4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pectocin M2
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
1JRPA 1JWAD 4G76A 1PUTA 3NVVA 4N58A 1QOGA 1XO3A 3AE2B 2WU2B 4LTUA 2BS3B 5H8YE 1VJKA 2BS4B 2KAJA 2H89B 3AV8A 2KMMA 1FRRA 1RWSA 3W5VB 1CJEA 3LXFA 3P63A 1NEKB 1I7HA 1E7PB 1ROEA 1RYJA 1N61A 2CU3A 3AE8B 1NYQA 1TKYA 1DOXA 1KRHA 2PIAA 3L4PA 1E10A 3DA4A 1EWYC 1QOFA 3P1MA 5AUKA 3ZYYX 1WXQA 2XTRA 3NRZA 3ABVB 4YT0B 3AE7B 2E3TA 1NENB 4WWMA 1QOBA 2LEKA 3VRAB 4HROA 1J7BA 3DWMA 1N63A 3AE9B 4N59A 1SF0A 1WWTA 3DA3A 4FZNA 1JALA 1CZPA 1NVID 5H92C 3AM9A 3AMZA 5GXGB 2DBYA 1L0VB 1DGJA 2N0SB 1RFKA 3RPFC 3P4RB 2EKIA 2PKOA 1V8CA 5EE0A 4YSZB 1GPXA 1N5XA 3AE5B 2XMXA 1A70A 1WRIA 1V97A 1AWDA 1L5PA 3FC4A 3SFDB 4P6VF 4JWSC 3AEAB 4US9A 3VRBB 3VR8B 5G5HA 1ZXIA 1E9MA 2DWQA 1UWMA 1YQ3B 2JQRB 3AEDB 5C3JB 1PFDA 4G75A 2Q5WD 3SR6A 2MJDA 1ZUD2 4A9AA 2MH7A 1FIQA 1FMAD 1TJEA 2ACZB 1JWBD 2WDRB 3AE6B 1FXAA 1NYRA 3B2GA 1FM0D 3B9JA 1VLBA 3NS1A 5EE3A 2AX5A 4JWUC 4YXDB 2QIEB 1N62A 4C7ZA 1J7AA 3AECB 3NVWA 5AUIA 4ITKA 4ZHPA 1L6VA 3AEEB 4KX6B 1F0ZA 2WU5B 3AE4B 3HRDD 4C80A 1XLNA 1OQQA 2BS2B 4JX1C 1B9RA 3NVZA 1FRDA 1N5WA 2K5PA 1IUEA 1AYFA 2BT6A 2Y5CA 1L6UA 2W54A 3KWLA 1E0ZA 3PO0A 1JROA 4WQMA 4ZHOA 1OFFA 1T3QA 1YJJA 5C2TB 4YSXB 3DWGC 5EE9A 2JX5A 4FXCA 1RM6C 5MPOA 1FFVA 4USAA 2QJLA 2WLBA 1XLOA 2FBWB 1R7SA 2M56B 1SB3C 3EUB2 3HVZA 3P4PB 3AB5A 3AN1A 1QF6A 1XLQA 1N60A 2WDVB 2WP9B 1NI3A 3AEGB 2G1EA 2L52A 2W3SA 3CIRB 3LB8C 1QT9A 2CJOA 2M19A 1QOAA 2MJ3A 1DOIA 1PDXA 1TKGA 1TKEA 3NVYA 1FXIA 4YTPB 2WQYB 1GAQB 3AEFB 3AE3B 1E6EB 3AE1B 2L83A 3ETRA 2CJNA 2WDQB 1WGKA 3P4QB 3AH7A 3W5UB 1KFYB 2XTQA 4YTMB 3FAHA 3BIID 4C7YA 4YTNB 2MJEA 1DOYA 4YSYB 1YJIA 2OHFA 2W3RA 2PVOD 3WCQA 1TYGB 4IDIA 2WS3B 5EE1A 1YQ4B 1FFUA 2H88B 4N6EB 3SFEB 4FZMA 2K22A 1JQ4A 1KF6B 1VDVA 3AEBB 1SIJA 1XLPA 1FO4A 3CWIA 4FZLA 3HUIA 2W55A 5G5GA 1J7CA 2PVGC 4ZOHC 1QLBB 3W9CB 2HTME 3VR9B 2K9XA 1ZP0B 1WYGA 4US8A 4HRSA 1ZOYB 2B76B 1JW9D 3P4SB 3B2FA 1OQRA
chains in the Genus database with same CATH superfamily
2R89A 4G76A 3DOWA 3NVVA 5CX3A 4UB8O 4I6NB 4GDLA 5TISO 1BH3A 3HM6X 2YEPF 1N6ZA 3QC8B 1FPYA 2BKFA 4A55A 3P63A 3PT2B 4KSLC 4AYMC 2L1AA 4B0EA 3SY9A 3VH3B 1R4MB 4BVUC 3DWNA 1ZHXA 3EA6A 2R88A 3PQUA 2XNAC 1IYFA 1C76A 4JLCA 5DL7A 2OJRA 1JALA 2WNMA 2M17A 4RF0A 2DBYA 5G38A 1F77A 1VD2A 1E7UA 3ZNGC 1QZEA 2WGSA 2Z8LA 2LGYA 4K81A 2C7HA 1UZXB 3H8HA 1CK1A 1ORMA 1FXAA 3W2DA 3I5JC 3BRZA 2KFKB 4N74A 2FIDA 2GMIC 3ZIMA 3CSFA 3AXCA 2WJQA 2BS2B 3A9JA 5BYRA 3NVZA 1SJED 6PRNA 1PHOA 4WJNA 2F1CX 4GXBA 2ZPYA 5B5EO 1FFVA 2K1FA 1XLOA 2KTRB 5KHOA 2QSDA 3AB5A 2XEWA 3JTYA 2DX5B 2WX0A 1QT9A 3GS2A 2LRUA 2W80C 3OWEB 2JY6A 2OHFA 3O65B 3PSEB 3WIMA 3UQAA 2YEPB 2N1VA 2WWZA 4BKSA 4W9GA 2K22A 2KX3A 4FUVA 3VTWA 4K3BA 1UH6A 2F1TA 4XDCA 1UELA 2X8XX 1R4MI 5DCNA 4JFBA 2Y5PA 1G6JA 2PMVA 3A1QA 1XEEA 1OQRA 3LDZE 3AE2B 3R2TA 5D94A 2JU6X 3LK41 2ZVNA 4RM9A 5AEKB 3ML8A 4HKZE 3UF8A 1BT9A 2ZFGA 1WZ0A 4II2B 1E7PB 1RYJA 2C5LC 1WSPA 3T24A 1JMLA 3T0SA 2MEKA 2O6VA 1FCLA 2KZ7B 3M95A 5ADXL 3I63C 3HW9A 4AKRB 3JSVA 2I1JA 2N9KA 2MCNB 5IAAC 2FNJB 4W9CA 1KM7A 1E7VA 2FCMA 3AMZA 3RD2A 3Q3MC 4GDKA 2PKOA 3ONSA 3HHMA 3RCZA 1OPFA 1A70A 4DQOC 4AYDC 1PQSA 4KGRA 5G5HA 4YWGG 4DWFA 2KHWB 2FUG1 2K6DB 3SU8X 5EE2A 1UWXA 2KWCA 3IBEA 3NY5A 1FIQA 3DBLB 1ZKHA 1VLBA 3L0WB 4DHJB 3Q8EA 2BWFA 2AX5A 1RRBA 3RFZB 3PGRA 3HRDD 3H7PA 4GMVA 2BGFA 2NS5A 3DVGY 2JXXA 3LK2B 4II3B 2MP2B 2M4NA 3ZXRA 1Q9FA 5C2TB 2CHWA 2HDEA 3ZNID 2RR9A 2KC2A 3P4PB 1KTKA 2XG6A 1Q5WB 2KQSA 1TZ1A 1WGRA 3LB8C 5CTRC 5DL5A 3RI7C 4YTPB 4GB9A 1HZ5A 3RPFC 3W5UB 4W9DA 2XTQA 2WXMA 3ECIA 4K1RB 3NUHB 3HK0A 3APCA 4S17A 5HI1A 1TS3A 2PVGC 2JF5A 3WU2O 2M0XA 4XGAB 4XNLA 2KXPA 4LK0M 4HK2A 1JW9D 4OW0A 4RGNA 4WAFA 3N30A 2K6QA 1D5XC 5C23A 3N32A 4C4VB 5GMVA 1HE8A 2R2QA 3DQVA 5JHAA 4FULA 5BYSA 1N61A 1NYQA 2HJ8A 2KK8A 5D2MB 3NRZA 2KJHB 4WWOA 4KDIC 3ZUNA 3DBLI 1RLFA 3DBRB 3AE9B 4B95A 1V1PA 3R2IA 1L0VB 2EKIA 4O49A 3WAPA 1UUPA 2WXFA 4US9A 2ZPNA 4JE3B 1YQ3B 2L0FA 2NPTA 3JYUA 2KC1A 4IKGA 5L95C 3AE6B 4HVBA 1NYRA 2R8AA 3UPGA 5KHQA 5AFUL 3AECB 4ITKA 2XBBC 1IPGA 4TMAB 2DZJA 4W9LA 3T3OA 3LK3B 2Y3AA 1HA5A 2ZLDA 2FGQX 2KWDA 4P1BC 1EF1A 2AQ2B 1WM3A 2KDYA 3KW5B 3HOEA 1RM6C 2FBWB 2O6VD 1R7SA 4WJOA 3VXWA 3DWOX 3EFUA 2L52A 2QC8A 1TGZB 1S1QB 2KDIA 4EZKA 1KJTA 2AQ3B 1QKZA 2LXCA 4KRAA 2CJNA 1WGHA 4F1SA 4CHKA 1NI2A 3NZSA 1WJ4A 2AEHA 3RT3B 1D6EC 4RNAA 1FFUA 2Z0EB 1ZE3D 3P42A 4XE0A 4OHJA 1YX6B 3D32A 1J7CA 2CS4A 3RNFC 2D3BA 4HRSA 1J0GA 1GFMA 1ZXHA 5J2RA 3DBRI 1FCCC 4H2AA 1Z2MA 3C5OA 2LUEA 2BS4B 2J0KA 1L0XB 3PLVA 3H1UA 2AWTA 2PLPA 4HDQA 3APFA 2EMSA 1ROEA 2KNBA 3PF1A 3AE8B 3L4PA 3T20A 2XTRA 1P7FA 4IW0A 2MX2A 4RGMA 5E79O 2IGGA 4FZNA 2K0LA 2MBBB 4IWPA 4O3WA 3GE8C 2WXGA 2MLBA 4P7IA 5IN7A 2FCNA 2NTSA 1GOZA 2LHEA 1XCQL 2KWUB 3QCAA 2M0AA 3WAMA 2MH7A 4WWNA 4QAYA 1JWBD 2MHJA 5LLIA 3B9JA 4GHBA 1EUVB 3AA0B 2LMCA 5DPRA 4AUQC 4KX6B 4K7WA 2LRWA 3TEXA 4ZRQA 5GTIO 2K3UA 3OJ4B 4FHJA 1L6UA 3BS0A 4NAWA 2TSSA 2ZNVB 3U4EG 3L13A 5BMGA 2WJRA 1P9DU 1LQBA 2IO2B 4EE2A 5HKHA 3VFKA 4URKA 3CSTA 2W3SA 4NY0A 4NQLB 4S0RA 2KDBA 1STEA 5D6JB 3RNEC 3L08A 3KVDD 3ZKJC 3L16A 3T8MA 4EOYA 1WGKA 2N2LA 3VUYA 1WE6A 3IT4B 4G50A 3QK0A 4ZRPA 2KXJA 2LHFA 5D3DA 1C79A 4JCHA 1TY2A 5IO9A 2L3ZA 1FXTB 1LO5D 1ZP0B 2D11A 4BAXA 1QILA 4HKQA 2V1YA 1CMXB 3C8YA 1R4NB 2AL3A 2I2YA 1QOGA 4MGZE 1XF5L 1FD6A 4HPPA 4FADA 5CHVC 3PPAA 4DHZE 1CJEA 4KIKA 1WXAA 2DYBA 1UGMA 1WXSA 4FN2A 1ZDXA 3VAWA 1KLGD 2BPSA 3QA8A 3TJPA 1H8CA 3DWMA 2K4TA 2LFUA 2DZKA 2MW5A 1PGAA 3AM9A 2NMQA 3V3XA 2J4UP 1QQRA 5FKAC 3W1SC 2FIFA 4D5UA 5G3AA 3N1YC 3NJTA 1AWDA 2FGRA 3PLUA 2M8SA 4E1SA 2JQRB 3CMMB 1HXXA 2WXHA 3GB1A 2MJDA 3S2AA 4A9AA 5C1ZA 1FM0D 3V60A 1J7AA 4LNFA 3O13A 3RN9C 3URYA 1F0ZA 4BUMX 3MC8A 2D3AA 4RGOS 1IP9A 5J17A 2IDYA 4AKMA 2ZZPB 2KT7A 1I4HA 2RSUA 3KWVA 4WQMA 3JVZX 2I38A 4ZYSA 5EE9A 1J8CA 1VZ7A 4ANUA 2JZZA 3TZGA 1N60A 1A5RA 3TEYA 1TS5A 2KFJA 2IWWA 4LLGM 5G55A 2WDQB 1PRNA 3AH7A 4XC2A 3MHZA 1R4NI 1SBBB 3BIID 1WGYA 3U8ZA 2CR5A 2O2VA 1DOYA 1YJIA 3X0WA 2D10A 1V1OA 3PVLA 2L8JA 3PRMB 2OOBB 1E8XA 5JXVA 4IM3A 3UIPB 3DPDA 4A3OA 2V3SA 1YJ1A 1JQ4A 3KUDB 4GSWA 3DVGX 2M06A 2HTME 4M00A 3AULA 2DNFA 2HE7A 2RGFA 3PV1A 3MJWA 2SAKA 4M0WA 2ZJDA 1HZ6A 3N20C 1XO3A 4FOZA 2PTLA 5HG2A 1IBXA 4LNOA 2QTKA 2H89B 1XXGA 3TIXA 3W5VB 3EECA 3LXFA 5L83A 1S3SG 4TQ1A 1ET9A 3DZMA 2GOWA 1GB4A 1C4CA 1E10A 1Q9GA 1EWYC 3TEZA 2QDFA 1GC6A 2HD5B 1WXQA 5TSSA 2LGDA 2LEKA 5DPSA 4N59A 1SF0A 4LDTD 1RFKA 3LJ3A 3L10B 4LNIA 3PZ7A 1IZNA 2R61A 4FBJB 2W81C 2RDBC 4WJPA 2PE9A 3VY8X 2EKEC 1L2NA 1MJDA 3L54A 2K39A 2ACZB 2KQ7A 3DDCB 4O4UA 