 1YQ4B 3GE3C 2KACA 4M8MA 4MACA 3Q8BA 4HXDA 1VZ8A 4NJ7A 4B95A 4NAWA 3DHIC 1MG8A 4XC2A 1BT0A 3BK1A 2J42A 3VR9B 5HKHA 3PQSA 4HCPB 1TY2A 3TL5A 1JWSD 5KAIO 2K4TA 3WI4A 5T5FA 4GSWA 2EMTA 5DL6A 3OG5A 4OHJA 5BMIA 3VXWA 4PR7A 2N0SB 4FQEA 4HDQA 2Y5CA 2V3PA 4ANXA 2C60A 2O6VB 2FUG1 3VUYA 2MWSB 2JMMA 1GFNA 4G75A 4MJSA 2JQRB 1GJZA 3AE6B 2WJRA 3VTWA 1YNTE 1TS4A 1WE7A 2PLPA 2KC0A 1FNWA 3Q3FA 3POQA 1HZ5A 5E79O 3JCUO 3HOEA 2KO3A 3P4PB 4HKQA 2N1VA 4G50A 1XF5L 2CJNA 5AFUK 3C8YA 2G1EA 2LVPA 3R8BA 1ZXHA 4NNJB 1D5XC 2CHZA 2K3UA 2TSSA 3I5JC 3AH7A 2BYFA 4WAAA 2JYTA 2L7RA 1RYJA 4O1NA 1IGCA 2EELA 1DOYA 2DX5B 1JWAD 2MCNB 3PORA 1QZEA 2H89B 1E90A 4HJGE 2WJQA 4W9HA 1WGHA 4IWQA 3NZ3A 3V05A 4FOZA 2N9LA 3P1MA 1HXUA 2IY0B 3QRAA 3HW9A 1VLBA 1XD3B 3HK0A 4KKIA 2GBJA 3UIOB 1VDVA 2D3BA 3AEEB 1Q10A 1XLOA 1WXQA 3VTVA 4HJKA 5H2FO 1UZXB 4AKRB 1B9RA 4OVVA 3ZGZA 2DZIA 1E5WA 2GE4A 2CKHB 3M95A 5E6JA 3T24A 5BYRA 5TR5A 3MC8A 1I4RA 4ZRIA 1MG4A 4TKNA 2M0AA 4RGNA 2FIDA 2V9HA 1XQQA 3RMKC 4TSSA 2NCNA 2PKOA 2ZVNA 3P63A 1SXTA 1HZ6A 3A4RA 4PJ0O 2IJ0A 2FAZA 1HE8A 4FMSA 7PRNA 2X9KA 1YD8U 5GXGB 2SEBD 2QILA 3QX1A 2WLBA 2MHLA 3QK0A 1K52A 4X57B 2KQSA 4FBJB 1PUTA 2QC8A 3PPAA 3KH0A 3TEXA 1PHOA 5IKCM 2WX1A 1UD7A 2KDFB 4JFBA 2K39A 2WX0A 3MJWA 4WQOB 4ZRPA 4A9AA 3RFZB 3POXA 2KKCA 1ZW7A 3ZKJC 2DNFA 2CHXA 5B66O 1WX9A 4ZYNA 2BW2A 3J9CA 2Y2XA 3A9JA 5IAAC 2PJHA 3V3XA 3WAOA 3EUB2 3H1UA 4FXCA 2MBEA 4YSZB 4EZLA 2LJIA 4JWSC 1J7BA 3A0BO 4YT0B 4AUQC 4XE0A 2WNMA 1XEEA 2LRUA 4JCHA 1JWMD 1N61A 4CO7A 3H7PA 4Q2JA 1WZ0A 1SE3A 1ZHZA 2LHEA 4IDIA 4IM2A 2F1TA 5DPWA 3RD2A 2AYOB 3E9SA 3SEBA 1I4PA 1MHXA 1GPXA 3SYSA 5TSSA 4YXDB 1IUEA 5G26A 8PRNA 4C00A 3T8MA 4CQNA 2Y5PA 1XLNA 1T0RC 2L32A 1MVKA 2JVCA 2J1NA 3EFCA 3AA0B 2R2QA 3WCQA 4NY0A 4MH0E 5G38A 3ZDMC 4ACFA 2KXPB 3NVWA 2LFUA 3PRMB 1SJED 2I1JA 4AYDC 2VRRB 2LD9A 4JE3B 2FGRA 3V6CB 1UBIA 2BB6A 3Q3NC 1L5PA 4RF0A 2KX0A 3DWGC 4MGZE 3JYUA 6PRNA 2VZKB 2DENB 1ZGUB 1QJ9A 5DL8A 1VCBA 4AQ7A 4O4XA 4LJOB 4MGYE 4AYNA 2LXAA 4REZA 4GMVA 3MFGA 2CR5A 3QAQA 2WU2B 2IWWA 5DPRA 4TV3A 4W9JA 3DDCB 1WMHB 1V2YA 2KFJA 2KMCA 2E3TA 3N1ZC 4IWPA 3EHVA 3DA4A 4Z3TA 2EKEC 3QIJA 3MJ5A 3OJ4B 4IUMB 5FKAC 4US8A 2KMMA 4PK1A 3GZNI 3M63B 3OLMD 4URKA 3K19A 4DDID 1YJ1A 3ENEA 1AARA 1PGAA 3QRCA 2C5LC 2L0TA 5FR3A 1X1MA 3R2IA 1ZPSA 3TJPA 3N1XC 3VE2A 5G3AA 1RRBA 2MP2B 2BS4B 4NZLB 4NJ6A 2MX2A 2N2LA 3RCZA 1K50A 2K6DB 3DBHI 4OVUA 1DOIA 4LSFA 1V49A 4AOFA 3H8HA 2MBQA 3AAAB 3MC9A 2BS3B 2LGIA 1QF6A 1GC7A 4GHBA 3R2TA 4L2YA 2XTRA 1WGYA 2ZNVB 4A90A 2R4LA 4N9F4 2ODJA 2KXJA 2FCMA 3AAEA 3SFEB 1FXIA 3T20A 4BOZB 3ETRA 3ZTCA 2DHZA 2NPTB 1T6BX 2N9EB 4FZMA 1EO6A 2H88B 3I3TB 4LCDE 4OZBA 3DBHB 2MJ3A 3PHWB 4AYMC 2KWVB 1WE6A 5D3IB
chains in the Genus database with same CATH topology
4GCPA 3LK42 3T0SA 3GS2A 1KFYB 4OW0A 3KLSX 4KGSA 2X38A 1FIQA 3LK2A 1MHHE 3ZJVA 4A6QA 2WU5B 3AE4B 3LXFA 3WI5A 4FRXA 3Q8EA 2OEDA 2O4VA 2PRNA 4O3XB 4LK0M 1IZNA 1BXWA 2WXNA 3FAHA 5H8YE 5GV0A 3VY8X 1QLBB 4AZLA 1IZNB 3BK2A 1C78A 1FRDA 1ET9A 1I7HA 1EM7A 1MM5A 1D6EC 1GB4A 1I4HA 1YMHE 2K0PA 4H2AA 5C3JB 1T5XD 1XXGA 2GI9A 4LTUA 3KVDD 3ZQ4A 4AS1A 2PVGC 2BYTA 1L6UA 3PZ7A 4D2KA 2OHFA 5D3DA 2L52A 1JROA 2ZW0A 1K51A 3W2DA 1SF0A 1A70A 4A8XC 3LK41 1ZHXA 3LK3B 3AA1A 4AYID 1QILA 1ZOYB 2QJLA 3AM9A 2XE1A 4RL9A 4ZRQA 2BTEA 2W54A 2MJEA 3AA1B 2Z8LA 2V0GA 4J3OD 3RPFC 4XWTA 4RLBA 4TMAB 1FEHA 2Y0LA 3BZDB 3FYXA 4D65A 5D7GA 4LSEA 2GRIA 4OZAA 4XDDA 3UAQA 4UDUC 2AQ2B 4MM3B 3EGRA 4U9CA 1YJIA 1ACCA 1P7EA 4B0EA 1V8CA 2KZ7A 1G90A 1MM4A 4KR8A 4JX1C 5ADXL 3HWBA 1AYFA 1PFDA 1TKGA 1TZOA 4RNAA 1QOBA 2KZ7B 2XNAC 3IT6B 1H6S1 1P7FA 3B2FA 1FRRA 2QIEB 2WXGA 3BYTB 1FM0D 5MPOA 3W9CB 1ZHYA 3MC0B 4TQ0A 1JRPA 1E10A 4O3YA 3EMNX 1EU4A 2B76B 1OSMA 4NJCA 1E6EB 1UUPA 1UWXA 2LFIA 1TYGB 3BIID 3IXSA 2EKIA 3E56A 5HHDG 1YJJA 1GOZA 4PT5A 1L0YB 3AEBB 1N60A 2XE5A 4LSHA 2WXFA 2V3NA 2FGQX 3LB8C 1YQ4B 2KACA 4F4BA 4CQNA 4MACA 3Q8BA 1I4GA 4NAMA 5T8IA 4YSXB 1IBXA 1VZ8A 1NI3A 4HKZE 2DYMA 1VZ6A 3CIRB 3AA7A 1RFKA 2PMVA 2Y3AA 1IBXB 3BK1A 3VR9B 2J42A 2XG6A 2KDMA 3PQSA 1TY2A 2PIAA 3AE3B 4RF1A 1FCLA 1JWSD 2N7JA 3AA7B 4NAWB 1XCQL 1BMLC 2K4TA 1SB3C 3WI4A 5T5FA 1NENB 1TKYA 1C79A 1J7AA 2K5PA 5DL6A 2IPKD 1N5WA 4RGOS 2NTTA 1TY0A 4OHJA 2KAJA 2IGHA 1FFVA 5BMIA 1D5MC 5BMHA 1L0VB 4FRTA 2M06A 2N0SB 3KQ4A 1D5ZC 3ABVB 2Y5CA 2K22A 2V3PA 1Y56A 2BB5A 4ZHPA 1DOXA 5C2TB 2WXKA 4GDLB 3TEYA 1Q9GA 5D5DA 2K0LA 2R61A 3W5UB 2FUG1 4RH6A 1KF6B 2JMMA 1GFNA 4G75A 4XDCA 4FZNA 2JQRB 4B0MA 1PRNA 3AE6B 3NS1A 1N63A 4KKJA 2BBCA 3V8UA 3B2GA 2ERVA 4XNLA 1F2RC 1TS4A 1HA5A 1YNTE 4FZLA 2PLPA 1HQRD 3FILA 3NVZA 4C7ZA 2KC0A 3I9V1 1FNWA 2D5GA 3CWIA 3FILB 3P4SB 1F0ZA 3POQA 3TZGA 1HZ5A 1NYRA 2WXPA 4RCOA 2JZPA 3TEZA 5EE9A 5FK9C 3HOEA 1C4CA 5EE2A 3SZDA 2RMMA 3P4PB 4O3WA 4HKQA 3NUHB 1XF5L 4O49A 2CJNA 5AFUK 5EE0A 3C8YA 2G1EA 2Y0HA 3R8BA 1ESFA 1FO4A 3POUA 2GB1A 1ZXHA 4L1BA 4FSPA 2L83A 2OMFA 2DBYA 3LK2B 4EE2A 1E9MA 1D5XC 3AE5B 2K3UA 2TSSA 2Q5WD 3AH7A 4WH4A 2INNE 1WWTA 2JYTA 1RWSA 1RYJA 1WYGA 4O1NA 1SIJA 4D64A 1IGCA 1XO3A 4ZHOA 2EELA 2K9XA 1ZHTA 1DOYA 4AKMA 5AUIA 4LSIA 1VRAB 1I4QA 1JWAD 2FBWB 3PORA 3AEDB 1T3QA 2H89B 1M4VA 5HG2A 3ZYYX 3PRNA 2WXQA 4HJGE 5BMGA 2KDYA 3B9JA 1JCKB 5BYQA 2Y0KA 1TS5A 1XCTL 2LEKA 2AQ1B 2W3SA 3NZ3A 3V05A 4FOZA 1NEKB 2N9LA 3HOLA 1JMLA 1BT9A 1V1PA 3P1MA 1HXUA 1YN3A 3QRAA 2KXPA 3HW9A 1VLBA 5DL5A 4ITKA 2L1AA 4KKIA 1V1PB 1VDVA 1GFOA 1AN8A 3C5OA 4G76A 3AEEB 4C80A 3DA3A 1Q10A 1XLOA 1YN4A 4YTPB 1NYQA 3U4EG 4AKRA 4GF4A 3G7GA 1WXQA 2WXRA 3Q8AA 4WQMA 3TEWA 2XTQA 4AKRB 1B9RA 3AEFB 1EWYC 2F1VA 3JTYA 4M0WA 3ZGZA 3HVZA 1QT9A 2GE4A 4KR4A 1E54A 2DLBA 2JU6X 2WXHA 2WXJA 4KGRA 4KGTA 4RGTA 3VZTX 1CQVA 5FVNA 5E6JA 1ENFA 3T24A 1FNUA 1PGXA 2JYEA 2NMQA 5G5HA 5BYRA 2J4XA 4C56C 1I4RA 1D4BA 3GP7A 4IOIE 4P16A 2M0AA 4RGNA 4ARIA 1GFQA 1QJ8A 1QOFA 3O13A 4TSSA 1STEA 4XNKA 4L23A 3RBHA 1MPEA 4DQOC 3AB5A 2IDYA 3SZVA 2PKOA 4MH8A 2ON8A 3P63A 1SXTA 3AE8B 1IGDA 3HRDD 1L6VA 1HZ6A 1TJEA 4AUIA 1FFUA 2IJ0A 3IT4B 1UWMA 4GDKB 1XLQA 5GXGB 4FMSA 7PRNA 2SEBD 2ACZB 1GFPA 2QILA 1C4PA 3SFDB 2LUMA 1OPFA 3PO0A 1SBBB 3SY9A 2WLBA 2MHLA 1HXTA 1K52A 1N5XA 1JW9D 3TUOA 3MP9A 1PUTA 4AFKA 3NVYA 3TEXA 4TQ1A 1PHOA 2MEKA 1SSNA 4JFBA 2XE2A 2KQ4X 1VZ7A 1OQRA 2QEJC 1PGBA 4GCSA 4ZYSA 4E1TA 1FMAD 3U7ZA 4O3ZA 2WDQB 5HI1A 1AWDA 3W5VB 1CZPA 4ZRPA 4WWMA 2N9KA 4A9AA 3RFZB 1ZDVA 3POXA 2ONQA 1QOAA 1SE2A 4LLGM 4O4UA 3VY9X 2LMCA 2BW2A 4RLCA 5ADXK 3VZUX 2Y2XA 3J9CA 3Q69A 4WAFA 1TS3A 4D5UA 3V3XA 1DYQA 1YN5A 1ZDXA 2ZFGA 2CJOA 2IGDA 1GFMA 3EA6A 1FD6A 1OQQA 3EUB2 3URYA 4C69X 1C77A 1K53A 4N58A 1MI0A 4FXCA 3BVGA 3W1SA 2WXIA 4YSZB 2JXTA 1GB1A 2WDVB 3L4PA 2LJIA 4JWSC 1J7BA 2DWQA 4YT0B 3VE1A 2JWUA 4XE0A 2WNMA 4OVZA 1XEEA 3P4RB 1WGKA 3N9YC 2MH7A 4DXGA 2G9HD 4RJWA 4WIPA 3AMZA 3Q8CA 1JWBD 1LO5D 4KRAA 1DGJA 2I38A 3I57A 1F2RI 4JCHA 1JWMD 1N61A 3PZ8A 2XMXA 1L4ZB 4Q2JA 4YSYB 1SJHD 2ZW1A 1SE3A 4ZOHC 2IGGA 2PW9A 1EU3A 1ZHZA 5HFYA 3O0EA 2LHEA 4AYEC 1V97A 4IDIA 2RDHA 2F1TA 1XLPA 3BVZA 3E9SA 1L0XB 1HXXA 1RM6C 1VJKA 2BS2B 4JWUC 2LHDA 1UGJA 5IYUA 2W82A 2XN9C 5AUKA 3SEBA 2YNKA 1I4PA 1MHXA 1GPXA 3SYSA 5TSSA 1N62A 4YXDB 1C9FA 1IUEA 5G26A 8PRNA 2M56B 1E0ZA 1SE4A 4HEA1 5EE1A 2NTSA 4C7YA 2Y5PA 3KWLA 1XLNA 2LHFA 3GP6A 2HTME 3AA0A 2L32A 2M19A 2YEPF 5DL7A 3AE2B 4R3DA 2MNHA 1EWCA 4ARCA 1MVKA 4RJXA 2Y7SA 2J1NA 1JALA 3AA0B 3T3NA 1R7SA 4FUVA 2ICIA 3WCQA 4B61A 4BUMX 1ET6A 5EE3A 4MT5A 2XE3A 4N59A 3LYYA 4GLSC 2KXPB 1E7PB 3NVWA 4YTMB 2LFUA 1PYWD 4WURA 1SJED 5H92C 3AA6A 3LK3A 2PORA 3VRAB 4AYDC 1KH0A 3VRBB 2INPE 1KLUD 4JE3B 3AA6B 2FGRA 2JX5A 3TSSA 1KRHA 2RDGA 3BVMA 2BB6A 3T3OA 3AEAB 1L5PA 2KN4A 4RF0A 1ZE3D 4RFBA 2AQ3B 3HVDA 3DWGC 3KWVA 1ROEA 3AV8A 1QKZA 2I2YA 6PRNA 3NVVA 2VZKB 1HEZE 1TKEA 2PTLA 2AX5A 3VQIA 1QJ9A 5DL8A 2YEPB 4YWGG 4AQ7A 4O4XA 1THQA 3DWMA 2MJDA 5JXVA 3ZJTA 3IAS1 2JSVX 3AE9B 3UPGA 4AYNA 3HUIA 2HDEA 4REZA 1JQ4A 3PQUA 3MFGA 2WU2B 2QSDA 4USAA 1NVID 3OWEB 4HRSA 3IAM1 4E1SA 2J52A 4XWWA 4N6EB 4FT6A 2WXOA 2ZLDA 2E3TA 1BH3A 2N2MA 3DA4A 1QOGA 4Z3TA 3MJ5A 3VR8B 2M07A 2QTKA 5FKAC 4US8A 2KMMA 2W81C 4OZCA 1VR9A 2WQYB 3GB1A 3K19A 5AFUL 3AE7B 3U2SC 3U52E 1PGAA 3MHZA 3Q8FA 2VZKD 3A2SX 2WXLA 3QRCA 3P42A 5FR3A 3ZJUA 4FSOA 2SAKA 3R2IA 1ZPSA 1ORMA 1ZHWA 4QQ1A 1Q9FA 1FXAA 1QJPA 3VE2A 1KLGD 2WXMA 3AECB 4KX6B 4GCQA 1C4AA 3BWUD 2BS4B 1C76A 2J4UP 1V1OA 4NZLB 5PRNA 1MPFA 3UI3A 5G5GA 2N2LA 4DXFA 1ZP0B 3SR6A 1K50A 2DYOA 3AEGB 3AAAA 2KWDA 2PVOD 2RPVA 1FNVA 3BYYB 1DOIA 4LSFA 3SY7A 2W55A 3H8HA 3SYBA 1ZXIA 4P6VF 1J7CA 3NSGA 3AAAB 5JDPA 2BS3B 3UU2A 2LGIA 4JPSA 1QF6A 2J53A 4GHBA 3VZWX 2WS3B 3R2TA 4L2YA 2XTRA 1WSPA 1YQ3B 4RGMA 4A90A 1SEBD 4YTNB 2V4IB 2ODJA 1I4XA 1ZUD2 2YPVA 1JWUD 1F77A 3AAEA 2CU3A 2WDRB 2W80C 3SFEB 1FXIA 1P4TA 2X27X 3T20A 1L4DB 2E6XA 2WP9B 3ETRA 5LNK1 1GAQB 3AAEB 3NRZA 2QMTA 2W3RA 1T6BX 3AN1A 1QQRA 1BUIC 4FZMA 3FC4A 1B1ZA 1CJEA 2BT6A 2H88B 3P4QB 1CK1A 1UNSA 4US9A 1BXTA 1WRIA 4IKGA 3AE1B 1PDXA 1TS2A 1KTKA 4OZBA 2MJ3A 1FCCC 4AYMC 1YS5A 4FESA 5I4DA 1HXYD 2FE8A 5BYSA 4PUXA 5D3IB 4A55A 1OFFA 4HROA 1AW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB5 A;  2PKO A;  5H92 C;  1DOX A;  5C2T B;  1KFY B;  3VRA B;  3P63 A;  3VRB B;  3AE8 B;  1FIQ A;  3HRD D;  1L6V A;  3W5U B;  1TJE A;  2WU5 B;  3AE4 B;  3LXF A;  1FFU A;  1KF6 B;  2JX5 A;  4G75 A;  1KRH A;  1UWM A;  1XLQ A;  4FZN A;  3AEA B;  5GXG B;  1L5P A;  2JQR B;  3FAH A;  3AE6 B;  3DWG C;  2ACZ B;  1N63 A;  3NS1 A;  5H8Y E;  1ROE A;  3AV8 A;  3SFD B;  3B2G A;  1QLB B;  3PO0 A;  2WLB A;  1FRD A;  4C7Z A;  4FZL A;  1I7H A;  3NVV A;  3NVZ A;  1TKE A;  1N5X A;  2AX5 A;  1JW9 D;  3CWI A;  1PUT A;  3NVY A;  3P4S B;  5C3J B;  1F0Z A;  1NYR A;  3DWM A;  4LTU A;  5EE9 A;  2MJD A;  3AE9 B;  2PVG C;  1OQR A;  3HUI A;  1JQ4 A;  1FMA D;  1L6U A;  3P4P B;  2WU2 B;  2OHF A;  4USA A;  2WDQ B;  1NVI D;  1AWD A;  2L52 A;  4HRS A;  3W5V B;  1CZP A;  1JRO A;  4WWM A;  2CJN A;  5EE0 A;  4A9A A;  4N6E B;  2G1E A;  1SF0 A;  1A70 A;  1FO4 A;  2E3T A;  1ZOY B;  2QJL A;  3AM9 A;  1QOA A;  3DA4 A;  1QOG A;  2L83 A;  2DBY A;  1E9M A;  2W54 A;  3AE5 B;  2MJE A;  3VR8 B;  2Q5W D;  3AH7 A;  4US8 A;  1WWT A;  2KMM A;  3RPF C;  1RWS A;  2CJO A;  1RYJ A;  2WQY B;  1WYG A;  1SIJ A;  4ZHO A;  1XO3 A;  1OQQ A;  3EUB 2;  3AE7 B;  