1WMHB 1YNTE 4ANVA 5J18A 3PGEA 1EO6A 5AZGA 1GUAB 2D5GA 5TR5A 2MBQA 3B08A 3SY7A 2N7JA 4DBGA 4E1TA 2KQ4X 3Q3FA 3AA1B 2V4LA 4MM3B 1EU3A 3MC9A 2L05A 5AFUK 1WF9A 2M56B 1P98A 3ZGZA 1MM5A 2IO3B 2WDVB 2WP9B 1NI3A 5CHWA 2INNE 3A2SX 3OG5A 1V86A 3DHGC 4KDLB 2DHZA 5JH5C 3ETRA 5HFYA 4TSSA 1SE3A 1QJ8A 3FAHA 4EFOA 3SYSA 5EDSA 2OJWA 4AYEC 2L76A 1GFQA 2JYTA 1KF6B 2VZKD 3N3KB 3HUIA 1WXMA 1HXYD 3TBLD 3W9CB 3VR9B 3Q8AA 4US8A 2ZCBA 2LUMA 3PORA 5KAFO 1E8WA 1FNUA 4WJQA 3ZNZB 2KVRA 2GI9A 2N2MA 3BK2A 5DPTA 2HJ1A 3MFGA 3QX1A 4L23A 4KR8A 1JCKB 1UGJA 2JRHA 4GLSC 2B3AA 4HJKA 2PPHA 2JSVX 2PIAA 2LXAA 1MPEA 2Y7SA 2MSED 2NR2A 4REZA 2D3CA 1SE9A 2NBWB 1P1AA 2JZ3B 3Q14C 3DA3A 3VE1A 1V1PB 3TL5A 5FR6A 3ZTDA 2UWQA 1P0RA 1L5PA 3FC4A 2GBMA 1KH0A 4OZCA 5JZEB 2LVQA 3GZNB 1V5OA 4EZJA 1THQA 4IUMB 2QIEB 1K50A 2N7EA 1L6VA 2CHXA 2BW2A 4UDUC 3U7ZA 3B1LX 3DVNU 1JROA 2LZ6A 1GFPA 3QWZB 3T9LA 1OSMA 4F7ZA 2QJLA 2WLBA 4OVUA 2G4SA 1XLQA 2CJOA 4XWWA 1QOAA 3BWUD 3TUOA 2DZIA 2J0JA 4FA6A 4EEWA 4YTMB 4AQ7A 4IL6O 1VZ6A 3W1SA 1WJUA 3A9KA 3SFEB 2LGSA 4O3XB 3VTVA 1D4BA 2J53A 2JT4B 4BBNF 1WX8A 4ARCA 2INDC 3N9YC 5CHFA 1Y8RC 1ACCA 2RD0A 3V61A 1JRPA 3NS8A 1GC7A 4MJSB 4K7UA 3IXSA 3E9SA 5DL8A 2KAJA 1E5WA 2KMMA 1SE2A 3UQBA 4AFKA 4FRXA 3IVFA 3PS6A 3RULA 3NZUA 1VZ8A 2XK5B 2LD9A 3GZNI 2KFKA 2JUOA 3UU2A 2JWUA 1WWTA 2ON8A 5AZHA 1VCBA 2SEBD 2GBKA 4PS7A 4RF1A 4LJPB 2Y0HA 1WRIA 3ALBA 4WURA 3NZ3A 4AJWA 1GFOA 2BB5A 2D3GA 3FILB 4AYNA 1JRUA 1F9JA 4A90A 2RDGA 1T16A 1SXTA 2LGXA 3RZFA 3AAAB 1H6S1 4JWSC 1WXVA 3L17A 4YXDB 4R3DA 4C7ZA 2C7NB 2NCNA 2KD0A 1UBQA 1XLNA 1OQQA 1Y56A 2BYFA 4PYUA 4W9IA 1N5WA 4G0NB 1UF0A 1AYFA 2BT6A 3OAWA 3HWBA 1WM2A 1HTQA 4FT6A 3VUWA 2N1WA 3AN1A 2DLBA 2EELA 4RFBA 1DYQA 2KJRA 3SD5A 4UB6O 2MJ3A 1DOIA 1TKGA 1FXIA 3BVZA 2J1NA 2XE2A 2N4FA 5G26A 1AW7A 2XN9C 2MNHA 2W3RA 3BYTB 2G45B 1WY8A 2H88B 2Y0LA 2DAJA 2QCZA 4GOCA 1WR6E 2KZ7A 2WXJA 4BOSC 2IO0B 4AKRA 3AA7A 1ZHZA 3K19A 3AU4A 3ENEA 2C9WB 3SZVA 3SEBA 3R7RA 3ML9A 1ISNA 3VQIA 2WXOA 1E8YA 1VJKA 3FYXA 1FRRA 4MGIE 2WXKA 1SSNA 2CU3A 2VH2A 3GOEA 4EUTA 2NVUI 1SE4A 3DA4A 3P1MA 1V80A 3UIOB 1QOBA 3ZW3A 3LK42 3GP6A 4XWTA 1NVID 1RAXA 2REXA 2N0SB 3EHVA 2ZW0A 3LK2A 3P4RB 2JZPA 2MP2A 1GPXA 1TY0A 1FNVA 1E54A 3LYYA 1F2RI 2IPKD 3AA6B 2LWPA 4RJXA 1UWMA 3BZDB 3SR6A 1SGHA 1BXWA 4XYCA 1T0RC 2MBHA 3AU5A 4J6IA 1V9JA 3AEEB 2FCSA 2ZCCA 4JX1C 3IHPC 2RDHA 4Z3TA 2K5PA 2WXNA 1SIFA 1MVKA 4CO7A 4RLCA 3DBHB 5D5DA 2LJIA 2UU7A 4FXCA 4GIVA 2CKHB 3WI4A 1SB3C 1VRAB 3RNAC 1AARA 2BTEA 1GB1A 3RYTA 2W9NA 1PDXA 3QJZA 2JVCA 3AEFB 3VHTC 2KC0A 1Z5SB 4JIOU 4FJVB 2WX1A 2FAZA 2MJEA 2O2VB 4C4VA 2LFIA 4KKIA 2FUHB 1NBFC 3VZWX 2KDFB 4DDID 4N6EB 4ANXA 3WAOA 2MWSB 2W55A 2BF8B 3ZRCA 1WYGA 2ZW1A 1OEYJ 2MA9B 1V2YA 4YL8A 4N75A 1V81A 2K8CA 1I4QA 3C19A 2IJ0A 1WFYA 4HCNB 2IGDA 2KACA 1K8RB 3IT6B 3POQA 2BB6A 4MELA 4C00A 3APDA 2PW9A 4A20A 3U52E 5E6OA 1ENFA 3BINA 2INPE 1HEZE 4BFRA 2MRPA 2M07A 3VRAB 1NENB 1J7BA 5GV0A 1N63A 2IWVA 3PTFC 4M02A 4LSIA 2BKRB 2WYQA 3KLSX 4A6QA 4JGHB 2KVZA 3LK3A 2KDEB 1LXDA 3QIJA 4YSZB 1N5XA 4ARIA 4GDLB 3K9OB 2WXPA 4W9EA 3TMPB 4P6VF 4AOFA 5IA7A 4RCOA 1C3TA 5G2NA 2BVCA 2GBNA 5BMHA 2JXTA 3DBHI 2YPVA 1ZUD2 1TJEA 3ZXVA 4AUIA 3NHEB 4FQEA 3TEWA 3ZJTA 2GB1A 3WI5A 1Q1OA 5FVNA 1FRDA 2G3QB 2IGHA 5FK9C 2YNKA 3Q8BA 3C0RB 5IOIA 3NOBA 4JQWC 1I4GA 5KAIO 1U4AA 4M8NA 3V05A 5ADXK 4TV3A 4ICUA 1QJPA 1PYWD 1YX5B 1JWMD 1QF6A 2NTTA 4FMSA 1L4DB 4DHJD 4KV2A 4DHZB 1D3ZA 1NDDA 1Q10A 3PZ8A 3V8UA 1GAQB 3V62A 1UBIA 3KYCD 1KFYB 3A4RA 1EF5A 3VZTX 4WH4A 3A9JB 1SEBD 2WS3B 3BVGA 4KVGB 2D2QA 4RM8A 4LSHA 1OEYA 2IZVB 1VDVA 1C4PA 4ANWA 5JDPA 3BK1A 3MTNB 2R4OA 1QJ9A 4ZOHC 1T0SC 1V5TA 5LXHA 3VUXA 4DXGA 4RH6A 1GFNA 2V4IB 4KR4A 2K25A 3JCUO 1V49A 4IWOA 2MHLA 3Q6BA 3EFCA 3RNGC 4EKUA 2N9LA 3QRAA 1F52A 2X38A 1RWSA 2YLMA 1ZHTA 5BO4B 2A4ZA 2XE1A 2AYOB 4B9KA 3N1XC 1TS4A 3E56A 2OEDA 1MG8A 3EGRA 1CZPA 3WALA 3A1QB 4B6WA 1P7EA 3NG0A 2V0GA 1DGJA 4M8MA 5EE0A 2HTHA 2XMXA 4MACA 1V97A 3DHHC 3SFDB 2DZMA 5IKCM 1JWUD 2GE4A 3MJ5A 3QRCA 4PK1A 2O6VB 2L0TA 1FMAD 1MPFA 1Q0WB 1GG3A 4GCPA 2Y2XA 1D5ZC 3JSVB 3AE4B 4TQ0A 3QARA 3HM3A 3N1ZC 4MH8A 4GDKB 4BZAA 2N9XA 3ZDMC 1K51A 1OFFA 3AAEA 2J4XA 4NAMA 5DPWA 2KTFA 5E6PA 4FHKA 1K53A 4N9F4 1L4ZB 1LGRA 3SDLC 3Q2AC 3VZUX 2KN5A 5T5FA 4MGKE 4MSMB 3GE3C 3TCAA 2V3PA 4NNJB 2L83A 3P4QB 3H7PB 4NJCA 4PS3A 1LM8B 1I4RA 2IBIB 1WE7A 2R4NA 3A9KB 4RMAA 4HDOA 4D2KA 4EZLA 4O3YA 3K9PB 1BT0A 4CYEA 2Z0DB 2M1MA 3VDZA 4FZLA 3ZVVA 3POXA 2PE6B 4Q2JA 4MSQB 2MBOA 2B76B 4F8CB 4RJWA 3RNBC 4N58A 3HIZA 1SJHD 3DVNV 4MDKE 2Y0KA 1MHHE 4C56C 3AV8A 3A0HO 2KJ6A 1C9FA 3Q3NC 4NPNA 1YIWA 2KANA 1I7HA 3HVDA 3Q8CA 8PRNA 2RMMA 1TKYA 3ZJUA 4HPMB 3A4SC 4KGSA 4YT0B 3AE7B 4WWMA 4XZ4A 3UGBB 2KXPB 1C4AA 2V9HA 2WXIA 2KOXA 1T0YA 4BOZB 4FJZA 3BYYB 2Z59B 5E6NA 2K0PA 2RPQA 3I9V1 4ASWC 1T0QC 3U7DA 3VRBB 1ZXIA 1B1ZA 2L7RA 1WIAA 4KGTA 1C77A 2WDRB 4BKTA 3NS1A 2JWZA 1MHXA 2JQYA 4FSOA 2YVCA 3W1YA 4KSKC 1WZ3A 1XD3B 1D5MC 2GRIA 4PJ0O 2W54A 1E0ZA 2ASQA 4YSXB 1TTNA 4HCPB 2KDMA 1I4XA 3PZDA 2C7MB 4IOIE 1M4VA 2NPTB 1T1LA 3AEGB 1S5LO 2Y5BB 4GF4A 3ZO5B 3M63B 3ZDTA 2MBEA 2CHZA 1F2RC 4QQ1A 4YTNB 4PYZA 3PRNA 1TBEA 3J9CA 4OVVA 4DK5A 2ZEQA 1YQ4B 2KWVB 4GCQA 2UYZB 3X23A 1X1MA 1PGBA 2VRRB 2DAFA 3AEBB 1E8ZA 3UINB 1FO4A 5BYQA 1RFAA 4BBNC 3H6NA 3AA7B 2VH1A 1YS5A 1GJZA 2XE5A 1ZOYB 1MM4A 4A8XC 3B2FA 1BXTA 2GBRA 2BYTA 4MT5A 5H8YE 4FSPA 2BWES 3FKYA 4HEA1 3OLMD 1HTOA 1H4RA 2KYWA 5FR3A 3DCGA 4LSEA 3U30A 4NQKE 1I42A 5I4DA 1DOXA 4AWJA 1KRHA 3PGSA 1WMHA 2N9EB 3VH4B 2E3TA 4O1NA 3IG3A 4JL9A 3NSGA 2JMMA 1ZDVA 4HROA 3BRYA 2DYMA 4WWPA 3U2SC 2X9KA 1F1HA 4P16A 1BMLC 1OGWA 1WYWB 3HOLA 1YN5A 3ZRFA 3AE5B 4ZRJA 3AA1A 3AEAB 4MM3A 3CF6E 3ZNHB 2N9PC 4GU2A 2X27X 1TS2A 3SHQA 4E74A 1YQBA 2QHOA 2WHIA 3Q3OC 4LNKA 4GN1A 4IM0A 4ZYNA 5AUIA 2LVPA 3NVWA 2D07B 5JHBA 2LHDA 4AP4C 3PRPB 4C80A 2ICIA 2RPVA 4MEMA 3KWLA 2Y5CA 4LCDE 4ZHOA 1T3QA 4I6PA 5HHDG 4P1CC 4USAA 2KTRA 3KQ4A 4E3CA 3PHXB 3R66C 3R7QA 1HXUA 2M19A 4ZRKA 1YN4A 2R4PA 1E6EB 4XNKA 2LJ5A 3R8BA 4KZCA 4C7YA 1WI0A 4FESA 1G90A 3KYDD 4MH0E 2E6XA 3DBSA 4WQOB 1L7YA 2V3NA 4CTDA 4NAWB 2JPHA 4A3PA 4C69X 4LSFA 3H7SA 1SIJA 3G7GA 3H9DA 1TZOA 4XDDA 3RNCC 3P4SB 3SYBA 1JWAD 2KO3A 4LDTB 1PUTA 3SZDA 2GLSA 4OVZA 4M01A 1HQRD 4LTUA 2IY0B 1AN8A 2O4VA 4D64A 4W9HA 2ZNVC 3POUA 5IYUA 4BKSD 1NEKB 2NBUA 4AZLA 4DXAB 1I4PA 1ZW7A 1PGXA 1HXTA 3I3TB 1OTRB 4PUXA 1IGDA 3MC0B 3EC8A 5GXGB 3KH0A 5IP4D 4WIPA 5B66O 3RZWC 1ZPSA 4W9FA 2J0MA 4X57B 2PEAA 4TKNA 4KIKB 1PFDA 4G75A 2Q5WD 4PR7A 3VVWB 2WXRA 3B2GA 3IAS1 1M94A 2N7DA 1XT9B 4D65A 2G9HD 3QQ8B 4IC7B 4JWUC 5EE3A 2KN4A 4G11A 4ZHPA 1WRDB 5G39A 4NJ7A 1B9RA 3QHTA 3JW0X 3IAM1 1WGGA 