2K9X A;  1DOY A;  4N58 A;  4FXC A;  5AUI A;  1YJI A;  1JWA D;  1V8C A;  2FBW B;  3AED B;  4JX1 C;  1T3Q A;  1AYF A;  1TKG A;  1PFD A;  2H89 B;  2WDV B;  3L4P A;  4YSZ B;  4JWS C;  1J7B A;  3ZYY X;  2DWQ A;  4YT0 B;  1QOB A;  3B2F A;  1FRR A;  3B9J A;  2QIE B;  1FM0 D;  5MPO A;  2LEK A;  1FXA A;  3P4R B;  3W9C B;  3AEC B;  4KX6 B;  1WGK A;  2W3S A;  1JRP A;  2MH7 A;  1E10 A;  2B76 B;  2BS4 B;  3AMZ A;  1JWB D;  1E6E B;  1DGJ A;  1NEK B;  4ZHP A;  1TYG B;  3BII D;  2EKI A;  5G5G A;  1N61 A;  1YJJ A;  3P1M A;  2XMX A;  1ZP0 B;  3AEB B;  3AEG B;  1VLB A;  4ITK A;  4YSY B;  3SR6 A;  1N60 A;  2PVO D;  4ZOH C;  1DOI A;  1VDV A;  2W55 A;  3LB8 C;  1YQ4 B;  1ZXI A;  4G76 A;  1J7C A;  3AEE B;  4P6V F;  4C80 A;  3DA3 A;  1XLO A;  2BS3 B;  1V97 A;  4IDI A;  4YTP B;  1NYQ A;  2WS3 B;  1QF6 A;  1XLP A;  2XTR A;  1YQ3 B;  4YSX B;  1WXQ A;  1RM6 C;  4YTN B;  1NI3 A;  1VJK A;  4WQM A;  2BS2 B;  4JWU C;  3CIR B;  2XTQ A;  1ZUD 2;  1RFK A;  2CU3 A;  5AUK A;  3SFE B;  2WDR B;  3VR9 B;  1B9R A;  3AEF B;  1EWY C;  1FXI A;  1GPX A;  1N62 A;  2PIA A;  3AE3 B;  1IUE A;  2M56 B;  3ETR A;  1QT9 A;  2WP9 B;  3HVZ A;  4YXD B;  1E0Z A;  1GAQ B;  1SB3 C;  5EE1 A;  3NRZ A;  2W3R A;  1NEN B;  3KWL A;  1XLN A;  3AE2 B;  3AN1 A;  1TKY A;  2HTM E;  4C7Y A;  2M19 A;  4FZM A;  3FC4 A;  1J7A A;  2K5P A;  2BT6 A;  1CJE A;  2H88 B;  1N5W A;  3P4Q B;  5G5H A;  4US9 A;  1JAL A;  1WRI A;  3AE1 B;  1PDX A;  1R7S A;  2KAJ A;  1FFV A;  3WCQ A;  2MJ3 A;  5EE3 A;  1L0V B;  2N0S B;  4N59 A;  1QOF A;  1E7P B;  3NVW A;  3ABV B;  4YTM B;  2Y5C A;  2K22 A;  1OFF A;  4HRO A; 
#chains in the Genus database with same CATH topology
 4GCP A;  3IG3 A;  3GS2 A;  4OW0 A;  1KFY B;  1FIQ A;  3ZJV A;  4FRX A;  3Q8E A;  3PRZ A;  3V60 A;  4IC7 B;  3FAH A;  5H8Y E;  1YOV B;  1MM5 A;  1D6E C;  4BKG A;  1TBE A;  3RZF A;  2HD5 B;  3ZQ4 A;  1XXG A;  3KVD D;  2GLS A;  4AS1 A;  2ZEQ A;  2JZZ A;  5CHV C;  4KIK B;  4LNF A;  2OHF A;  3H6N A;  1K51 A;  3W2D A;  3X23 A;  1SF0 A;  1ZOY B;  3LK3 B;  2YVC A;  4W9D A;  4ZRQ A;  2MJE A;  4HPL B;  4MGI E;  2VH2 A;  2Z8L A;  3WU2 O;  2V0G A;  3VH4 B;  3N30 A;  4NPN A;  4OZA A;  3X0W A;  4U9C A;  1V8C A;  4KR8 A;  5ADX L;  1AYF A;  4DDG D;  1H6S 1;  4K7W A;  2QIE B;  3DBL I;  3BYT B;  5MPO A;  3W9C B;  4TQ0 A;  2HE7 A;  3UIP B;  1JRP A;  1H8C A;  4C4V B;  1EUV B;  4M02 A;  1OSM A;  4NJC A;  1E6E B;  1UWX A;  2EKI A;  1WM3 A;  1TZ1 A;  2FGQ X;  3LB8 C;  1IBX A;  4YSX B;  1NI3 A;  2RDB C;  3CIR B;  3N20 C;  2PMV A;  2KDM A;  2XG6 A;  2M17 A;  4AJW A;  1FCL A;  3AE3 B;  3AA7 B;  3DBL B;  1XCQ L;  2HJ8 A;  1N5W A;  1TY0 A;  4WWP A;  2KAJ A;  2JUO A;  1D5M C;  4EZK A;  1L0V B;  3ZNG C;  3KQ4 A;  2LAS A;  2C9W B;  3PGR A;  1D5Z C;  3ABV B;  2V1Y A;  1K8R B;  2K22 A;  1Y56 A;  2BB5 A;  1A5R A;  2O2V B;  2WXK A;  5D5D A;  2B3A A;  2K0L A;  3W5U B;  3HM3 A;  1KF6 B;  2GOW A;  4W9I A;  5IOI A;  4XDC A;  2KC1 A;  1PRN A;  3ZNH B;  1LM8 B;  3B2G A;  2ERV A;  3FIL A;  3PLV A;  4FZL A;  1HQR D;  3UQA A;  3P4S B;  4RCO A;  2JZP A;  3B08 A;  5FK9 C;  5EE2 A;  2RMM A;  5EE0 A;  3QWZ B;  1ESF A;  4KDL B;  4L1B A;  2DBY A;  4EE2 A;  2R4P A;  3PGU A;  1E9M A;  2O6V D;  3AE5 B;  1RWS A;  2DZK A;  4ANW A;  4EOY A;  1Z5S B;  1V81 A;  3QJZ A;  1ZHT A;  2L00 B;  5AUI A;  1VRA B;  1R4N I;  1T3Q A;  1P0R A;  1M4V A;  3KUZ A;  4IWO A;  3QAR A;  3B9J A;  5G55 A;  5BYQ A;  1TS5 A;  2LEK A;  1MJD A;  2AQ1 B;  2JRH A;  1D3Z A;  1Y8R C;  2DZJ A;  3CF6 E;  5E6O A;  4RMA A;  1V1P A;  4PYU A;  2KXP A;  4ITK A;  5DL5 A;  5JHA A;  3SD5 A;  3DA3 A;  1YN4 A;  4MDK E;  5CHW A;  1R4N B;  2WXR A;  3AEF B;  3JTY A;  4DHJ B;  3HVZ A;  1QT9 A;  4BBN F;  1E54 A;  2DLB A;  2WXJ A;  4KGT A;  4RGT A;  4JGH B;  4M0W B;  1CQV A;  1ENF A;  3Q3O C;  5G5H A;  2GBM A;  2J4X A;  4P16 A;  2MSE D;  3L13 A;  1WXA A;  3BRY A;  2INC C;  1QOF A;  4BAX A;  3IVF A;  2RD0 A;  4ZDV A;  4GDK A;  2ON8 A;  4GN1 A;  3HRD D;  1L6V A;  2FNJ B;  2JF5 A;  4AUI A;  3IT4 B;  3PV1 A;  2W9N A;  1XLQ A;  2KX3 A;  1MFW A;  3ECI A;  2ACZ B;  1GFP A;  3DQV A;  3SFD B;  1SBB B;  3PGE A;  2KTR A;  4S17 A;  3I63 C;  1LFD A;  5JHB A;  2XK5 A;  3MP9 A;  4AFK A;  4TQ1 A;  2LXC A;  1OQR A;  2J0J A;  4GCS A;  1FMA D;  4O3Z A;  4P1C C;  5HI1 A;  2WVP A;  2KVZ A;  1I42 A;  1ZDV A;  1Q5W B;  1KLV A;  4WJO A;  4O4U A;  2LMC A;  3VZU X;  1TS3 A;  1YN5 A;  1GFM A;  2JPH A;  3URY A;  4C69 X;  1C77 A;  3QC8 B;  3BVG A;  3KUC B;  2IZV B;  1GB1 A;  4FN2 A;  3VE1 A;  4JL9 A;  2MLB A;  4OVZ A;  1KJT A;  2G4D B;  3P4R B;  3N9Y C;  2MH7 A;  2R4N A;  2KHW B;  3AMZ A;  2R4O A;  1JWB D;  1LO5 D;  2IWV A;  4KRA A;  3PZ8 A;  2WDT B;  4WJQ A;  4ZOH C;  5B5E O;  2IGG A;  4ICV A;  3O0E A;  5D94 A;  2RDH A;  1XLP A;  1L0X B;  1HXX A;  4PS8 A;  1UGJ A;  5IYU A;  2W82 A;  2YNK A;  3A33 B;  2M56 B;  2KZR A;  5EDS A;  2NTS A;  4KZ0 A;  2UWQ A;  2HTM E;  2M19 A;  1T0S C;  1T1L A;  5D6J B;  2NR2 A;  4A3O A;  3T3N A;  1R7S A;  2ICI A;  2MBO A;  4BKT A;  2BKF A;  1WFY A;  3ONS A;  4GLS C;  1E7P B;  