3PREA 3VE2A 3RMKC 4DDGD 2OMFA 3Q3JA 3HVZA 1P3QU 2LASA 2VZKB 1K52A 2DENB 2G1EA 2WXQA 3QAQA 4HJGE 3OJ3A 2ONQA 2KMAA 2KMCA 4BKGA 5DL6A 4MJSA 2QILA 2KLCA 3V6EB 2LGIA 2ZVOA 2LVOA 3TSSA 1XCTL 2XK5A 4OZAA 1XLPA 2IO1B 2BQQA 1UNSA 5G5GA 2IY1B 1QLBB 5PRNA 3M3JA 4LNNA 4O3ZA 4OZBA 2BYEA 1ZHWA 1EWCA 4HXDA 4L2YA 2BS3B 2JRIB 2R2OA 4PS8A 1YD8U 3FILA 4ACFA 1KLVA 2K8BA 4RGTA 1YOVB 4I6LB 3AAAA 3PRZA 1ET6A 1QOFA 5AUKA 5D7GA 4HLEA 2AXTO 3ABVB 3AI5A 1EM7A 5H92C 4M0WB 3Q69A 3MP9A 4ZRIA 2J52A 2LI5A 2NBVB 1EU4A 4K7SA 3A33B 2AQ1B 1IBXB 4DXFA 5D3IB 3ZLZA 3VR8B 2BBCA 1E9MA 1ESFA 2DWQA 3AEDB 5C3JB 1ZHYA 1BUIC 1VR9A 4FRTA 1LFDA 4GGQA 1WX9A 2KLGA 4KZ0A 2FE8A 2WU5B 4XX5A 3ZQ4A 2KX0A 5LXIB 1IUEA 3BY4B 2QMTA 2PRNA 3PGUA 1IZNB 3PO0A 3AAEB 1FNWA 2L32A 4FLHA 5MPOA 1WGDA 1KOTA 4J3OD 1YN3A 4IWQA 3CIRB 4TUUA 3VTUA 3ZJVA 1L0YB 4W9JA 3NVYA 2WQYB 1WJ6A 4NZLB 3AE3B 3AE1B 2J7QB 5LNK1 2K8HA 2QEJC 4L1BA 1P4TA 1FEHA 4B0MA 5EE1A 2XE3A 3UAQA 4FZMA 3V6CB 3KVFB 3CWIA 5BMIA 4FJYA 3KUCB 2K9XA 4HWIB 4F4BA 4ZDVA 3PQSA 2ODJA 2A5UA 1YMHE 4U9CA 2IYDB 4B61A 1MFWA 2WU2B 4ICVA 3KUZA 3VY9X 5E6JA 4RL9A 3AA6A 4K3CA 1UD7A 3T3NA 4G3XB 2J42A 4JPSA 4HPLB 1JWSD 2DYOA 3ZYYX 2WVPA 3PHWB 3Q8FA 4AJYB 2EMTA 2FCQA 3A0BO 2KZRA 5T8IA 1WX7A 2G4DB 4AS1A 1V8CA 3O0EA 1WJNA 2W82A 3WANA 1T6BX 4IG7B 1IGCA 3MHSD 7PRNA 1TT5B 4AYID 3RUIB 4E71A 5AZFA 2L00B 3AA0A 2JYEA 1N62A 4IM2A 2PJHA 5H2FO 2F1VA 3UI3A 1MI0A 1TIFA 2ERVA 4LJOB 1V6EA 1WR1A 1J19A 1C78A 4GCSA 2CU1A 1YJJA 4NJ6A 1XQQA 3DWGC 1KLUD 2JX5A 2WXLA 2WDTB 3I57A 1ZGUB 3EUB2 4MGYE 1C1YB 4PT5A 4O4XA 1MG4A 4CQNA 1TKEA 1WH3A 2I1KA 3RBHA 2BYVE 4RLBA 2C60A 4YSYB 3B0AA 2MQJA 2PVOD 2INCC 1TYGB 3DHIC 4IDIA 3WCQA 1T5XD 2GBJA 2PORA 3KZIO 2R4LA 1GNUA 3BVMA 3P2BA 3R3MA 4W9KA 4WAAA 3M62B 2KKCA 2AL6A 1E90A 3ZTCA 3GP7A 3EMNX 1CQVA 5GTHO 4KKJA 1OQYA 1I35A 3WA0A 3IFWB
chains in the Genus database with same CATH topology
3C8YA 4G76A 3NVVA 1BXTA 2I2YA 1QOGA 3VQIA 2BYTA 4MT5A 2WXOA 1BH3A 5H8YE 4FSPA 2YEPF 1VJKA 4HEA1 1XF5L 1FD6A 4A55A 3FYXA 1FRRA 5FR3A 1CJEA 3P63A 2WXKA 1SSNA 2CU3A 4LSEA 4AYMC 5I4DA 2L1AA 4B0EA 1DOXA 1KRHA 3SY9A 1SE4A 3DA4A 3P1MA 1ZDXA 1ZHXA 3EA6A 3PQUA 2E3TA 1KLGD 4O1NA 1QOBA 2XNAC 1C76A 5DL7A 3NSGA 2JMMA 1ZDVA 3LK42 2K4TA 3DWMA 4HROA 2LFUA 2DYMA 3U2SC 3GP6A 4XWTA 1JALA 1NVID 1PGAA 2WNMA 3AM9A 4RF0A 4P16A 1BMLC 2DBYA 2N0SB 2NMQA 2ZW0A 3V3XA 3LK2A 2J4UP 3P4RB 1QQRA 2JZPA 3HOLA 1YN5A 5FKAC 1GPXA 1F77A 4D5UA 1TY0A 1FNVA 3AE5B 3AA1A 1E54A 3LYYA 1AWDA 1F2RI 2FGRA 2IPKD 2Z8LA 3AEAB 3AA6B 2X27X 4RJXA 1TS2A 4E1SA 1UWMA 2JQRB 3BZDB 1HXXA 2WXHA 3GB1A 3SR6A 2MJDA 4A9AA 3H8HA 1CK1A 1ORMA 1BXWA 1FXAA 3W2DA 1FM0D 1J7AA 5AUIA 3NVWA 3O13A 3AEEB 3URYA 1F0ZA 2LHDA 4BUMX 4C80A 4JX1C 4RGOS 2BS2B 5BYRA 2RDHA 4Z3TA 3NVZA 2K5PA 1SJED 2ICIA 6PRNA 4AKMA 2IDYA 2RPVA 1PHOA 3KWLA 2Y5CA 1I4HA 2WXNA 3KWVA 4WQMA 1MVKA 4ZHOA 1T3QA 2I38A 5HHDG 4ZYSA 4RLCA 5EE9A 5D5DA 2LJIA 4FXCA 1FFVA 4USAA 1XLOA 1VZ7A 3WI4A 3KQ4A 1SB3C 3TZGA 1VRAB 2QSDA 3AB5A 3JTYA 1HXUA 1N60A 2BTEA 3TEYA 1GB1A 1QT9A 2M19A 3GS2A 1PDXA 1TS5A 1YN4A 4LLGM 3AEFB 1E6EB 4XNKA 3R8BA 2WDQB 2KC0A 1PRNA 3AH7A 3MHZA 1SBBB 3BIID 2W80C 2MJEA 3OWEB 4C7YA 1DOYA 1YJIA 4FESA 1G90A 2LFIA 2OHFA 2E6XA 4KKIA 1V1OA 3VZWX 2YEPB 5JXVA 2V3NA 4NAWB 4N6EB 4C69X 2K22A 1JQ4A 4LSFA 4FUVA 1SIJA 3G7GA 2W55A 2F1TA 4XDCA 1TZOA 2M06A 2HTME 4XDDA 4JFBA 1WYGA 2ZW1A 2Y5PA 3P4SB 2PMVA 2SAKA 4M0WA 3SYBA 1OQRA 1XEEA 1JWAD 1HZ6A 1PUTA 3SZDA 3AE2B 1XO3A 4FOZA 3R2TA 4OVZA 2JU6X 3LK41 1HQRD 1I4QA 2PTLA 4LTUA 5HG2A 2IJ0A 1IBXA 2IGDA 1AN8A 2QTKA 2H89B 2O4VA 4D64A 2KACA 4HKZE 3POUA 1BT9A 1XXGA 3IT6B 2ZFGA 3POQA 3LXFA 2BB6A 5IYUA 3W5VB 4TQ1A 1NEKB 1E7PB 1ET9A 1RYJA 4AZLA 1WSPA 3T24A 2PW9A 1JMLA 3T0SA 2MEKA 1GB4A 3U52E 1C4CA 1E10A 1Q9GA 1EWYC 3TEZA 1FCLA 1ENFA 2KZ7B 1WXQA 1I4PA 2INPE 5TSSA 5ADXL 1PGXA 1HEZE 3HW9A 3VRAB 1HXTA 2M07A 4AKRB 1NENB 2LEKA 1J7BA 2N9KA 5GV0A 1N63A 4N59A 1SF0A 4LSIA 4PUXA 1IGDA 3KLSX 3MC0B 4A6QA 3AMZA 3LK3A 5GXGB 1RFKA 2PKOA 4YSZB 3PZ7A 1N5XA 4ARIA 4GDLB 4WIPA 1OPFA 1A70A 1IZNA 2R61A 2W81C 2WXPA 4DQOC 4AYDC 1ZPSA 4P6VF 4KGRA 5G5HA 3VY8X 4YWGG 4RCOA 5BMHA 2FUG1 1PFDA 4G75A 2JXTA 2Q5WD 5EE2A 1UWXA 2YPVA 1ZUD2 2WXRA 1FIQA 1TJEA 2ACZB 3B2GA 3IAS1 4O4UA 1YNTE 1VLBA 4AUIA 4D65A 2G9HD 3Q8EA 2AX5A 4JWUC 5EE3A 2KN4A 3RFZB 4ZHPA 3TEWA 3ZJTA 2GB1A 2D5GA 3HRDD 3WI5A 1B9RA 5FVNA 3SY7A 2N7JA 1FRDA 3LK2B 4E1TA 2IGHA 2KQ4X 3IAM1 5FK9C 2YNKA 3Q8BA 1Q9FA 3AA1B 1I4GA 4MM3B 5C2TB 3VE2A 3V05A 2HDEA 1EU3A 5ADXK 2OMFA 5AFUK 1QJPA 2M56B 3P4PB 3HVZA 1PYWD 2VZKB 3ZGZA 1KTKA 1JWMD 1K52A 2XG6A 1MM5A 4FMSA 1L4DB 2NTTA 2WDVB 2WP9B 1NI3A 2G1EA 2WXQA 3LB8C 1Q10A 2INNE 3PZ8A 3A2SX 3V8UA 4HJGE 5DL5A 2ONQA 4YTPB 1GAQB 1HZ5A 3RPFC 3ETRA 5HFYA 3W5UB 5DL6A 1KFYB 4TSSA 2XTQA 1SE3A 1QJ8A 3FAHA 3VZTX 2QILA 3SYSA 2WXMA 4WH4A 1SEBD 2LGIA 3NUHB 2WS3B 3BVGA 4AYEC 1GFQA 2JYTA 4LSHA 3TSSA 1KF6B 1VDVA 1XCTL 5HI1A 4OZAA 1C4PA 1XLPA 2VZKD 1TS3A 3HUIA 5JDPA 1UNSA 3BK1A 5G5GA 1QJ9A 1HXYD 2PVGC 1QLBB 4ZOHC 3W9CB 5PRNA 3VR9B 3Q8AA 4DXGA 4XNLA 2KXPA 4LK0M 4US8A 4O3ZA 2LUMA 1GFNA 4RH6A 3PORA 1JW9D 4OW0A 1FNUA 2V4IB 4KR4A 4OZBA 4RGNA 4WAFA 2GI9A 1D5XC 1ZHWA 2N2MA 1EWCA 2MHLA 3BK2A 4L2YA 2BS3B 3MFGA 2N9LA 3QRAA 3FILA 2X38A 4L23A 4KR8A 1JCKB 1RWSA 1UGJA 4GLSC 4RGTA 5BYSA 1N61A 3AAAA 1ZHTA 1NYQA 1QF6A 2XE1A 1ET6A 2JSVX 2PIAA 1QOFA 5AUKA 1MPEA 2Y7SA 3NRZA 5D7GA 1TS4A 3ABVB 4REZA 3E56A 1EM7A 2OEDA 3AE9B 1V1PA 5H92C 3DA3A 3VE1A 1CZPA 1V1PB 3EGRA 2V0GA 1P7EA 3Q69A 3R2IA 1L0VB 1DGJA 3MP9A 2J52A 2EKIA 5EE0A 4O49A 1EU4A 2XMXA 1UUPA 2WXFA 2AQ1B 1V97A 4MACA 1L5PA 3FC4A 1IBXB 3SFDB 4DXFA 1JWUD 4US9A 5D3IB 3VR8B 4JE3B 2BBCA 1E9MA 2GE4A 1ESFA 1KH0A 2DWQA 1YQ3B 3AEDB 5C3JB 3MJ5A 4OZCA 1ZHYA 3QRCA 1BUIC 1FMAD 1VR9A 4IKGA 1MPFA 3AE6B 1NYRA 4FRTA 4GCPA 3UPGA 1THQA 5AFUL 2QIEB 1K50A 3AECB 2Y2XA 1D5ZC 4ITKA 2FE8A 1L6VA 4TMAB 2WU5B 3AE4B 4TQ0A 2BW2A 3ZQ4A 3T3OA 4UDUC 3LK3B 4MH8A 3U7ZA 2Y3AA 1HA5A 4GDKB 2ZLDA 1IUEA 2FGQX 2QMTA 2PRNA 3PO0A 1IZNB 1JROA 1K51A 2KWDA 1OFFA 3AAEA 3AAEB 1GFPA 2J4XA 1FNWA 2AQ2B 4NAMA 2L32A 2KDYA 3HOEA 5MPOA 1K53A 1RM6C 1OSMA 2QJLA 2WLBA 2FBWB 1R7SA 4J3OD 1L4ZB 1YN3A 1XLQA 2L52A 3CIRB 2CJOA 4XWWA 3VZUX 1QOAA 3ZJVA 3BWUD 2AQ3B 3TUOA 1L0YB 5T5FA 3NVYA 2WQYB 1QKZA 4NZLB 3AE3B 2V3PA 3AE1B 4KRAA 2L83A 2CJNA 3P4QB 5LNK1 4NJCA 4YTMB 4AQ7A 2QEJC 1I4RA 1VZ6A 4L1BA 1P4TA 3W1SA 1FEHA 4B0MA 5EE1A 1D6EC 2XE3A 4RNAA 1FFUA 3UAQA 4D2KA 3SFEB 4FZMA 4O3YA 4O3XB 1ZE3D 3P42A 4XE0A 1D4BA 4OHJA 2J53A 3CWIA 4FZLA 5BMIA 4ARCA 1J7CA 3N9YC 3POXA 2K9XA 4Q2JA 4HRSA 4F4BA 1ACCA 2B76B 1GFMA 1ZXHA 3PQSA 2ODJA 4RJWA 1JRPA 1YMHE 4N58A 4U9CA 1FCCC 