3RI7 C;  2CU1 A;  4WUR A;  1F52 A;  3LK3 A;  2K8C A;  2KFK A;  3VRB B;  1KLU D;  3U30 A;  2ZPY A;  3AA6 B;  3BVM A;  3AEA B;  2I1K A;  3NHE B;  4DWF A;  1T0Q C;  1ROE A;  3ZUN A;  1QKZ A;  2BYV E;  2M8S A;  1UGM A;  2AX5 A;  2YEP B;  4DK5 A;  1THQ A;  3DWM A;  2L3Z A;  5JXV A;  1JQ4 A;  2HDE A;  3A1Q B;  4I6P A;  4DBG A;  2JWZ A;  4E1S A;  2MBH A;  2J52 A;  3RYT A;  3AXC A;  2NVU I;  4FT6 A;  2WXO A;  2KT7 A;  2N2M A;  3JSV B;  1H4R A;  2M07 A;  5GMV A;  2N1W A;  2W81 C;  2C7N B;  2JT4 B;  3D32 A;  2MRP A;  3ZRF A;  3MHZ A;  2VZK D;  3A2S X;  3UGB B;  3UIN B;  3P42 A;  1RFA A;  3PSE B;  4FSO A;  1Q1O A;  1ORM A;  1ZHW A;  1QJP A;  1KLG D;  2IO2 B;  3PT2 B;  4KX6 B;  4GCQ A;  2IYD B;  3BWU D;  3QA8 A;  1V1O A;  3R7Q A;  4GB9 A;  1IPG A;  1MPF A;  1EF5 A;  2KC2 A;  5G5G A;  4DXF A;  4XGA B;  2DYO A;  3M3J A;  2KWD A;  2PVO D;  3BYY B;  1FNV A;  3SYB A;  1ZXI A;  1N6Z A;  1J7C A;  2REX A;  3S2A A;  3NSG A;  3UU2 A;  3WAP A;  3CST A;  4RGM A;  1WSP A;  1YQ3 B;  1HTQ A;  4FHK A;  4YTN B;  3DBR I;  1WJ4 A;  2V4I B;  1WR6 E;  4M00 A;  2W80 C;  3AU5 A;  2DYB A;  1GAQ B;  4EKU A;  1SE9 A;  4K3B A;  1WYW B;  2QMT A;  3QQ8 B;  5DCN A;  1E8Y A;  4HCN B;  2BT6 A;  3P4Q B;  1CK1 A;  3LDZ E;  3Q3M C;  1PDX A;  1TS2 A;  1P9D U;  5KHQ A;  4TUU A;  2IY1 B;  1YS5 A;  2FE8 A;  5BYS A;  4PUX A;  1UUP A;  2D10 A;  3ZW3 A;  3T0S A;  4J6I A;  3ZLZ A;  2JRI B;  3DBR B;  2RR9 A;  4M01 A;  2OED A;  1BXW A;  3L10 B;  4WWN A;  2J0K A;  5GV0 A;  1KM7 A;  3OAW A;  3A0H O;  3VY8 X;  2C7M B;  4RM9 A;  1IZN B;  3MHS D;  1C78 A;  1FRD A;  1ET9 A;  3C0R B;  4DHZ B;  4JIO U;  1T5X D;  2GI9 A;  4LTU A;  5J18 A;  2KNB A;  3RNA C;  2PVG C;  3U7D A;  2D3A A;  3AI5 A;  2L52 A;  4KSL C;  1RAX A;  5IA7 A;  3Q2A C;  2QJL A;  3AM9 A;  2GBR A;  2XE1 A;  2BWF A;  2BTE A;  3VH3 B;  3AA1 B;  4XWT A;  3L16 A;  1FEH A;  5D7G A;  4D65 A;  4LSE A;  3UAQ A;  2AQ2 B;  2BKR B;  1YJI A;  1P7E A;  3ZO5 B;  4JX1 C;  3A9K A;  3HWB A;  1TKG A;  1PFD A;  1OEY J;  2ZNV C;  4ANV A;  2KZ7 B;  1P7F A;  3FKY A;  4XX5 A;  2N9X A;  2KJR A;  1EU4 A;  3VDZ A;  4IM3 A;  2LFI A;  5KAF O;  1TYG B;  3BII D;  1OGW A;  3E56 A;  4BVU C;  1L0Y B;  1N60 A;  4CHK A;  2XE5 A;  4LSH A;  1UF0 A;  2IBI B;  4F4B A;  4W9F A;  2KDE B;  4KSK C;  1EF1 A;  1I4G A;  4MSQ B;  4BKS A;  2ZZP B;  3RT3 B;  1VZ6 A;  1RFK A;  3RNG C;  5J17 A;  4PS7 A;  5G39 A;  2PIA A;  4RF1 A;  2BWE S;  2N7J A;  4NAW B;  3W1Y A;  1BML C;  1E8Z A;  1SB3 C;  1NEN B;  2K5P A;  4HWI B;  2VH1 A;  4RGO S;  4EFO A;  2IGH A;  2LUE A;  4FA6 A;  5BMH A;  3V6E B;  2M06 A;  2O6V A;  3JVZ X;  1WZ3 A;  4ZHP A;  1DOX A;  1WI0 A;  1M94 A;  4GDL B;  1Q9G A;  3QHT A;  3TBL D;  2ZPN A;  3DHH C;  3DOW A;  4ZRK A;  4FZN A;  2K1F A;  4E3C A;  4B0M A;  3NS1 A;  4BOS C;  4KKJ A;  2BBC A;  3PRP B;  4MJS B;  1F2R C;  1YX6 B;  2N7E A;  4C7Z A;  3NVZ A;  3I9V 1;  4FLH A;  4CYE A;  3QCA A;  1F0Z A;  2KK8 A;  3TZG A;  1NYR A;  5EE9 A;  3VHT C;  4DXA B;  1C4C A;  3SZD A;  4O3W A;  3NUH B;  2MW5 A;  2Y0H A;  1FO4 A;  3POU A;  2GB1 A;  3PTF C;  4FSP A;  1ZKH A;  2L83 A;  3VUW A;  4IW0 A;  1HTO A;  1ISN A;  5CTR C;  4W9L A;  2INN E;  1WWT A;  4HLE A;  5E6N A;  5AZH A;  1WYG A;  1SIJ A;  4ZHO A;  3ZXR A;  2K9X A;  2UU7 A;  4AKM A;  4LSI A;  4JQW C;  3IFW B;  4KZC A;  3SHQ A;  1I4Q A;  3AED B;  2A4Z A;  3ZYY X;  3PRN A;  3M62 B;  2KDY A;  1JCK B;  4XYC A;  2Y0K A;  2RGF A;  4W9K A;  3ZDT A;  1NEK B;  2D3G A;  1BT9 A;  2RSU A;  3V62 A;  1T16 A;  5CHF A;  1V5T A;  3PRE A;  1AN8 A;  2QDF A;  3C5O A;  4C80 A;  4AKR A;  4MSM B;  2CHW A;  3NOB A;  3Q8A A;  5GTH O;  4WQM A;  3TEW A;  2XTQ A;  4LNN A;  2L8J A;  1EWY C;  2F1V A;  3IHP C;  2Z59 B;  2WXH A;  1FPY A;  1V9J A;  3BY4 B;  3NZU A;  3Q6B A;  1PGX A;  2JYE A;  2NMQ A;  3BS0 A;  1D4B A;  3GP7 A;  2Z0E B;  2G4S A;  2WHI A;  1GFQ A;  1QJ8 A;  1T0Y A;  1WJU A;  3O13 A;  4QAY A;  1STE A;  4XNK A;  2K6Q A;  4HK2 A;  4L23 A;  3RBH A;  1MPE A;  2D3C A;  4DQO C;  3SZV A;  4LNI A;  1IGD A;  4B6W A;  2A5U A;  1R4M B;  1OEY A;  2PE9 A;  2MA9 B;  3PO0 A;  3ML9 A;  3SY9 A;  3DZM A;  1WH3 A;  2FCS A;  4DHJ D;  5DPT A;  3Q3J A;  3TUO A;  1P98 A;  2MEK A;  2BVC A;  2KQ4 X;  1PGB A;  4ZYS A;  4E1T A;  3RUL A;  3U7Z A;  3DBS A;  5C1Z A;  1V5O A;  1CZP A;  1WRD B;  4IL6 O;  5L83 A;  2ONQ A;  4FJV B;  5ADX K;  2V4L A;  3Q69 A;  4D5U A;  1DYQ A;  1ZDX A;  2CJO A;  4EUT A;  3A9J B;  1OQQ A;  1K53 A;  4N58 A;  1C1Y B;  2WXI A;  2JXT A;  2WDV B;  3BRZ A;  2DWQ A;  2JWU A;  1TT5 B;  2XEW A;  3KVF B;  2BQQ A;  1GC6 A;  4WIP A;  4RJW A;  3O65 B;  1DGJ A;  3I57 A;  2XMX A;  4YSY B;  2ZCC A;  2ZW1 A;  4RM8 A;  4F7Z A;  1NDD A;  3H7P B;  1EU3 A;  4AYE C;  5DPS A;  3BVZ A;  4K81 A;  2BS2 B;  3Q14 C;  4DXG A;  5AUK A;  2XN9 C;  1N62 A;  1C9F A;  1E0Z A;  4HEA 1;  2C7H A;  1WXS A;  2LHF A;  3AA0 A;  4R3D A;  4RJX A;  2Y7S A;  4AP4 C;  2KWU B;  5IN7 A;  2QHO A;  2OJR A;  4BUM X;  1ET6 A;  5EE3 A;  1GG3 A;  3LYY A;  1PYW D;  2KJ6 A;  2LGD A;  5H92 C;  2KAN A;  5C23 A;  3VRA