4H2AA 4B61A 1SJHD 2WU2B 3C5OA 2Y0KA 3IXSA 3VY9X 3E9SA 1MHHE 5E6JA 4RL9A 5DL8A 2BS4B 3AA6A 1L0XB 2KAJA 2KMMA 3AV8A 4C56C 1C9FA 1SE2A 2PLPA 4AFKA 3T3NA 4FRXA 1I7HA 1ROEA 2J42A 3HVDA 8PRNA 3AE8B 2RMMA 1TKYA 3Q8CA 4JPSA 3ZJUA 3L4PA 3T20A 1JWSD 1VZ8A 2DYOA 3ZYYX 2XTRA 3Q8FA 4KGSA 4YT0B 1P7FA 3AE7B 4WWMA 3UU2A 2JWUA 4RGMA 2KXPB 1C4AA 2WXIA 1WWTA 2IGGA 4FZNA 2ON8A 2K0LA 2SEBD 5T8IA 4O3WA 4RF1A 2WXGA 4AS1A 3BYYB 1V8CA 3O0EA 2W82A 2Y0HA 1WRIA 2K0PA 3I9V1 4WURA 3NZ3A 2NTSA 1GFOA 2BB5A 1T6BX 3VRBB 3FILB 1GOZA 1ZXIA 4AYNA 1B1ZA 1IGCA 1XCQL 2LHEA 4A90A 2RDGA 1SXTA 3AAAB 7PRNA 1H6S1 2M0AA 4KGTA 4AYID 1C77A 2MH7A 2WDRB 4JWSC 1JWBD 3B9JA 4GHBA 3NS1A 3AA0A 3AA0B 2JYEA 4R3DA 1N62A 4C7ZA 2LMCA 4YXDB 1MHXA 4FSOA 4KX6B 3TEXA 4ZRQA 2F1VA 3UI3A 1XLNA 1MI0A 1OQQA 1Y56A 1D5MC 2ERVA 1N5WA 2GRIA 2K3UA 1AYFA 2BT6A 1L6UA 2W54A 1E0ZA 1C78A 3HWBA 4GCSA 2TSSA 3U4EG 1YJJA 4YSXB 3DWGC 2KDMA 1KLUD 1I4XA 2JX5A 2WXLA 5BMGA 3I57A 4IOIE 4FT6A 1M4VA 3EUB2 3AN1A 4EE2A 4PT5A 2DLBA 2EELA 4O4XA 2W3SA 3AEGB 4RFBA 1DYQA 4CQNA 1STEA 2MJ3A 4GF4A 1DOIA 3KVDD 1TKGA 1TKEA 1FXIA 3BVZA 2J1NA 2XE2A 3RBHA 2N2LA 1WGKA 5G26A 4RLBA 1F2RC 4QQ1A 1AW7A 4YTNB 2XN9C 4YSYB 3PRNA 3IT4B 3J9CA 2MNHA 2W3RA 2PVOD 3BYTB 1TYGB 3WCQA 4IDIA 4ZRPA 1YQ4B 4GCQA 1T5XD 2PORA 2H88B 3BVMA 2LHFA 2Y0LA 1PGBA 5D3DA 1C79A 4JCHA 1TY2A 3AEBB 1FO4A 2KZ7A 5BYQA 2WXJA 4AKRA 3AA7A 3AA7B 1LO5D 1ZHZA 3EMNX 3K19A 3GP7A 1CQVA 1ZP0B 1YS5A 4KKJA 2XE5A 1ZOYB 1MM4A 4A8XC 3SZVA 3SEBA 3B2FA 1QILA 4HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1JWA D;  4G76 A;  1PUT A;  3NVV A;  4N58 A;  1QOG A;  1XO3 A;  3AE2 B;  2WU2 B;  4LTU A;  2BS3 B;  5H8Y E;  1VJK A;  2BS4 B;  2KAJ A;  2H89 B;  3AV8 A;  2KMM A;  1FRR A;  1RWS A;  3W5V B;  1CJE A;  3LXF A;  3P63 A;  1NEK B;  1I7H A;  1E7P B;  1ROE A;  1RYJ A;  1N61 A;  2CU3 A;  3AE8 B;  1NYQ A;  1TKY A;  1DOX A;  1KRH A;  2PIA A;  3L4P A;  1E10 A;  3DA4 A;  1EWY C;  1QOF A;  3P1M A;  5AUK A;  3ZYY X;  1WXQ A;  2XTR A;  3NRZ A;  3ABV B;  4YT0 B;  3AE7 B;  2E3T A;  1NEN B;  4WWM A;  1QOB A;  2LEK A;  3VRA B;  4HRO A;  1J7B A;  3DWM A;  1N63 A;  3AE9 B;  4N59 A;  1SF0 A;  1WWT A;  3DA3 A;  4FZN A;  1JAL A;  1CZP A;  1NVI D;  5H92 C;  3AM9 A;  3AMZ A;  5GXG B;  2DBY A;  1L0V B;  1DGJ A;  2N0S B;  1RFK A;  3RPF C;  3P4R B;  2EKI A;  2PKO A;  1V8C A;  5EE0 A;  4YSZ B;  1GPX A;  1N5X A;  3AE5 B;  2XMX A;  1A70 A;  1WRI A;  1V97 A;  1AWD A;  1L5P A;  3FC4 A;  3SFD B;  4P6V F;  4JWS C;  3AEA B;  4US9 A;  3VRB B;  3VR8 B;  5G5H A;  1ZXI A;  1E9M A;  2DWQ A;  1UWM A;  1YQ3 B;  2JQR B;  3AED B;  5C3J B;  1PFD A;  4G75 A;  2Q5W D;  3SR6 A;  2MJD A;  1ZUD 2;  4A9A A;  2MH7 A;  1FIQ A;  1FMA D;  1TJE A;  2ACZ B;  1JWB D;  2WDR B;  3AE6 B;  1FXA A;  1NYR A;  3B2G A;  1FM0 D;  3B9J A;  1VLB A;  3NS1 A;  5EE3 A;  2AX5 A;  4JWU C;  4YXD B;  2QIE B;  1N62 A;  4C7Z A;  1J7A A;  3AEC B;  3NVW A;  5AUI A;  4ITK A;  4ZHP A;  1L6V A;  3AEE B;  4KX6 B;  1F0Z A;  2WU5 B;  3AE4 B;  3HRD D;  4C80 A;  1XLN A;  1OQQ A;  2BS2 B;  4JX1 C;  1B9R A;  3NVZ A;  1FRD A;  1N5W A;  2K5P A;  1IUE A;  1AYF A;  2BT6 A;  2Y5C A;  1L6U A;  2W54 A;  3KWL A;  1E0Z A;  3PO0 A;  1JRO A;  4WQM A;  4ZHO A;  1OFF A;  1T3Q A;  1YJJ A;  5C2T B;  4YSX B;  3DWG C;  5EE9 A;  2JX5 A;  4FXC A;  1RM6 C;  5MPO A;  1FFV A;  4USA A;  2QJL A;  2WLB A;  1XLO A;  2FBW B;  1R7S A;  2M56 B;  1SB3 C;  3EUB 2;  3HVZ A;  3P4P B;  3AB5 A;  3AN1 A;  1QF6 A;  1XLQ A;  1N60 A;  2WDV B;  2WP9 B;  1NI3 A;  3AEG B;  2G1E A;  2L52 A;  2W3S A;  3CIR B;  3LB8 C;  1QT9 A;  2CJO A;  2M19 A;  1QOA A;  2MJ3 A;  1DOI A;  1PDX A;  1TKG A;  1TKE A;  3NVY A;  1FXI A;  4YTP B;  2WQY B;  1GAQ B;  3AEF B;  3AE3 B;  1E6E B;  3AE1 B;  2L83 A;  3ETR A;  2CJN A;  2WDQ B;  1WGK A;  3P4Q B;  3AH7 A;  3W5U B;  1KFY B;  2XTQ A;  4YTM B;  3FAH A;  3BII D;  4C7Y A;  4YTN B;  2MJE A;  1DOY A;  4YSY B;  1YJI A;  2OHF A;  2W3R A;  2PVO D;  3WCQ A;  1TYG B;  4IDI A;  2WS3 B;  5EE1 A;  1YQ4 B;  1FFU A;  2H88 B;  4N6E B;  3SFE B;  4FZM A;  2K22 A;  1JQ4 A;  1KF6 B;  1VDV A;  3AEB B;  1SIJ A;  1XLP A;  1FO4 A;  3CWI A;  4FZL A;  3HUI A;  2W55 A;  5G5G A;  1J7C A;  2PVG C;  4ZOH C;  1QLB B;  3W9C B;  2HTM E;  3VR9 B;  2K9X A;  1ZP0 B;  1WYG A;  4US8 A;  4HRS A;  1ZOY B;  2B76 B;  1JW9 D;  3P4S B;  3B2F A;  1OQR A; 
#chains in the Genus database with same CATH topology
 2R89 A;  4G76 A;  3DOW A;  3NVV A;  5CX3 A;  4UB8 O;  4I6N B;  4GDL A;  5TIS O;  1BH3 A;  3HM6 X;  2YEP F;  1N6Z A;  3QC8 B;  1FPY A;  2BKF A;  4A55 A;  3P63 A;  3PT2 B;  4KSL C;  4AYM C;  2L1A A;  4B0E A;  3SY9 A;  3VH3 B;  1R4M B;  4BVU C;  3DWN A;  1ZHX A;  3EA6 A;  2R88 A;  3PQU A;  2XNA C;  1IYF A;  1C76 A;  4JLC A;  5DL7 A;  2OJR A;  1JAL A;  2WNM A;  2M17 A;  4RF0 A;  2DBY A;  5G38 A;  1F77 A;  1VD2 A;  1E7U A;  3ZNG C;  1QZE A;  2WGS A;  2Z8L A;  2LGY A;  4K81 A;  2C7H A;  1UZX B;  3H8H A;  1CK1 A;  1ORM A;  1FXA A;  3W2D A;  3I5J C;  3BRZ A;  2KFK B;  4N74 A;  2FID A;  2GMI C;  3ZIM A;  3CSF A;  3AXC A;  2WJQ A;  2BS2 B;  3A9J A;  5BYR A;  3NVZ A;  1SJE D;  6PRN A;  1PHO A;  4WJN A;  2F1C X;  4GXB A;  2ZPY A;  5B5E O;  1FFV A;  2K1F A;  1XLO A;  2KTR B;  5KHO A;  2QSD A;  3AB5 A;  2XEW A;  3JTY A;  2DX5 B;  2WX0 A;  1QT9 A;  3GS2 A;  2LRU A;  2W80 C;  3OWE B;  2JY6 A;  2OHF A;  3O65 B;  3PSE B;  3WIM A;  3UQA A;  2YEP B;  2N1V A;  2WWZ A;  4BKS A;  4W9G A;  2K22 A;  2KX3 A;  4FUV A;  3VTW A;  4K3B A;  1UH6 A;  2F1T A;  4XDC A;  1UEL A;  2X8X X;  1R4M I;  5DCN A;  4JFB A;  2Y5P A;  1G6J A;  2PMV A;  3A1Q A;  1XEE A;  1OQR A;  3LDZ E;  3AE2 B;  3R2T A;  5D94 A;  2JU6 X;  3LK4 1;  2ZVN A;  4RM9 A;  5AEK B;  3ML8 A;  4HKZ E;  3UF8 A;  1BT9 A;  2ZFG A;  1WZ0 A;  4II2 B;  1E7P B;  1RYJ A;  2C5L C;  1WSP A;  3T24 A;  1JML A;  3T0S A;  2MEK A;  2O6V A;  1FCL A;  2KZ7 B;  3M95 A;  5ADX L;  3I63 C;  3HW9 A;  4AKR B;  3JSV A;  2I1J A;  2N9K A;  2MCN B;  5IAA C;  2FNJ B;  4W9C A;  1KM7 A;  1E7V A;  2FCM A;  3AMZ A;  3RD2 A;  3Q3M C;  4GDK A;  2PKO A;  3ONS A;  3HHM A;  3RCZ A;  1OPF A;  1A70 A;  4DQO C;  4AYD C;  1PQS A;  4KGR A;  5G5H A;  4YWG G;  4DWF A;  2KHW B;  2FUG 1;  2K6D B;  3SU8 X;  5EE2 A;  1UWX A;  2KWC A;  3IBE A;  3NY5 A;  1FIQ A;  3DBL B;  1ZKH A;  1VLB A;  3L0W B;  4DHJ B;  3Q8E A;  2BWF A;  2AX5 A;  1RRB A;  3RFZ B;  3PGR A;  3HRD D;  3H7P A;  4GMV A;  2BGF A;  2NS5 A;  3DVG Y;  2JXX A;  3LK2 B;  4II3 B;  2MP2 B;  2M4N A;  3ZXR A;  1Q9F A;  5C2T B;  2CHW A;  2HDE A;  3ZNI D;  2RR9 A;  2KC2 A;  3P4P B;  1KTK A;  2XG6 A;  