B;  1KH0 A;  1WY8 A;  4W9E A;  5IP4 D;  2INP E;  3DHG C;  1PQS A;  2KYW A;  2LRW A;  4K1R B;  3TSS A;  2RDG A;  3LJ3 A;  1ZE3 D;  4RFB A;  3HVD A;  3ZRC A;  1WGD A;  3VVW B;  2I2Y A;  3NVV A;  1GUA B;  1HEZ E;  1TKE A;  2PTL A;  3HHM A;  3VQI A;  4YWG G;  4LDT D;  3C19 A;  3UPG A;  2KDI A;  1JRU A;  3PQU A;  2LGX A;  1WMH A;  1Z2M A;  1S1Q B;  4KV2 A;  1F9J A;  3IAM 1;  3PZD A;  4HRS A;  3W1S C;  4XWW A;  4N6E B;  4WJP A;  2AEH A;  3ML8 A;  1QOG A;  3VR8 B;  4HDO A;  4OZC A;  1VR9 A;  1V80 A;  3GB1 A;  2GMI C;  5AFU L;  1NI2 A;  3R7R A;  3AE7 B;  3U2S C;  2BYE A;  3AU4 A;  2LJ5 A;  1WIA A;  4KDI C;  2SAK A;  2MP2 A;  3RN9 C;  1OQY A;  4QQ1 A;  1Q9F A;  2K8H A;  1LXD A;  2WXM A;  1C76 A;  3UI3 A;  4W9G A;  4P1B C;  1ZP0 B;  3SR6 A;  1G6J A;  2AL6 A;  3AAA A;  2M1M A;  4GXB A;  2FCQ A;  1SGH A;  4EZJ A;  4GDL A;  4P6V F;  1WJN A;  5JDP A;  4JPS A;  2J53 A;  3VZW X;  2KDB A;  2WS3 B;  3B0A A;  2D2Q A;  1ZUD 2;  3RNF C;  1JWU D;  1F77 A;  4W9C A;  2NPT A;  1L4D B;  4WJN A;  4K7S A;  2WP9 B;  2KMA A;  1S5L O;  3AAE B;  3NRZ A;  3AN1 A;  3FC4 A;  1B1Z A;  5LXH A;  2MBB B;  3ZNZ B;  3V61 A;  1BXT A;  4IKG A;  4I6N B;  1KOT A;  3NG0 A;  4E71 A;  4FES A;  4A55 A;  4EEW A;  1Q0W B;  3LK4 2;  1TGZ B;  3KLS X;  1SIF A;  2LGY A;  2X38 A;  4KGS A;  2L05 A;  4A6Q A;  3AE4 B;  3LXF A;  3WI5 A;  1E8X A;  1LGR A;  3RZW C;  2WXN A;  4LDT B;  1WGR A;  3BK2 A;  3WA0 A;  1GB4 A;  2IO0 B;  2K0P A;  2M0X A;  4H2A A;  4KIK A;  1WXM A;  2KWC A;  3PZ7 A;  4D2K A;  1JRO A;  2ZW0 A;  4LNK A;  3DCG A;  2L76 A;  4AYI D;  2F1C X;  1WF9 A;  3GOE A;  4HVB A;  3RPF C;  3BZD B;  5BO4 B;  4XDD A;  3UQB A;  3H9D A;  4MM3 B;  1U4A A;  3EGR A;  2N9P C;  2M4N A;  2PEA A;  3DVN V;  1S3S G;  4B0E A;  1UH6 A;  1G90 A;  3APD A;  1MM4 A;  2UYZ B;  2CS4 A;  4NQK E;  1TZO A;  4YL8 A;  2AWT A;  4C4V A;  3B2F A;  5CX3 A;  2WXG A;  1FM0 D;  3ZNI D;  4PS3 A;  1ZHY A;  3MC0 B;  4O3Y A;  3KYD D;  5HHD G;  3DWN A;  1GOZ A;  1YJJ A;  4ANU A;  4PT5 A;  3MTN B;  4GU2 A;  2V3N A;  3JW0 X;  3AUL A;  2LVQ A;  4NAM A;  5T8I A;  2KN5 A;  5D2M B;  4HKZ E;  2DYM A;  3AA7 A;  2Y3A A;  1IBX B;  5AZG A;  1P3Q U;  1TKY A;  5TIS O;  1C79 A;  1J7A A;  2IPK D;  4BZA A;  2NTT A;  3PS6 A;  1FFV A;  1C3T A;  4FRT A;  2O2V A;  2AXT O;  2OOB B;  5C2T B;  3TEY A;  2R61 A;  4RH6 A;  3TMP B;  3PF1 A;  2K8B A;  1IYF A;  2LZ6 A;  2PPH A;  1N63 A;  2BF8 B;  3V8U A;  4XNL A;  1HA5 A;  2D5G A;  3CWI A;  2ZCB A;  3FIL B;  4G3X B;  2WXP A;  3L08 A;  3R3M A;  3TEZ A;  5J2R A;  3HIZ A;  2D11 A;  3RNE C;  1WJ6 A;  2GBN A;  2QCZ A;  3RUI B;  4O49 A;  2YLM A;  1L7Y A;  2NBW B;  3NY5 A;  2OMF A;  3LK2 B;  3K9P B;  4CTD A;  2Q5W D;  4WH4 A;  3ZXV A;  2JZ3 B;  2NBU A;  4D64 A;  2FUH B;  1XO3 A;  2DZM A;  4PYZ A;  5JZE B;  3DVG X;  2KLC A;  5GTI O;  3DVG Y;  2FBW B;  5HG2 A;  2EMS A;  2WXQ A;  5BMG A;  3WAN A;  1XT9 B;  1J0G A;  1XCT L;  2W3S A;  2V3S A;  2LVO A;  3HOL A;  1JML A;  2ASQ A;  3SU8 X;  1YN3 A;  4BBN C;  5FR6 A;  5E6P A;  2L1A A;  1V1P B;  1GFO A;  2IND C;  4G76 A;  4HPM B;  4BFR A;  4YTP B;  1NYQ A;  2ZVO A;  3OJ3 A;  3TCA A;  4GF4 A;  3U4E G;  3G7G A;  4B9K A;  3L17 A;  3APF A;  2R89 A;  1YQB A;  4M0W A;  4AWJ A;  2JU6 X;  4KR4 A;  4KGR A;  2G3Q B;  3VZT X;  5FVN A;  3ALB A;  1FNU A;  4M8N A;  3CMM B;  4C56 C;  4IOI E;  4ARI A;  3N1Y C;  3PGS A;  1CMX B;  4P7I A;  1OTR B;  4DHZ E;  2K25 A;  2MHJ A;  3AB5 A;  2IDY A;  1E8W A;  4IM0 A;  4MH8 A;  3AE8 B;  2KD0 A;  1TJE A;  1FFU A;  1UWM A;  4GDK B;  1C4P A;  3EC8 A;  2LUM A;  1OPF A;  4A20 A;  1HXT A;  1N5X A;  4F8C B;  1JW9 D;  1TIF A;  3PHX B;  3NVY A;  3B1L X;  2KTR B;  4XZ4 A;  1SSN A;  2XE2 A;  4ZRJ A;  1VZ7 A;  2XK5 B;  2XBB C;  5L95 C;  2QEJ C;  3RNB C;  2WDQ B;  1AWD A;  3W5V B;  1J8C A;  1LQB A;  4WWM A;  2N9K A;  1WX7 A;  4G0N B;  5JH5 C;  1QOA A;  1SE2 A;  4LLG M;  3VY9 X;  4RLC A;  3N3K B;  4LJP B;  4WAF A;  3IBE A;  2PE6 B;  2ZFG A;  2IGD A;  4A3P A;  3SDL C;  3GZN B;  4LNO A;  3EA6 A;  3APC A;  1FD6 A;  3WAM A;  1MI0 A;  2KVR A;  3K9O B;  3ZVV A;  4F1S A;  3W1S A;  2KOX A;  2N4F A;  4NQL B;  2NBV B;  3L4P A;  1L2N A;  1YX5 B;  4GOC A;  1P1A A;  2BPS A;  1WGK A;  2JXX A;  2GBK A;  2G9H D;  3Q8C A;  2I38 A;  1F2R I;  1IP9 A;  1L4Z B;  3T9L A;  3DPD A;  1NBF C;  1SJH D;  4ASW C;  2R8A A;  2PW9 A;  3GE8 C;  3U8Z A;  5HFY A;  3ZIM A;  1V97 A;  2IO1 B;  1WGG A;  4MEM A;  1RM6 C;  1VJK A;  3NS8 A;  4JWU C;  1RLF A;  2LHD A;  4UB8 O;  3DVN U;  2FIF A;  1SE4 A;  5EE1 A;  4C7Y A;  3WAL A;  3KWL A;  3AE2 B;  3GP6 A;  2YEP F;  4ARC A;  5DL7 A;  2MNH A;  1EWC A;  1JAL A;  4FUV A;  4FUL A;  3EEC A;  2WGS A;  4B61 A;  1UBQ A;  2XE3 A;  4MT5 A;  1I35 A;  4N59 A;  3VUX A;  4YTM B;  3AA6 A;  5LXI B;  2POR A;  3NZS A;  3DWO X;  3N32 A;  1V86 A;  2D07 B;  2JX5 A;  2RPQ A;  1FXT B;  1KRH A;  1R4M I;  2KFK B;  3T3O A;  2KN4 A;  4S0R A;  2AQ3 B;  2G45 B;  1WR1 A;  2HTH A;  2KLG A;  3KWV A;  3AV8 A;  4FAD A;  3NJT A;  4MM3 A;  1WXV A;  1WX8 A;  3A1Q A;  3P2B A;  3KW5 B;  2MJD A;  3ZJT