1Q5W B;  2KQS A;  1TZ1 A;  1WGR A;  3LB8 C;  5CTR C;  5DL5 A;  3RI7 C;  4YTP B;  4GB9 A;  1HZ5 A;  3RPF C;  3W5U B;  4W9D A;  2XTQ A;  2WXM A;  3ECI A;  4K1R B;  3NUH B;  3HK0 A;  3APC A;  4S17 A;  5HI1 A;  1TS3 A;  2PVG C;  2JF5 A;  3WU2 O;  2M0X A;  4XGA B;  4XNL A;  2KXP A;  4LK0 M;  4HK2 A;  1JW9 D;  4OW0 A;  4RGN A;  4WAF A;  3N30 A;  2K6Q A;  1D5X C;  5C23 A;  3N32 A;  4C4V B;  5GMV A;  1HE8 A;  2R2Q A;  3DQV A;  5JHA A;  4FUL A;  5BYS A;  1N61 A;  1NYQ A;  2HJ8 A;  2KK8 A;  5D2M B;  3NRZ A;  2KJH B;  4WWO A;  4KDI C;  3ZUN A;  3DBL I;  1RLF A;  3DBR B;  3AE9 B;  4B95 A;  1V1P A;  3R2I A;  1L0V B;  2EKI A;  4O49 A;  3WAP A;  1UUP A;  2WXF A;  4US9 A;  2ZPN A;  4JE3 B;  1YQ3 B;  2L0F A;  2NPT A;  3JYU A;  2KC1 A;  4IKG A;  5L95 C;  3AE6 B;  4HVB A;  1NYR A;  2R8A A;  3UPG A;  5KHQ A;  5AFU L;  3AEC B;  4ITK A;  2XBB C;  1IPG A;  4TMA B;  2DZJ A;  4W9L A;  3T3O A;  3LK3 B;  2Y3A A;  1HA5 A;  2ZLD A;  2FGQ X;  2KWD A;  4P1B C;  1EF1 A;  2AQ2 B;  1WM3 A;  2KDY A;  3KW5 B;  3HOE A;  1RM6 C;  2FBW B;  2O6V D;  1R7S A;  4WJO A;  3VXW A;  3DWO X;  3EFU A;  2L52 A;  2QC8 A;  1TGZ B;  1S1Q B;  2KDI A;  4EZK A;  1KJT A;  2AQ3 B;  1QKZ A;  2LXC A;  4KRA A;  2CJN A;  1WGH A;  4F1S A;  4CHK A;  1NI2 A;  3NZS A;  1WJ4 A;  2AEH A;  3RT3 B;  1D6E C;  4RNA A;  1FFU A;  2Z0E B;  1ZE3 D;  3P42 A;  4XE0 A;  4OHJ A;  1YX6 B;  3D32 A;  1J7C A;  2CS4 A;  3RNF C;  2D3B A;  4HRS A;  1J0G A;  1GFM A;  1ZXH A;  5J2R A;  3DBR I;  1FCC C;  4H2A A;  1Z2M A;  3C5O A;  2LUE A;  2BS4 B;  2J0K A;  1L0X B;  3PLV A;  3H1U A;  2AWT A;  2PLP A;  4HDQ A;  3APF A;  2EMS A;  1ROE A;  2KNB A;  3PF1 A;  3AE8 B;  3L4P A;  3T20 A;  2XTR A;  1P7F A;  4IW0 A;  2MX2 A;  4RGM A;  5E79 O;  2IGG A;  4FZN A;  2K0L A;  2MBB B;  4IWP A;  4O3W A;  3GE8 C;  2WXG A;  2MLB A;  4P7I A;  5IN7 A;  2FCN A;  2NTS A;  1GOZ A;  2LHE A;  1XCQ L;  2KWU B;  3QCA A;  2M0A A;  3WAM A;  2MH7 A;  4WWN A;  4QAY A;  1JWB D;  2MHJ A;  5LLI A;  3B9J A;  4GHB A;  1EUV B;  3AA0 B;  2LMC A;  5DPR A;  4AUQ C;  4KX6 B;  4K7W A;  2LRW A;  3TEX A;  4ZRQ A;  5GTI O;  2K3U A;  3OJ4 B;  4FHJ A;  1L6U A;  3BS0 A;  4NAW A;  2TSS A;  2ZNV B;  3U4E G;  3L13 A;  5BMG A;  2WJR A;  1P9D U;  1LQB A;  2IO2 B;  4EE2 A;  5HKH A;  3VFK A;  4URK A;  3CST A;  2W3S A;  4NY0 A;  4NQL B;  4S0R A;  2KDB A;  1STE A;  5D6J B;  3RNE C;  3L08 A;  3KVD D;  3ZKJ C;  3L16 A;  3T8M A;  4EOY A;  1WGK A;  2N2L A;  3VUY A;  1WE6 A;  3IT4 B;  4G50 A;  3QK0 A;  4ZRP A;  2KXJ A;  2LHF A;  5D3D A;  1C79 A;  4JCH A;  1TY2 A;  5IO9 A;  2L3Z A;  1FXT B;  1LO5 D;  1ZP0 B;  2D11 A;  4BAX A;  1QIL A;  4HKQ A;  2V1Y A;  1CMX B;  3C8Y A;  1R4N B;  2AL3 A;  2I2Y A;  1QOG A;  4MGZ E;  1XF5 L;  1FD6 A;  4HPP A;  4FAD A;  5CHV C;  3PPA A;  4DHZ E;  1CJE A;  4KIK A;  1WXA A;  2DYB A;  1UGM A;  1WXS A;  4FN2 A;  1ZDX A;  3VAW A;  1KLG D;  2BPS A;  3QA8 A;  3TJP A;  1H8C A;  3DWM A;  2K4T A;  2LFU A;  2DZK A;  2MW5 A;  1PGA A;  3AM9 A;  2NMQ A;  3V3X A;  2J4U P;  1QQR A;  5FKA C;  3W1S C;  2FIF A;  4D5U A;  5G3A A;  3N1Y C;  3NJT A;  1AWD A;  2FGR A;  3PLU A;  2M8S A;  4E1S A;  2JQR B;  3CMM B;  1HXX A;  2WXH A;  3GB1 A;  2MJD A;  3S2A A;  4A9A A;  5C1Z A;  1FM0 D;  3V60 A;  1J7A A;  4LNF A;  3O13 A;  3RN9 C;  3URY A;  1F0Z A;  4BUM X;  3MC8 A;  2D3A A;  4RGO S;  1IP9 A;  5J17 A;  2IDY A;  4AKM A;  2ZZP B;  2KT7 A;  1I4H A;  2RSU A;  3KWV A;  4WQM A;  3JVZ X;  2I38 A;  4ZYS A;  5EE9 A;  1J8C A;  1VZ7 A;  4ANU A;  2JZZ A;  3TZG A;  1N60 A;  1A5R A;  3TEY A;  1TS5 A;  2KFJ A;  2IWW A;  4LLG M;  5G55 A;  2WDQ B;  1PRN A;  3AH7 A;  4XC2 A;  3MHZ A;  1R4N I;  1SBB B;  3BII D;  1WGY A;  3U8Z A;  2CR5 A;  2O2V A;  1DOY A;  1YJI A;  3X0W A;  2D10 A;  1V1O A;  3PVL A;  2L8J A;  3PRM B;  2OOB B;  1E8X A;  5JXV A;  4IM3 A;  3UIP B;  3DPD A;  4A3O A;  2V3S A;  1YJ1 A;  1JQ4 A;  3KUD B;  4GSW A;  3DVG X;  2M06 A;  2HTM E;  4M00 A;  3AUL A;  2DNF A;  2HE7 A;  2RGF A;  3PV1 A;  3MJW A;  2SAK A;  4M0W A;  2ZJD A;  1HZ6 A;  3N20 C;  1XO3 A;  4FOZ A;  2PTL A;  5HG2 A;  1IBX A;  4LNO A;  2QTK A;  2H89 B;  1XXG A;  3TIX A;  3W5V B;  3EEC A;  3LXF A;  5L83 A;  1S3S G;  4TQ1 A;  1ET9 A;  3DZM A;  2GOW A;  1GB4 A;  1C4C A;  1E10 A;  1Q9G A;  1EWY C;  3TEZ A;  2QDF A;  1GC6 A;  2HD5 B;  1WXQ A;  5TSS A;  2LGD A;  2LEK A;  5DPS A;  4N59 A;  1SF0 A;  4LDT D;  1RFK A;  3LJ3 A;  3L10 B;  4LNI A;  3PZ7 A;  1IZN A;  2R61 A;  4FBJ B;  2W81 C;  2RDB C;  4WJP A;  2PE9 A;  3VY8 X;  2EKE C;  1L2N A;  1MJD A;  3L54 A;  2K39 A;  2ACZ B;  2KQ7 A;  3DDC B;  4O4U A;  1WMH B;  1YNT E;  4ANV A;  5J18 A;  3PGE A;  1EO6 A;  5AZG A;  1GUA B;  2D5G A;  5TR5 A;  2MBQ A;  3B08 A;  3SY7 A;  2N7J A;  4DBG A;  4E1T A;  2KQ4 X;  3Q3F A;  3AA1 B;  2V4L A;  4MM3 B;  1EU3 A;  3MC9 A;  2L05 A;  5AFU K;  1WF9 A;  2M56 B;  1P98 A;  3ZGZ A;  1MM5 A;  2IO3 B;  2WDV B;  2WP9 B;  1NI3 A;  5CHW A;  2INN E;  3A2S X;  3OG5 A;  1V86 A;  3DHG C;  4KDL B;  2DHZ A;  5JH5 C;  3ETR A;  5HFY A;  4TSS A;  1SE3 A;  1QJ8 A;  3FAH A;  4EFO A;  3SYS A;  5EDS A;  2OJW A;  4AYE C;  2L76 A;  1GFQ A;  2JYT A;  1KF6 B;  2VZK D;  3N3K B;  3HUI A;  1WXM A;  1HXY D;  3TBL D;  3W9C B;  3VR9 B;  3Q8A A;  4US8 A;  2ZCB A;  2LUM A;  3POR A;  5KAF O;  1E8W A;  1FNU A;  4WJQ A;  3ZNZ B;  2KVR A;  2GI9 A;  2N2M A;  3BK2 A;  5DPT A;  2HJ1 A;  3MFG A;  3QX1 A;  4L23 A;  4KR8 A;  1JCK B;  1UGJ A;  2JRH A;  4GLS C;  2B3A A;  4HJK A;  2PPH A;  2JSV X;  2PIA A;  2LXA A;  1MPE A;  2Y7S A;  2MSE D;  2NR2 A;  4REZ A;  2D3C A;  1SE9 A;  2NBW B;  1P1A A;  2JZ3 B;  3Q14 C;  3DA3 A;  3VE1 A;  1V1P B;  3TL5 A;  5FR6 A;  3ZTD A;  2UWQ A;  1P0R A;  1L5P A;  3FC4 A;  2GBM A;  1KH0 A;  4OZC A;  5JZE B;  2LVQ A;  3GZN B;  1V5O A;  4EZJ A;  1THQ A;  4IUM B;  2QIE B;  1K50 A;  2N7E A;  1L6V A;  2CHX A;  2BW2 A;  4UDU C;  3U7Z A;  3B1L X;  3DVN U;  1JRO A;  2LZ6 A;  1GFP A;  3QWZ B;  3T9L A;  1OSM A;  4F7Z A;  2QJL A;  2WLB A;  4OVU A;  2G4S A;  1XLQ A;  2CJO A;  4XWW A;  1QOA A;  3BWU D;  3TUO A;  2DZI A;  2J0J A;  4FA6 A;  4EEW A;  4YTM B;  4AQ7 A;  4IL6 O;  1VZ6 A;  3W1S A;  1WJU A;  3A9K A;  3SFE B;  2LGS A;  4O3X B;  3VTV A;  1D4B A;  2J53 A;  2JT4 B;  4BBN F;  1WX8 A;  4ARC A;  2IND C;  3N9Y C;  5CHF A;  1Y8R C;  1ACC A;  2RD0 A;  3V61 A;  1JRP A;  3NS8 A;  1GC7 A;  4MJS B;  4K7U A;  3IXS A;  3E9S A;  5DL8 A;  2KAJ A;  1E5W A;  2KMM A;  1SE2 A;  3UQB A;  4AFK A;  4FRX A;  3IVF A;  3PS6 A;  3RUL A;  3NZU A;  1VZ8 A;  2XK5 B;  2LD9 A;  3GZN I;  2KFK A;  2JUO A;  3UU2 A;  2JWU A;  1WWT A;  2ON8 A;  5AZH A;  1VCB A;  2SEB D;  2GBK A;  4PS7 A;  4RF1 A;  4LJP B;  2Y0H A;  1WRI A;  3ALB A;  4WUR A;  3NZ3 A;  4AJW A;  1GFO A;  2BB5 A;  2D3G A;  3FIL B;  4AYN A;  1JRU A;  1F9J A;  4A90 A;  2RDG A;  1T16 A;  1SXT A;  2LGX A;  3RZF A;  3AAA B;  1H6S 1;  4JWS C;  1WXV A;  3L17 A;  4YXD B;  4R3D A;  4C7Z A;  2C7N B;  2NCN A;  2KD0 A;  1UBQ A;  1XLN A;  1OQQ A;  1Y56 A;  2BYF A;  4PYU A;  4W9I A;  1N5W A;  4G0N B;  1UF0 A;  1AYF A;  2BT6 A;  3OAW A;  3HWB A;  1WM2 A;  1HTQ A;  4FT6 A;  3VUW A;  2N1W A;  3AN1 A;  2DLB A;  2EEL A;  4RFB A;  1DYQ A;  2KJR A;  3SD5 A;  4UB6 O;  2MJ3 A;  1DOI A;  1TKG A;  1FXI A;  3BVZ A;  2J1N A;  2XE2 A;  2N4F A;  5G26 A;  1AW7 A;  2XN9 C;  2MNH A;  2W3R A;  3BYT B;  2G45 B;  1WY8 A;  2H88 B;  2Y0L A;  2DAJ A;  2QCZ A;  4GOC A;  1WR6 E;  2KZ7 A;  2WXJ A;  4BOS C;  2IO0 B;  4AKR A;  3AA7 A;  1ZHZ A;  3K19 A;  3AU4 A;  3ENE A;  2C9W B;  3SZV A;  3SEB A;  3R7R A;  3ML9 A;  1ISN A;  3VQI A;  2WXO A;  1E8Y A;  1VJK A;  3FYX A;  1FRR A;  4MGI E;  2WXK A;  1SSN A;  2CU3 A;  2VH2 A;  3GOE A;  4EUT A;  2NVU I;  1SE4 A;  3DA4 A;  3P1M A;  1V80 A;  3UIO B;  1QOB A;  3ZW3 A;  3LK4 2;  3GP6 A;  4XWT A;  1NVI D;  1RAX A;  2REX A;  2N0S B;  3EHV A;  2ZW0 A;  3LK2 A;  3P4R B;  2JZP A;  2MP2 A;  1GPX A;  1TY0 A;  1FNV A;  1E54 A;  3LYY A;  1F2R I;  2IPK D;  3AA6 B;  2LWP A;  4RJX A;  1UWM A;  3BZD B;  3SR6 A;  1SGH A;  1BXW A;  4XYC A;  1T0R C;  2MBH A;  3AU5 A;  4J6I A;  1V9J A;  3AEE B;  2FCS A;  2ZCC A;  4JX1 C;  3IHP C;  2RDH A;  4Z3T A;  2K5P A;  2WXN A;  1SIF A;  1MVK A;  4CO7 A;  4RLC A;  3DBH B;  5D5D A;  2LJI A;  2UU7 A;  4FXC A;  4GIV A;  2CKH B;  3WI4 A;  1SB3 C;  1VRA B;  3RNA C;  1AAR A;  2BTE A;  1GB1 A;  3RYT A;  2W9N A;  1PDX A;  3QJZ A;  2JVC A;  3AEF B;  3VHT C;  2KC0 A;  1Z5S B;  4JIO U;  4FJV B;  2WX1 A;  2FAZ A;  2MJE A;  2O2V B;  4C4V A;  2LFI A;  4KKI A;  2FUH B;  1NBF C;  3VZW X;  2KDF B;  4DDI D;  4N6E B;  4ANX A;  3WAO A;  2MWS B;  2W55 A;  2BF8 B;  3ZRC A;  1WYG A;  2ZW1 A;  1OEY J;  2MA9 B;  1V2Y A;  4YL8 A;  4N75 A;  1V81 A;  2K8C A;  1I4Q A;  3C19 A;  2IJ0 A;  1WFY A;  4HCN B;  2IGD A;  2KAC A;  1K8R B;  3IT6 B;  3POQ A;  2BB6 A;  4MEL A;  4C00 A;  3APD A;  2PW9 A;  4A20 A;  3U52 E;  5E6O A;  1ENF A;  3BIN A;  2INP E;  1HEZ E;  4BFR A;  2MRP A;  2M07 A;  3VRA B;  1NEN B;  1J7B A;  5GV0 A;  1N63 A;  2IWV A;  3PTF C;  4M02 A;  4LSI A;  2BKR B;  2WYQ A;  3KLS X;  4A6Q A;  4JGH B;  2KVZ A;  3LK3 A;  2KDE B;  1LXD A;  3QIJ A;  4YSZ B;  1N5X A;  4ARI A;  4GDL B;  3K9O B;  2WXP A;  4W9E A;  3TMP B;  4P6V F;  4AOF A;  5IA7 A;  4RCO A;  1C3T A;  5G2N A;  2BVC A;  2GBN A;  5BMH A;  2JXT A;  3DBH I;  2YPV A;  1ZUD 2;  1TJE A;  3ZXV A;  4AUI A;  3NHE B;  4FQE A;  3TEW A;  3ZJT A;  2GB1 A;  3WI5 A;  1Q1O A;  5FVN A;  1FRD A;  2G3Q B;  2IGH A;  5FK9 C;  2YNK A;  3Q8B A;  3C0R B;  5IOI A;  3NOB A;  4JQW C;  1I4G A;  5KAI O;  1U4A A;  4M8N A;  3V05 A;  5ADX K;  4TV3 A;  4ICU A;  1QJP A;  1PYW D;  1YX5 B;  1JWM D;  1QF6 A;  2NTT A;  4FMS A;  1L4D B;  4DHJ D;  4KV2 A;  4DHZ B;  1D3Z A;  1NDD A;  1Q10 A;  3PZ8 A;  3V8U A;  1GAQ B;  3V62 A;  1UBI A;  3KYC D;  1KFY B;  3A4R A;  1EF5 A;  3VZT X;  4WH4 A;  3A9J B;  1SEB D;  2WS3 B;  3BVG A;  4KVG B;  2D2Q A;  4RM8 A;  4LSH A;  1OEY A;  2IZV B;  1VDV A;  1C4P A;  4ANW A;  5JDP A;  3BK1 A;  3MTN B;  2R4O A;  1QJ9 A;  4ZOH C;  1T0S C;  1V5T A;  5LXH A;  3VUX A;  4DXG A;  4RH6 A;  1GFN A;  2V4I B;  4KR4 A;  2K25 A;  3JCU O;  1V49 A;  4IWO A;  2MHL A;  3Q6B A;  3EFC A;  3RNG C;  4EKU A;  2N9L A;  3QRA A;  1F52 A;  2X38 A;  1RWS A;  2YLM A;  1ZHT A;  5BO4 B;  2A4Z A;  2XE1 A;  2AYO B;  4B9K A;  3N1X C;  1TS4 A;  3E56 A;  2OED A;  1MG8 A;  3EGR A;  1CZP A;  3WAL A;  3A1Q B;  4B6W A;  1P7E A;  3NG0 A;  2V0G A;  1DGJ A;  4M8M A;  5EE0 A;  2HTH A;  2XMX A;  4MAC A;  1V97 A;  3DHH C;  3SFD B;  2DZM A;  5IKC M;  1JWU D;  2GE4 A;  3MJ5 A;  3QRC A;  4PK1 A;  2O6V B;  2L0T A;  1FMA D;  1MPF A;  1Q0W B;  1GG3 A;  4GCP A;  2Y2X A;  1D5Z C;  3JSV B;  3AE4 B;  4TQ0 A;  3QAR A;  3HM3 A;  3N1Z C;  4MH8 A;  4GDK B;  4BZA A;  2N9X A;  3ZDM C;  1K51 A;  1OFF A;  3AAE A;  2J4X A;  4NAM A;  5DPW A;  2KTF A;  5E6P A;  4FHK A;  1K53 A;  4N9F 4;  1L4Z B;  1LGR A;  3SDL C;  3Q2A C;  3VZU X;  2KN5 A;  5T5F A;  4MGK E;  4MSM B;  3GE3 C;  3TCA A;  2V3P A;  4NNJ B;  2L83 A;  3P4Q B;  3H7P B;  4NJC A;  4PS3 A;  1LM8 B;  1I4R A;  2IBI B;  1WE7 A;  2R4N A;  3A9K B;  4RMA A;  4HDO A;  4D2K A;  4EZL A;  4O3Y A;  3K9P B;  1BT0 A;  4CYE A;  2Z0D B;  2M1M A;  3VDZ A;  4FZL A;  3ZVV A;  3POX A;  2PE6 B;  4Q2J A;  4MSQ B;  2MBO A;  2B76 B;  4F8C B;  4RJW A;  3RNB C;  4N58 A;  3HIZ A;  1SJH D;  3DVN V;  4MDK E;  2Y0K A;  1MHH E;  4C56 C;  3AV8 A;  3A0H O;  2KJ6 A;  1C9F A;  3Q3N C;  4NPN A;  1YIW A;  2KAN A;  1I7H A;  3HVD A;  3Q8C A;  8PRN A;  2RMM A;  1TKY A;  3ZJU A;  4HPM B;  3A4S C;  4KGS A;  4YT0 B;  3AE7 B;  4WWM A;  4XZ4 A;  3UGB B;  2KXP B;  1C4A A;  2V9H A;  2WXI A;  2KOX A;  1T0Y A;  4BOZ B;  4FJZ A;  3BYY B;  2Z59 B;  5E6N A;  2K0P A;  2RPQ A;  3I9V 1;  4ASW C;  1T0Q C;  3U7D A;  3VRB B;  1ZXI A;  1B1Z A;  2L7R A;  1WIA A;  4KGT A;  1C77 A;  2WDR B;  4BKT A;  3NS1 A;  2JWZ A;  1MHX A;  2JQY A;  4FSO A;  2YVC A;  3W1Y A;  4KSK C;  1WZ3 A;  1XD3 B;  1D5M C;  2GRI A;  4PJ0 O;  2W54 A;  1E0Z A;  2ASQ A;  4YSX B;  1TTN A;  4HCP B;  2KDM A;  1I4X A;  3PZD A;  2C7M B;  4IOI E;  1M4V A;  2NPT B;  1T1L A;  3AEG B;  1S5L O;  2Y5B B;  4GF4 A;  3ZO5 B;  3M63 B;  3ZDT A;  2MBE A;  2CHZ A;  1F2R C;  4QQ1 A;  4YTN B;  4PYZ A;  3PRN A;  1TBE A;  3J9C A;  4OVV A;  4DK5 A;  2ZEQ A;  1YQ4 B;  2KWV B;  4GCQ A;  2UYZ B;  3X23 A;  1X1M A;  1PGB A;  2VRR B;  2DAF A;  3AEB B;  1E8Z A;  3UIN B;  1FO4 A;  5BYQ A;  1RFA A;  4BBN C;  3H6N A;  3AA7 B;  2VH1 A;  1YS5 A;  1GJZ A;  2XE5 A;  1ZOY B;  1MM4 A;  4A8X C;  3B2F A;  1BXT A;  2GBR A;  2BYT A;  4MT5 A;  5H8Y E;  4FSP A;  2BWE S;  3FKY A;  4HEA 1;  3OLM D;  1HTO A;  1H4R A;  2KYW A;  5FR3 A;  3DCG A;  4LSE A;  3U30 A;  4NQK E;  1I42 A;  5I4D A;  1DOX A;  4AWJ A;  1KRH A;  3PGS A;  1WMH A;  2N9E B;  3VH4 B;  2E3T A;  4O1N A;  3IG3 A;  4JL9 A;  3NSG A;  2JMM A;  1ZDV A;  4HRO A;  3BRY A;  2DYM A;  4WWP A;  3U2S C;  2X9K A;  1F1H A;  4P16 A;  1BML C;  1OGW A;  1WYW B;  3HOL A;  1YN5 A;  3ZRF A;  3AE5 B;  4ZRJ A;  3AA1 A;  3AEA B;  4MM3 A;  3CF6 E;  3ZNH B;  2N9P C;  4GU2 A;  2X27 X;  1TS2 A;  3SHQ A;  4E74 A;  1YQB A;  2QHO A;  2WHI A;  3Q3O C;  4LNK A;  