A;  3IAS 1;  3VAW A;  2JSV X;  3AE9 B;  3HUI A;  4IG7 B;  3KUD B;  2KJH B;  2QSD A;  4USA A;  1NVI D;  3OWE B;  3JSV A;  4II2 B;  2ZLD A;  3BIN A;  1BH3 A;  4GGQ A;  2LI5 A;  3EFU A;  2QTK A;  2MQJ A;  2WQY B;  2ZJD A;  5G2N A;  2R2O A;  2Z0D B;  3U52 E;  3Q8F A;  2WXL A;  3ZJU A;  4FJZ A;  2Y5B B;  2BGF A;  3CSF A;  1FXA A;  1YIW A;  3AEC B;  4MGK E;  2KQ7 A;  3UF8 A;  1C4A A;  1WM2 A;  2J4U P;  4FJY A;  5PRN A;  3VFK A;  4I6L B;  4G11 A;  4K7U A;  4WWO A;  3AEG B;  4JLC A;  2RPV A;  4AJY B;  2LGS A;  3SY7 A;  2W55 A;  3HM6 X;  1SEB D;  3L54 A;  1I4X A;  5IO9 A;  2YPV A;  2CU3 A;  2R88 A;  2WDR B;  2JY6 A;  1P4T A;  2X27 X;  5AEK B;  2E6X A;  2WWZ A;  3PVL A;  5LNK 1;  4E74 A;  2W3R A;  4GIV A;  4BKS D;  1QQR A;  1BUI C;  1V6E A;  3ZTD A;  3TIX A;  3L0W B;  1CJE A;  1UNS A;  4US9 A;  1WRI A;  3AE1 B;  1KTK A;  2FCN A;  1FCC C;  4FHJ A;  5I4D A;  1HXY D;  1OFF A;  4HRO A;  1VD2 A;  2X8X X;  1AW7 A;  5AZF A;  3LK2 A;  1MHH E;  5KHO A;  2WU5 B;  2O4V A;  2PRN A;  4O3X B;  4LK0 M;  1IZN A;  1E7U A;  4N75 A;  1F1H A;  4N74 A;  1QLB B;  4AZL A;  2DAF A;  1UEL A;  1I7H A;  1EM7 A;  3PLU A;  1I4H A;  3R66 C;  1YMH E;  2HJ1 A;  5C3J B;  2WYQ A;  3VTU A;  2IO3 B;  2BYT A;  2AL3 A;  3WIM A;  2L0F A;  3H7S A;  1L6U A;  4HPP A;  2LWP A;  4II3 B;  3KZI O;  5D3D A;  2OJW A;  1A70 A;  4A8X C;  3LK4 1;  1ZHX A;  4UB6 O;  3AA1 A;  1E7V A;  1GNU A;  1QIL A;  4RL9 A;  2W54 A;  1J19 A;  4J3O D;  3RNC C;  4RLB A;  2NS5 A;  4TMA B;  2Y0L A;  4MEL A;  3FYX A;  2GRI A;  2N7D A;  4KVG B;  4UDU C;  2J7Q B;  5LLI A;  1ACC A;  2KZ7 A;  3A4S C;  4ICU A;  2DAJ A;  4RNA A;  1QOB A;  2XNA C;  2KTF A;  3IT6 B;  2J0M A;  1FRR A;  3A9K B;  1E10 A;  4K3C A;  3EMN X;  2B76 B;  3IXS A;  3KYC D;  3AEB B;  2WXF A;  1TTN A;  2JQY A;  1YQ4 B;  3GE3 C;  2KAC A;  4M8M A;  4MAC A;  3Q8B A;  4HXD A;  1VZ8 A;  4NJ7 A;  4B95 A;  4NAW A;  3DHI C;  1MG8 A;  4XC2 A;  1BT0 A;  3BK1 A;  2J42 A;  3VR9 B;  5HKH A;  3PQS A;  4HCP B;  1TY2 A;  3TL5 A;  1JWS D;  5KAI O;  2K4T A;  3WI4 A;  5T5F A;  4GSW A;  2EMT A;  5DL6 A;  3OG5 A;  4OHJ A;  5BMI A;  3VXW A;  4PR7 A;  2N0S B;  4FQE A;  4HDQ A;  2Y5C A;  2V3P A;  4ANX A;  2C60 A;  2O6V B;  2FUG 1;  3VUY A;  2MWS B;  2JMM A;  1GFN A;  4G75 A;  4MJS A;  2JQR B;  1GJZ A;  3AE6 B;  2WJR A;  3VTW A;  1YNT E;  1TS4 A;  1WE7 A;  2PLP A;  2KC0 A;  1FNW A;  3Q3F A;  3POQ A;  1HZ5 A;  5E79 O;  3JCU O;  3HOE A;  2KO3 A;  3P4P B;  4HKQ A;  2N1V A;  4G50 A;  1XF5 L;  2CJN A;  5AFU K;  3C8Y A;  2G1E A;  2LVP A;  3R8B A;  1ZXH A;  4NNJ B;  1D5X C;  2CHZ A;  2K3U A;  2TSS A;  3I5J C;  3AH7 A;  2BYF A;  4WAA A;  2JYT A;  2L7R A;  1RYJ A;  4O1N A;  1IGC A;  2EEL A;  1DOY A;  2DX5 B;  1JWA D;  2MCN B;  3POR A;  1QZE A;  2H89 B;  1E90 A;  4HJG E;  2WJQ A;  4W9H A;  1WGH A;  4IWQ A;  3NZ3 A;  3V05 A;  4FOZ A;  2N9L A;  3P1M A;  1HXU A;  2IY0 B;  3QRA A;  3HW9 A;  1VLB A;  1XD3 B;  3HK0 A;  4KKI A;  2GBJ A;  3UIO B;  1VDV A;  2D3B A;  3AEE B;  1Q10 A;  1XLO A;  1WXQ A;  3VTV A;  4HJK A;  5H2F O;  1UZX B;  4AKR B;  1B9R A;  4OVV A;  3ZGZ A;  2DZI A;  1E5W A;  2GE4 A;  2CKH B;  3M95 A;  5E6J A;  3T24 A;  5BYR A;  5TR5 A;  3MC8 A;  1I4R A;  4ZRI A;  1MG4 A;  4TKN A;  2M0A A;  4RGN A;  2FID A;  2V9H A;  1XQQ A;  3RMK C;  4TSS A;  2NCN A;  2PKO A;  2ZVN A;  3P63 A;  1SXT A;  1HZ6 A;  3A4R A;  4PJ0 O;  2IJ0 A;  2FAZ A;  1HE8 A;  4FMS A;  7PRN A;  2X9K A;  1YD8 U;  5GXG B;  2SEB D;  2QIL A;  3QX1 A;  2WLB A;  2MHL A;  3QK0 A;  1K52 A;  4X57 B;  2KQS A;  4FBJ B;  1PUT A;  2QC8 A;  3PPA A;  3KH0 A;  3TEX A;  1PHO A;  5IKC M;  2WX1 A;  1UD7 A;  2KDF B;  4JFB A;  2K39 A;  2WX0 A;  3MJW A;  4WQO B;  4ZRP A;  4A9A A;  3RFZ B;  3POX A;  2KKC A;  1ZW7 A;  3ZKJ C;  2DNF A;  2CHX A;  5B66 O;  1WX9 A;  4ZYN A;  2BW2 A;  3J9C A;  2Y2X A;  3A9J A;  5IAA C;  2PJH A;  3V3X A;  3WAO A;  3EUB 2;  3H1U A;  4FXC A;  2MBE A;  4YSZ B;  4EZL A;  2LJI A;  4JWS C;  1J7B A;  3A0B O;  4YT0 B;  4AUQ C;  4XE0 A;  2WNM A;  1XEE A;  2LRU A;  4JCH A;  1JWM D;  1N61 A;  4CO7 A;  3H7P A;  4Q2J A;  1WZ0 A;  1SE3 A;  1ZHZ A;  2LHE A;  4IDI A;  4IM2 A;  2F1T A;  5DPW A;  3RD2 A;  2AYO B;  3E9S A;  3SEB A;  1I4P A;  1MHX A;  1GPX A;  3SYS A;  5TSS A;  4YXD B;  1IUE A;  5G26 A;  8PRN A;  4C00 A;  3T8M A;  4CQN A;  2Y5P A;  1XLN A;  1T0R C;  2L32 A;  1MVK A;  2JVC A;  2J1N A;  3EFC A;  3AA0 B;  2R2Q A;  3WCQ A;  4NY0 A;  4MH0 E;  5G38 A;  3ZDM C;  4ACF A;  2KXP B;  3NVW A;  2LFU A;  3PRM B;  1SJE D;  2I1J A;  4AYD C;  2VRR B;  2LD9 A;  4JE3 B;  2FGR A;  3V6C B;  1UBI A;  2BB6 A;  3Q3N C;  1L5P A;  4RF0 A;  2KX0 A;  3DWG C;  4MGZ E;  3JYU A;  6PRN A;  2VZK B;  2DEN B;  1ZGU B;  1QJ9 A;  5DL8 A;  1VCB A;  4AQ7 A;  4O4X A;  4LJO B;  4MGY E;  4AYN A;  2LXA A;  4REZ A;  4GMV A;  3MFG A;  2CR5 A;  3QAQ A;  2WU2 B;  2IWW A;  5DPR A;  4TV3 A;  4W9J A;  3DDC B;  1WMH B;  1V2Y A;  2KFJ A;  2KMC A;  2E3T A;  3N1Z C;  4IWP A;  3EHV A;  3DA4 A;  4Z3T A;  2EKE C;  3QIJ A;  3MJ5 A;  3OJ4 B;  4IUM B;  5FKA C;  4US8 A;  2KMM A;  4PK1 A;  3GZN I;  3M63 B;  3OLM D;  4URK A;  3K19 A;  4DDI D;  1YJ1 A;  3ENE A;  1AAR A;  1PGA A;  3QRC A;  2C5L C;  2L0T A;  5FR3 A;  1X1M A;  3R2I A;  1ZPS A;  3TJP A;  3N1X C;  3VE2 A;  5G3A A;  1RRB A;  2MP2 B;  2BS4 B;  4NZL B;  4NJ6 A;  2MX2 A;  2N2L A;  3RCZ A;  1K50 A;  2K6D B;  3DBH I;  4OVU A;  1DOI A;  4LSF A;  1V49 A;  4AOF A;  3H8H A;  2MBQ A;  3AAA B;  3MC9 A;  2BS3 B;  2LGI A;  1QF6 A;  1GC7 A;  4GHB A;  3R2T A;  4L2Y A;  2XTR A;  1WGY A;  2ZNV B;  4A90 A;  2R4L A;  4N9F 4;  2ODJ A;  2KXJ A;  2FCM A;  3AAE A;  3SFE B;  1FXI A;  3T20 A;  4BOZ B;  3ETR A;  3ZTC A;  2DHZ A;  2NPT B;  1T6B X;  2N9E B;  4FZM A;  1EO6 A;  2H88 B;  3I3T B;  4LCD E;  4OZB A;  3DBH B;  2MJ3 A;  3PHW B;  4AYM C;  2KWV B;  1WE6 A;  5D3I B; 
#chains in the Genus database with same CATH homology
 4GCP A;  3LK4 2;  3T0S A;  3GS2 A;  1KFY B;  4OW0 A;  3KLS X;  4KGS A;  2X38 A;  1FIQ A;  3LK2 A;  1MHH E;  3ZJV A;  4A6Q A;  2WU5 B;  3AE4 B;  3LXF A;  3WI5 A;  4FRX A;  3Q8E A;  2OED A;  2O4V A;  2PRN A;  4O3X B;  4LK0 M;  1IZN A;  1BXW A;  2WXN A;  3FAH A;  5H8Y E;  5GV0 A;  3VY8 X;  1QLB B;  4AZL A;  1IZN B;  3BK2 A;  1C78 A;  1FRD A;  1ET9 A;  1I7H A;  1EM7 A;  1MM5 A;  1D6E C;  1GB4 A;  1I4H A;  1YMH E;  2K0P A;  4H2A A;  5C3J B;  1T5X D;  1XXG A;  2GI9 A;  4LTU A;  3KVD D;  3ZQ4 A;  4AS1 A;  2PVG C;  2BYT A;  1L6U A;  3PZ7 A;  4D2K A;  2OHF A;  5D3D A;  2L52 A;  1JRO A;  2ZW0 A;  1K51 A;  3W2D A;  1SF0 A;  1A70 A;  4A8X C;  3LK4 1;  1ZHX A;  3LK3 B;  3AA1 A;  4AYI D;  1QIL A;  1ZOY B;  2QJL A;  3AM9 A;  2XE1 A;  4RL9 A;  4ZRQ A;  2BTE A;  2W54 A;  2MJE A;  3AA1 B;  2Z8L A;  2V0G A;  4J3O D;  3RPF C;  4XWT A;  4RLB A;  4TMA B;  1FEH A;  2Y0L A;  3BZD B;  3FYX A;  4D65 A;  5D7G A;  4LSE A;  2GRI A;  4OZA A;  4XDD A;  3UAQ A;  4UDU C;  2AQ2 B;  4MM3 B;  3EGR A;  4U9C A;  1YJI A;  1ACC A;  1P7E A;  4B0E A;  1V8C A;  2KZ7 A;  1G90 A;  1MM4 A;  4KR8 A;  4JX1 C;  5ADX L;  3HWB A;  1AYF A;  1PFD A;  1TKG A;  1TZO A;  4RNA A;  1QOB A;  2KZ7 B;  2XNA C;  3IT6 B;  1H6S 1;  1P7F A;  3B2F A;  1FRR A;  2QIE B;  2WXG A;  3BYT B;  1FM0 D;  5MPO A;  3W9C B;  1ZHY A;  3MC0 B;  4TQ0 A;  1JRP A;  1E10 A;  4O3Y A;  3EMN X;  1EU4 A;  2B76 B;  1OSM A;  4NJC A;  1E6E B;  1UUP A;  1UWX A;  2LFI A;  1TYG B;  3BII D;  3IXS A;  2EKI A;  3E56 A;  5HHD G;  1YJJ A;  1GOZ A;  4PT5 A;  1L0Y B;  3AEB B;  1N60 A;  2XE5 A;  4LSH A;  2WXF A;  2V3N A;  2FGQ X;  3LB8 C;  1YQ4 B;  2KAC A;  4F4B A;  4CQN A;  4MAC A;  3Q8B A;  1I4G A;  4NAM A;  5T8I A;  4YSX B;  1IBX A;  1VZ8 A;  1NI3 A;  4HKZ E;  2DYM A;  1VZ6 A;  3CIR B;  3AA7 A;  1RFK A;  2PMV A;  2Y3A A;  1IBX B;  3BK1 A;  3VR9 B;  2J42 A;  2XG6 A;  2KDM A;  3PQS A;  1TY2 A;  2PIA A;  3AE3 B;  4RF1 A;  1FCL A;  1JWS D;  2N7J A;  3AA7 B;  4NAW B;  1XCQ L;  1BML C;  2K4T A;  1SB3 C;  3WI4 A;  5T5F A;  1NEN B;  1TKY A;  1C79 A;  1J7A A;  2K5P A;  5DL6 A;  2IPK D;  1N5W A;  4RGO S;  2NTT A;  1TY0 A;  4OHJ A;  2KAJ A;  2IGH A;  1FFV A;  5BMI A;  1D5M C;  5BMH A;  1L0V B;  4FRT A;  2M06 A;  2N0S B;  3KQ4 A;  1D5Z C;  3ABV B;  2Y5C A;  2K22 A;  2V3P A;  1Y56 A;  2BB5 A;  4ZHP A;  1DOX A;  5C2T B;  2WXK A;  4GDL B;  3TEY A;  1Q9G A;  5D5D A;  2K0L A;  2R61 A;  3W5U B;  2FUG 1;  4RH6 A;  1KF6 B;  2JMM A;  1GFN A;  4G75 A;  4XDC A;  4FZN A;  2JQR B;  4B0M A;  1PRN A;  3AE6 B;  3NS1 A;  1N63 A;  4KKJ A;  2BBC A;  3V8U A;  3B2G A;  2ERV A;  4XNL A;  1F2R C;  1TS4 A;  1HA5 A;  1YNT E;  4FZL A;  2PLP A;  1HQR D;  3FIL A;  3NVZ A;  4C7Z A;  2KC0 A;  3I9V 1;  1FNW A;  2D5G A;  3CWI A;  3FIL B;  3P4S B;  1F0Z A;  3POQ A;  3TZG A;  1HZ5 A;  1NYR A;  2WXP A;  4RCO A;  2JZP A;  3TEZ A;  5EE9 A;  5FK9 C;  3HOE A;  1C4C A;  5EE2 A;  3SZD A;  2RMM A;  3P4P B;  4O3W A;  4HKQ A;  3NUH B;  1XF5 L;  4O49 A;  2CJN A;  5AFU K;  5EE0 A;  3C8Y A;  2G1E A;  2Y0H A;  3R8B A;  1ESF A;  1FO4 A;  3POU A;  2GB1 A;  1ZXH A;  4L1B A;  4FSP A;  2L83 A;  2OMF A;  2DBY A;  3LK2 B;  4EE2 A;  1E9M A;  1D5X C;  3AE5 B;  2K3U A;  2TSS A;  2Q5W D;  3AH7 A;  4WH4 A;  2INN E;  1WWT A;  2JYT A;  1RWS A;  1RYJ A;  1WYG A;  4O1N A;  1SIJ A;  4D64 A;  1IGC A;  1XO3 A;  4ZHO A;  2EEL A;  2K9X A;  1ZHT A;  1DOY A;  4AKM A;  5AUI A;  4LSI A;  1VRA B;  1I4Q A;  1JWA D;  2FBW B;  3POR A;  3AED B;  1T3Q A;  2H89 B;  1M4V A;  5HG2 A;  3ZYY X;  3PRN A;  2WXQ A;  4HJG E;  5BMG A;  2KDY A;  3B9J A;  1JCK B;  5BYQ A;  2Y0K A;  1TS5 A;  1XCT L;  2LEK A;  2AQ1 B;  2W3S A;  3NZ3 A;  3V05 A;  4FOZ A;  1NEK B;  2N9L A;  3HOL A;  1JML A;  1BT9 A;  1V1P A;  3P1M A;  1HXU A;  1YN3 A;  3QRA A;  2KXP A;  3HW9 A;  1VLB A;  5DL5 A;  4ITK A;  2L1A A;  4KKI A;  1V1P B;  1VDV A;  1GFO A;  1AN8 A;  3C5O A;  4G76 A;  3AEE B;  4C80 A;  3DA3 A;  1Q10 A;  1XLO A;  1YN4 A;  4YTP B;  1NYQ A;  3U4E G;  4AKR A;  4GF4 A;  3G7G A;  1WXQ A;  2WXR A;  3Q8A A;  4WQM A;  3TEW A;  2XTQ A;  4AKR B;  1B9R A;  3AEF B;  1EWY C;  2F1V A;  3JTY A;  4M0W A;  3ZGZ A;  3HVZ A;  1QT9 A;  2GE4 A;  4KR4 A;  1E54 A;  2DLB A;  2JU6 X;  2WXH A;  2WXJ A;  