4GN1 A;  4IM0 A;  4ZYN A;  5AUI A;  2LVP A;  3NVW A;  2D07 B;  5JHB A;  2LHD A;  4AP4 C;  3PRP B;  4C80 A;  2ICI A;  2RPV A;  4MEM A;  3KWL A;  2Y5C A;  4LCD E;  4ZHO A;  1T3Q A;  4I6P A;  5HHD G;  4P1C C;  4USA A;  2KTR A;  3KQ4 A;  4E3C A;  3PHX B;  3R66 C;  3R7Q A;  1HXU A;  2M19 A;  4ZRK A;  1YN4 A;  2R4P A;  1E6E B;  4XNK A;  2LJ5 A;  3R8B A;  4KZC A;  4C7Y A;  1WI0 A;  4FES A;  1G90 A;  3KYD D;  4MH0 E;  2E6X A;  3DBS A;  4WQO B;  1L7Y A;  2V3N A;  4CTD A;  4NAW B;  2JPH A;  4A3P A;  4C69 X;  4LSF A;  3H7S A;  1SIJ A;  3G7G A;  3H9D A;  1TZO A;  4XDD A;  3RNC C;  3P4S B;  3SYB A;  1JWA D;  2KO3 A;  4LDT B;  1PUT A;  3SZD A;  2GLS A;  4OVZ A;  4M01 A;  1HQR D;  4LTU A;  2IY0 B;  1AN8 A;  2O4V A;  4D64 A;  4W9H A;  2ZNV C;  3POU A;  5IYU A;  4BKS D;  1NEK B;  2NBU A;  4AZL A;  4DXA B;  1I4P A;  1ZW7 A;  1PGX A;  1HXT A;  3I3T B;  1OTR B;  4PUX A;  1IGD A;  3MC0 B;  3EC8 A;  5GXG B;  3KH0 A;  5IP4 D;  4WIP A;  5B66 O;  3RZW C;  1ZPS A;  4W9F A;  2J0M A;  4X57 B;  2PEA A;  4TKN A;  4KIK B;  1PFD A;  4G75 A;  2Q5W D;  4PR7 A;  3VVW B;  2WXR A;  3B2G A;  3IAS 1;  1M94 A;  2N7D A;  1XT9 B;  4D65 A;  2G9H D;  3QQ8 B;  4IC7 B;  4JWU C;  5EE3 A;  2KN4 A;  4G11 A;  4ZHP A;  1WRD B;  5G39 A;  4NJ7 A;  1B9R A;  3QHT A;  3JW0 X;  3IAM 1;  1WGG A;  3PRE A;  3VE2 A;  3RMK C;  4DDG D;  2OMF A;  3Q3J A;  3HVZ A;  1P3Q U;  2LAS A;  2VZK B;  1K52 A;  2DEN B;  2G1E A;  2WXQ A;  3QAQ A;  4HJG E;  3OJ3 A;  2ONQ A;  2KMA A;  2KMC A;  4BKG A;  5DL6 A;  4MJS A;  2QIL A;  2KLC A;  3V6E B;  2LGI A;  2ZVO A;  2LVO A;  3TSS A;  1XCT L;  2XK5 A;  4OZA A;  1XLP A;  2IO1 B;  2BQQ A;  1UNS A;  5G5G A;  2IY1 B;  1QLB B;  5PRN A;  3M3J A;  4LNN A;  4O3Z A;  4OZB A;  2BYE A;  1ZHW A;  1EWC A;  4HXD A;  4L2Y A;  2BS3 B;  2JRI B;  2R2O A;  4PS8 A;  1YD8 U;  3FIL A;  4ACF A;  1KLV A;  2K8B A;  4RGT A;  1YOV B;  4I6L B;  3AAA A;  3PRZ A;  1ET6 A;  1QOF A;  5AUK A;  5D7G A;  4HLE A;  2AXT O;  3ABV B;  3AI5 A;  1EM7 A;  5H92 C;  4M0W B;  3Q69 A;  3MP9 A;  4ZRI A;  2J52 A;  2LI5 A;  2NBV B;  1EU4 A;  4K7S A;  3A33 B;  2AQ1 B;  1IBX B;  4DXF A;  5D3I B;  3ZLZ A;  3VR8 B;  2BBC A;  1E9M A;  1ESF A;  2DWQ A;  3AED B;  5C3J B;  1ZHY A;  1BUI C;  1VR9 A;  4FRT A;  1LFD A;  4GGQ A;  1WX9 A;  2KLG A;  4KZ0 A;  2FE8 A;  2WU5 B;  4XX5 A;  3ZQ4 A;  2KX0 A;  5LXI B;  1IUE A;  3BY4 B;  2QMT A;  2PRN A;  3PGU A;  1IZN B;  3PO0 A;  3AAE B;  1FNW A;  2L32 A;  4FLH A;  5MPO A;  1WGD A;  1KOT A;  4J3O D;  1YN3 A;  4IWQ A;  3CIR B;  4TUU A;  3VTU A;  3ZJV A;  1L0Y B;  4W9J A;  3NVY A;  2WQY B;  1WJ6 A;  4NZL B;  3AE3 B;  3AE1 B;  2J7Q B;  5LNK 1;  2K8H A;  2QEJ C;  4L1B A;  1P4T A;  1FEH A;  4B0M A;  5EE1 A;  2XE3 A;  3UAQ A;  4FZM A;  3V6C B;  3KVF B;  3CWI A;  5BMI A;  4FJY A;  3KUC B;  2K9X A;  4HWI B;  4F4B A;  4ZDV A;  3PQS A;  2ODJ A;  2A5U A;  1YMH E;  4U9C A;  2IYD B;  4B61 A;  1MFW A;  2WU2 B;  4ICV A;  3KUZ A;  3VY9 X;  5E6J A;  4RL9 A;  3AA6 A;  4K3C A;  1UD7 A;  3T3N A;  4G3X B;  2J42 A;  4JPS A;  4HPL B;  1JWS D;  2DYO A;  3ZYY X;  2WVP A;  3PHW B;  3Q8F A;  4AJY B;  2EMT A;  2FCQ A;  3A0B O;  2KZR A;  5T8I A;  1WX7 A;  2G4D B;  4AS1 A;  1V8C A;  3O0E A;  1WJN A;  2W82 A;  3WAN A;  1T6B X;  4IG7 B;  1IGC A;  3MHS D;  7PRN A;  1TT5 B;  4AYI D;  3RUI B;  4E71 A;  5AZF A;  2L00 B;  3AA0 A;  2JYE A;  1N62 A;  4IM2 A;  2PJH A;  5H2F O;  2F1V A;  3UI3 A;  1MI0 A;  1TIF A;  2ERV A;  4LJO B;  1V6E A;  1WR1 A;  1J19 A;  1C78 A;  4GCS A;  2CU1 A;  1YJJ A;  4NJ6 A;  1XQQ A;  3DWG C;  1KLU D;  2JX5 A;  2WXL A;  2WDT B;  3I57 A;  1ZGU B;  3EUB 2;  4MGY E;  1C1Y B;  4PT5 A;  4O4X A;  1MG4 A;  4CQN A;  1TKE A;  1WH3 A;  2I1K A;  3RBH A;  2BYV E;  4RLB A;  2C60 A;  4YSY B;  3B0A A;  2MQJ A;  2PVO D;  2INC C;  1TYG B;  3DHI C;  4IDI A;  3WCQ A;  1T5X D;  2GBJ A;  2POR A;  3KZI O;  2R4L A;  1GNU A;  3BVM A;  3P2B A;  3R3M A;  4W9K A;  4WAA A;  3M62 B;  2KKC A;  2AL6 A;  1E90 A;  3ZTC A;  3GP7 A;  3EMN X;  1CQV A;  5GTH O;  4KKJ A;  1OQY A;  1I35 A;  3WA0 A;  3IFW B; 
#chains in the Genus database with same CATH homology
 3C8Y A;  4G76 A;  3NVV A;  1BXT A;  2I2Y A;  1QOG A;  3VQI A;  2BYT A;  4MT5 A;  2WXO A;  1BH3 A;  5H8Y E;  4FSP A;  2YEP F;  1VJK A;  4HEA 1;  1XF5 L;  1FD6 A;  4A55 A;  3FYX A;  1FRR A;  5FR3 A;  1CJE A;  3P63 A;  2WXK A;  1SSN A;  2CU3 A;  4LSE A;  4AYM C;  5I4D A;  2L1A A;  4B0E A;  1DOX A;  1KRH A;  3SY9 A;  1SE4 A;  3DA4 A;  3P1M A;  1ZDX A;  1ZHX A;  3EA6 A;  3PQU A;  2E3T A;  1KLG D;  4O1N A;  1QOB A;  2XNA C;  1C76 A;  5DL7 A;  3NSG A;  2JMM A;  1ZDV A;  3LK4 2;  2K4T A;  3DWM A;  4HRO A;  2LFU A;  2DYM A;  3U2S C;  3GP6 A;  4XWT A;  1JAL A;  1NVI D;  1PGA A;  2WNM A;  3AM9 A;  4RF0 A;  4P16 A;  1BML C;  2DBY A;  2N0S B;  2NMQ A;  2ZW0 A;  3V3X A;  3LK2 A;  2J4U P;  3P4R B;  1QQR A;  2JZP A;  3HOL A;  1YN5 A;  5FKA C;  1GPX A;  1F77 A;  4D5U A;  1TY0 A;  1FNV A;  3AE5 B;  3AA1 A;  1E54 A;  3LYY A;  1AWD A;  1F2R I;  2FGR A;  2IPK D;  2Z8L A;  3AEA B;  3AA6 B;  2X27 X;  4RJX A;  1TS2 A;  4E1S A;  1UWM A;  2JQR B;  3BZD B;  1HXX A;  2WXH A;  3GB1 A;  3SR6 A;  2MJD A;  4A9A A;  3H8H A;  1CK1 A;  1ORM A;  1BXW A;  1FXA A;  3W2D A;  1FM0 D;  1J7A A;  5AUI A;  3NVW A;  3O13 A;  3AEE B;  3URY A;  1F0Z A;  2LHD A;  4BUM X;  4C80 A;  4JX1 C;  4RGO S;  2BS2 B;  5BYR A;  2RDH A;  4Z3T A;  3NVZ A;  2K5P A;  1SJE D;  2ICI A;  6PRN A;  4AKM A;  2IDY A;  2RPV A;  1PHO A;  3KWL A;  2Y5C A;  1I4H A;  2WXN A;  3KWV A;  4WQM A;  1MVK A;  4ZHO A;  1T3Q A;  2I38 A;  5HHD G;  4ZYS A;  4RLC A;  5EE9 A;  5D5D A;  2LJI A;  4FXC A;  1FFV A;  4USA A;  1XLO A;  1VZ7 A;  3WI4 A;  3KQ4 A;  1SB3 C;  3TZG A;  1VRA B;  2QSD A;  3AB5 A;  3JTY A;  1HXU A;  1N60 A;  2BTE A;  3TEY A;  1GB1 A;  1QT9 A;  2M19 A;  3GS2 A;  1PDX A;  1TS5 A;  1YN4 A;  4LLG M;  3AEF B;  1E6E B;  4XNK A;  3R8B A;  2WDQ B;  2KC0 A;  1PRN A;  3AH7 A;  3MHZ A;  1SBB B;  3BII D;  2W80 C;  2MJE A;  3OWE B;  4C7Y A;  1DOY A;  1YJI A;  4FES A;  1G90 A;  2LFI A;  2OHF A;  2E6X A;  4KKI A;  1V1O A;  3VZW X;  2YEP B;  5JXV A;  2V3N A;  4NAW B;  4N6E B;  4C69 X;  2K22 A;  1JQ4 A;  4LSF A;  4FUV A;  1SIJ A;  3G7G A;  2W55 A;  2F1T A;  4XDC A;  1TZO A;  2M06 A;  2HTM E;  4XDD A;  4JFB A;  1WYG A;  2ZW1 A;  2Y5P A;  3P4S B;  2PMV A;  2SAK A;  4M0W A;  3SYB A;  1OQR A;  1XEE A;  1JWA D;  1HZ6 A;  1PUT A;  3SZD A;  3AE2 B;  1XO3 A;  4FOZ A;  3R2T A;  4OVZ A;  2JU6 X;  3LK4 1;  1HQR D;  1I4Q A;  2PTL A;  4LTU A;  5HG2 A;  2IJ0 A;  1IBX A;  2IGD A;  