4KGR A;  4KGT A;  4RGT A;  3VZT X;  1CQV A;  5FVN A;  5E6J A;  1ENF A;  3T24 A;  1FNU A;  1PGX A;  2JYE A;  2NMQ A;  5G5H A;  5BYR A;  2J4X A;  4C56 C;  1I4R A;  1D4B A;  3GP7 A;  4IOI E;  4P16 A;  2M0A A;  4RGN A;  4ARI A;  1GFQ A;  1QJ8 A;  1QOF A;  3O13 A;  4TSS A;  1STE A;  4XNK A;  4L23 A;  3RBH A;  1MPE A;  4DQO C;  3AB5 A;  2IDY A;  3SZV A;  2PKO A;  4MH8 A;  2ON8 A;  3P63 A;  1SXT A;  3AE8 B;  1IGD A;  3HRD D;  1L6V A;  1HZ6 A;  1TJE A;  4AUI A;  1FFU A;  2IJ0 A;  3IT4 B;  1UWM A;  4GDK B;  1XLQ A;  5GXG B;  4FMS A;  7PRN A;  2SEB D;  2ACZ B;  1GFP A;  2QIL A;  1C4P A;  3SFD B;  2LUM A;  1OPF A;  3PO0 A;  1SBB B;  3SY9 A;  2WLB A;  2MHL A;  1HXT A;  1K52 A;  1N5X A;  1JW9 D;  3TUO A;  3MP9 A;  1PUT A;  4AFK A;  3NVY A;  3TEX A;  4TQ1 A;  1PHO A;  2MEK A;  1SSN A;  4JFB A;  2XE2 A;  2KQ4 X;  1VZ7 A;  1OQR A;  2QEJ C;  1PGB A;  4GCS A;  4ZYS A;  4E1T A;  1FMA D;  3U7Z A;  4O3Z A;  2WDQ B;  5HI1 A;  1AWD A;  3W5V B;  1CZP A;  4ZRP A;  4WWM A;  2N9K A;  4A9A A;  3RFZ B;  1ZDV A;  3POX A;  2ONQ A;  1QOA A;  1SE2 A;  4LLG M;  4O4U A;  3VY9 X;  2LMC A;  2BW2 A;  4RLC A;  5ADX K;  3VZU X;  2Y2X A;  3J9C A;  3Q69 A;  4WAF A;  1TS3 A;  4D5U A;  3V3X A;  1DYQ A;  1YN5 A;  1ZDX A;  2ZFG A;  2CJO A;  2IGD A;  1GFM A;  3EA6 A;  1FD6 A;  1OQQ A;  3EUB 2;  3URY A;  4C69 X;  1C77 A;  1K53 A;  4N58 A;  1MI0 A;  4FXC A;  3BVG A;  3W1S A;  2WXI A;  4YSZ B;  2JXT A;  1GB1 A;  2WDV B;  3L4P A;  2LJI A;  4JWS C;  1J7B A;  2DWQ A;  4YT0 B;  3VE1 A;  2JWU A;  4XE0 A;  2WNM A;  4OVZ A;  1XEE A;  3P4R B;  1WGK A;  3N9Y C;  2MH7 A;  4DXG A;  2G9H D;  4RJW A;  4WIP A;  3AMZ A;  3Q8C A;  1JWB D;  1LO5 D;  4KRA A;  1DGJ A;  2I38 A;  3I57 A;  1F2R I;  4JCH A;  1JWM D;  1N61 A;  3PZ8 A;  2XMX A;  1L4Z B;  4Q2J A;  4YSY B;  1SJH D;  2ZW1 A;  1SE3 A;  4ZOH C;  2IGG A;  2PW9 A;  1EU3 A;  1ZHZ A;  5HFY A;  3O0E A;  2LHE A;  4AYE C;  1V97 A;  4IDI A;  2RDH A;  2F1T A;  1XLP A;  3BVZ A;  3E9S A;  1L0X B;  1HXX A;  1RM6 C;  1VJK A;  2BS2 B;  4JWU C;  2LHD A;  1UGJ A;  5IYU A;  2W82 A;  2XN9 C;  5AUK A;  3SEB A;  2YNK A;  1I4P A;  1MHX A;  1GPX A;  3SYS A;  5TSS A;  1N62 A;  4YXD B;  1C9F A;  1IUE A;  5G26 A;  8PRN A;  2M56 B;  1E0Z A;  1SE4 A;  4HEA 1;  5EE1 A;  2NTS A;  4C7Y A;  2Y5P A;  3KWL A;  1XLN A;  2LHF A;  3GP6 A;  2HTM E;  3AA0 A;  2L32 A;  2M19 A;  2YEP F;  5DL7 A;  3AE2 B;  4R3D A;  2MNH A;  1EWC A;  4ARC A;  1MVK A;  4RJX A;  2Y7S A;  2J1N A;  1JAL A;  3AA0 B;  3T3N A;  1R7S A;  4FUV A;  2ICI A;  3WCQ A;  4B61 A;  4BUM X;  1ET6 A;  5EE3 A;  4MT5 A;  2XE3 A;  4N59 A;  3LYY A;  4GLS C;  2KXP B;  1E7P B;  3NVW A;  4YTM B;  2LFU A;  1PYW D;  4WUR A;  1SJE D;  5H92 C;  3AA6 A;  3LK3 A;  2POR A;  3VRA B;  4AYD C;  1KH0 A;  3VRB B;  2INP E;  1KLU D;  4JE3 B;  3AA6 B;  2FGR A;  2JX5 A;  3TSS A;  1KRH A;  2RDG A;  3BVM A;  2BB6 A;  3T3O A;  3AEA B;  1L5P A;  2KN4 A;  4RF0 A;  1ZE3 D;  4RFB A;  2AQ3 B;  3HVD A;  3DWG C;  3KWV A;  1ROE A;  3AV8 A;  1QKZ A;  2I2Y A;  6PRN A;  3NVV A;  2VZK B;  1HEZ E;  1TKE A;  2PTL A;  2AX5 A;  3VQI A;  1QJ9 A;  5DL8 A;  2YEP B;  4YWG G;  4AQ7 A;  4O4X A;  1THQ A;  3DWM A;  2MJD A;  5JXV A;  3ZJT A;  3IAS 1;  2JSV X;  3AE9 B;  3UPG A;  4AYN A;  3HUI A;  2HDE A;  4REZ A;  1JQ4 A;  3PQU A;  3MFG A;  2WU2 B;  2QSD A;  4USA A;  1NVI D;  3OWE B;  4HRS A;  3IAM 1;  4E1S A;  2J52 A;  4XWW A;  4N6E B;  4FT6 A;  2WXO A;  2ZLD A;  2E3T A;  1BH3 A;  2N2M A;  3DA4 A;  1QOG A;  4Z3T A;  3MJ5 A;  3VR8 B;  2M07 A;  2QTK A;  5FKA C;  4US8 A;  2KMM A;  2W81 C;  4OZC A;  1VR9 A;  2WQY B;  3GB1 A;  3K19 A;  5AFU L;  3AE7 B;  3U2S C;  3U52 E;  1PGA A;  3MHZ A;  3Q8F A;  2VZK D;  3A2S X;  2WXL A;  3QRC A;  3P42 A;  5FR3 A;  3ZJU A;  4FSO A;  2SAK A;  3R2I A;  1ZPS A;  1ORM A;  1ZHW A;  4QQ1 A;  1Q9F A;  1FXA A;  1QJP A;  3VE2 A;  1KLG D;  2WXM A;  3AEC B;  4KX6 B;  4GCQ A;  1C4A A;  3BWU D;  2BS4 B;  1C76 A;  2J4U P;  1V1O A;  4NZL B;  5PRN A;  1MPF A;  3UI3 A;  5G5G A;  2N2L A;  4DXF A;  1ZP0 B;  3SR6 A;  1K50 A;  2DYO A;  3AEG B;  3AAA A;  2KWD A;  2PVO D;  2RPV A;  1FNV A;  3BYY B;  1DOI A;  4LSF A;  3SY7 A;  2W55 A;  3H8H A;  3SYB A;  1ZXI A;  4P6V F;  1J7C A;  3NSG A;  3AAA B;  5JDP A;  2BS3 B;  3UU2 A;  2LGI A;  4JPS A;  1QF6 A;  2J53 A;  4GHB A;  3VZW X;  2WS3 B;  3R2T A;  4L2Y A;  2XTR A;  1WSP A;  1YQ3 B;  4RGM A;  4A90 A;  1SEB D;  4YTN B;  2V4I B;  2ODJ A;  1I4X A;  1ZUD 2;  2YPV A;  1JWU D;  1F77 A;  3AAE A;  2CU3 A;  2WDR B;  2W80 C;  3SFE B;  1FXI A;  1P4T A;  2X27 X;  3T20 A;  1L4D B;  2E6X A;  2WP9 B;  3ETR A;  5LNK 1;  1GAQ B;  3AAE B;  3NRZ A;  2QMT A;  2W3R A;  1T6B X;  3AN1 A;  1QQR A;  1BUI C;  4FZM A;  3FC4 A;  1B1Z A;  1CJE A;  2BT6 A;  2H88 B;  3P4Q B;  1CK1 A;  1UNS A;  4US9 A;  1BXT A;  1WRI A;  4IKG A;  3AE1 B;  1PDX A;  1TS2 A;  1KTK A;  4OZB A;  2MJ3 A;  1FCC C;  4AYM C;  1YS5 A;  4FES A;  5I4D A;  1HXY D;  2FE8 A;  5BYS A;  4PUX A;  5D3I B;  4A55 A;  1OFF A;  4HRO A;  1AW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...