1AN8 A;  2QTK A;  2H89 B;  2O4V A;  4D64 A;  2KAC A;  4HKZ E;  3POU A;  1BT9 A;  1XXG A;  3IT6 B;  2ZFG A;  3POQ A;  3LXF A;  2BB6 A;  5IYU A;  3W5V B;  4TQ1 A;  1NEK B;  1E7P B;  1ET9 A;  1RYJ A;  4AZL A;  1WSP A;  3T24 A;  2PW9 A;  1JML A;  3T0S A;  2MEK A;  1GB4 A;  3U52 E;  1C4C A;  1E10 A;  1Q9G A;  1EWY C;  3TEZ A;  1FCL A;  1ENF A;  2KZ7 B;  1WXQ A;  1I4P A;  2INP E;  5TSS A;  5ADX L;  1PGX A;  1HEZ E;  3HW9 A;  3VRA B;  1HXT A;  2M07 A;  4AKR B;  1NEN B;  2LEK A;  1J7B A;  2N9K A;  5GV0 A;  1N63 A;  4N59 A;  1SF0 A;  4LSI A;  4PUX A;  1IGD A;  3KLS X;  3MC0 B;  4A6Q A;  3AMZ A;  3LK3 A;  5GXG B;  1RFK A;  2PKO A;  4YSZ B;  3PZ7 A;  1N5X A;  4ARI A;  4GDL B;  4WIP A;  1OPF A;  1A70 A;  1IZN A;  2R61 A;  2W81 C;  2WXP A;  4DQO C;  4AYD C;  1ZPS A;  4P6V F;  4KGR A;  5G5H A;  3VY8 X;  4YWG G;  4RCO A;  5BMH A;  2FUG 1;  1PFD A;  4G75 A;  2JXT A;  2Q5W D;  5EE2 A;  1UWX A;  2YPV A;  1ZUD 2;  2WXR A;  1FIQ A;  1TJE A;  2ACZ B;  3B2G A;  3IAS 1;  4O4U A;  1YNT E;  1VLB A;  4AUI A;  4D65 A;  2G9H D;  3Q8E A;  2AX5 A;  4JWU C;  5EE3 A;  2KN4 A;  3RFZ B;  4ZHP A;  3TEW A;  3ZJT A;  2GB1 A;  2D5G A;  3HRD D;  3WI5 A;  1B9R A;  5FVN A;  3SY7 A;  2N7J A;  1FRD A;  3LK2 B;  4E1T A;  2IGH A;  2KQ4 X;  3IAM 1;  5FK9 C;  2YNK A;  3Q8B A;  1Q9F A;  3AA1 B;  1I4G A;  4MM3 B;  5C2T B;  3VE2 A;  3V05 A;  2HDE A;  1EU3 A;  5ADX K;  2OMF A;  5AFU K;  1QJP A;  2M56 B;  3P4P B;  3HVZ A;  1PYW D;  2VZK B;  3ZGZ A;  1KTK A;  1JWM D;  1K52 A;  2XG6 A;  1MM5 A;  4FMS A;  1L4D B;  2NTT A;  2WDV B;  2WP9 B;  1NI3 A;  2G1E A;  2WXQ A;  3LB8 C;  1Q10 A;  2INN E;  3PZ8 A;  3A2S X;  3V8U A;  4HJG E;  5DL5 A;  2ONQ A;  4YTP B;  1GAQ B;  1HZ5 A;  3RPF C;  3ETR A;  5HFY A;  3W5U B;  5DL6 A;  1KFY B;  4TSS A;  2XTQ A;  1SE3 A;  1QJ8 A;  3FAH A;  3VZT X;  2QIL A;  3SYS A;  2WXM A;  4WH4 A;  1SEB D;  2LGI A;  3NUH B;  2WS3 B;  3BVG A;  4AYE C;  1GFQ A;  2JYT A;  4LSH A;  3TSS A;  1KF6 B;  1VDV A;  1XCT L;  5HI1 A;  4OZA A;  1C4P A;  1XLP A;  2VZK D;  1TS3 A;  3HUI A;  5JDP A;  1UNS A;  3BK1 A;  5G5G A;  1QJ9 A;  1HXY D;  2PVG C;  1QLB B;  4ZOH C;  3W9C B;  5PRN A;  3VR9 B;  3Q8A A;  4DXG A;  4XNL A;  2KXP A;  4LK0 M;  4US8 A;  4O3Z A;  2LUM A;  1GFN A;  4RH6 A;  3POR A;  1JW9 D;  4OW0 A;  1FNU A;  2V4I B;  4KR4 A;  4OZB A;  4RGN A;  4WAF A;  2GI9 A;  1D5X C;  1ZHW A;  2N2M A;  1EWC A;  2MHL A;  3BK2 A;  4L2Y A;  2BS3 B;  3MFG A;  2N9L A;  3QRA A;  3FIL A;  2X38 A;  4L23 A;  4KR8 A;  1JCK B;  1RWS A;  1UGJ A;  4GLS C;  4RGT A;  5BYS A;  1N61 A;  3AAA A;  1ZHT A;  1NYQ A;  1QF6 A;  2XE1 A;  1ET6 A;  2JSV X;  2PIA A;  1QOF A;  5AUK A;  1MPE A;  2Y7S A;  3NRZ A;  5D7G A;  1TS4 A;  3ABV B;  4REZ A;  3E56 A;  1EM7 A;  2OED A;  3AE9 B;  1V1P A;  5H92 C;  3DA3 A;  3VE1 A;  1CZP A;  1V1P B;  3EGR A;  2V0G A;  1P7E A;  3Q69 A;  3R2I A;  1L0V B;  1DGJ A;  3MP9 A;  2J52 A;  2EKI A;  5EE0 A;  4O49 A;  1EU4 A;  2XMX A;  1UUP A;  2WXF A;  2AQ1 B;  1V97 A;  4MAC A;  1L5P A;  3FC4 A;  1IBX B;  3SFD B;  4DXF A;  1JWU D;  4US9 A;  5D3I B;  3VR8 B;  4JE3 B;  2BBC A;  1E9M A;  2GE4 A;  1ESF A;  1KH0 A;  2DWQ A;  1YQ3 B;  3AED B;  5C3J B;  3MJ5 A;  4OZC A;  1ZHY A;  3QRC A;  1BUI C;  1FMA D;  1VR9 A;  4IKG A;  1MPF A;  3AE6 B;  1NYR A;  4FRT A;  4GCP A;  3UPG A;  1THQ A;  5AFU L;  2QIE B;  1K50 A;  3AEC B;  2Y2X A;  1D5Z C;  4ITK A;  2FE8 A;  1L6V A;  4TMA B;  2WU5 B;  3AE4 B;  4TQ0 A;  2BW2 A;  3ZQ4 A;  3T3O A;  4UDU C;  3LK3 B;  4MH8 A;  3U7Z A;  2Y3A A;  1HA5 A;  4GDK B;  2ZLD A;  1IUE A;  2FGQ X;  2QMT A;  2PRN A;  3PO0 A;  1IZN B;  1JRO A;  1K51 A;  2KWD A;  1OFF A;  3AAE A;  3AAE B;  1GFP A;  2J4X A;  1FNW A;  2AQ2 B;  4NAM A;  2L32 A;  2KDY A;  3HOE A;  5MPO A;  1K53 A;  1RM6 C;  1OSM A;  2QJL A;  2WLB A;  2FBW B;  1R7S A;  4J3O D;  1L4Z B;  1YN3 A;  1XLQ A;  2L52 A;  3CIR B;  2CJO A;  4XWW A;  3VZU X;  1QOA A;  3ZJV A;  3BWU D;  2AQ3 B;  3TUO A;  1L0Y B;  5T5F A;  3NVY A;  2WQY B;  1QKZ A;  4NZL B;  3AE3 B;  2V3P A;  3AE1 B;  4KRA A;  2L83 A;  2CJN A;  3P4Q B;  5LNK 1;  4NJC A;  4YTM B;  4AQ7 A;  2QEJ C;  1I4R A;  1VZ6 A;  4L1B A;  1P4T A;  3W1S A;  1FEH A;  4B0M A;  5EE1 A;  1D6E C;  2XE3 A;  4RNA A;  1FFU A;  3UAQ A;  4D2K A;  3SFE B;  4FZM A;  4O3Y A;  4O3X B;  1ZE3 D;  3P42 A;  4XE0 A;  1D4B A;  4OHJ A;  2J53 A;  3CWI A;  4FZL A;  5BMI A;  4ARC A;  1J7C A;  3N9Y C;  3POX A;  2K9X A;  4Q2J A;  4HRS A;  4F4B A;  1ACC A;  2B76 B;  1GFM A;  1ZXH A;  3PQS A;  2ODJ A;  4RJW A;  1JRP A;  1YMH E;  4N58 A;  4U9C A;  1FCC C;  4H2A A;  4B61 A;  1SJH D;  2WU2 B;  3C5O A;  2Y0K A;  3IXS A;  3VY9 X;  3E9S A;  1MHH E;  5E6J A;  4RL9 A;  5DL8 A;  2BS4 B;  3AA6 A;  1L0X B;  2KAJ A;  2KMM A;  3AV8 A;  4C56 C;  1C9F A;  1SE2 A;  2PLP A;  4AFK A;  3T3N A;  4FRX A;  1I7H A;  1ROE A;  2J42 A;  3HVD A;  8PRN A;  3AE8 B;  2RMM A;  1TKY A;  3Q8C A;  4JPS A;  3ZJU A;  3L4P A;  3T20 A;  1JWS D;  1VZ8 A;  2DYO A;  3ZYY X;  2XTR A;  3Q8F A;  4KGS A;  4YT0 B;  1P7F A;  3AE7 B;  4WWM A;  3UU2 A;  2JWU A;  4RGM A;  2KXP B;  1C4A A;  2WXI A;  1WWT A;  2IGG A;  4FZN A;  2ON8 A;  2K0L A;  2SEB D;  5T8I A;  4O3W A;  4RF1 A;  2WXG A;  4AS1 A;  3BYY B;  1V8C A;  3O0E A;  2W82 A;  2Y0H A;  1WRI A;  2K0P A;  3I9V 1;  4WUR A;  3NZ3 A;  2NTS A;  1GFO A;  2BB5 A;  1T6B X;  3VRB B;  3FIL B;  1GOZ A;  1ZXI A;  4AYN A;  1B1Z A;  1IGC A;  1XCQ L;  2LHE A;  4A90 A;  2RDG A;  1SXT A;  3AAA B;  7PRN A;  1H6S 1;  2M0A A;  4KGT A;  4AYI D;  1C77 A;  2MH7 A;  2WDR B;  4JWS C;  1JWB D;  3B9J A;  4GHB A;  3NS1 A;  3AA0 A;  3AA0 B;  2JYE A;  4R3D A;  1N62 A;  4C7Z A;  2LMC A;  4YXD B;  1MHX A;  4FSO A;  4KX6 B;  3TEX A;  4ZRQ A;  2F1V A;  3UI3 A;  1XLN A;  1MI0 A;  1OQQ A;  1Y56 A;  1D5M C;  2ERV A;  1N5W A;  2GRI A;  2K3U A;  1AYF A;  2BT6 A;  1L6U A;  2W54 A;  1E0Z A;  1C78 A;  3HWB A;  4GCS A;  2TSS A;  3U4E G;  1YJJ A;  4YSX B;  3DWG C;  2KDM A;  1KLU D;  1I4X A;  2JX5 A;  2WXL A;  5BMG A;  3I57 A;  4IOI E;  4FT6 A;  1M4V A;  3EUB 2;  3AN1 A;  4EE2 A;  4PT5 A;  2DLB A;  2EEL A;  4O4X A;  2W3S A;  3AEG B;  4RFB A;  1DYQ A;  4CQN A;  1STE A;  2MJ3 A;  4GF4 A;  1DOI A;  3KVD D;  1TKG A;  1TKE A;  1FXI A;  3BVZ A;  2J1N A;  2XE2 A;  3RBH A;  2N2L A;  1WGK A;  5G26 A;  4RLB A;  1F2R C;  4QQ1 A;  1AW7 A;  4YTN B;  2XN9 C;  4YSY B;  3PRN A;  3IT4 B;  3J9C A;  2MNH A;  2W3R A;  2PVO D;  3BYT B;  1TYG B;  3WCQ A;  4IDI A;  4ZRP A;  1YQ4 B;  4GCQ A;  1T5X D;  2POR A;  2H88 B;  3BVM A;  2LHF A;  2Y0L A;  1PGB A;  5D3D A;  1C79 A;  4JCH A;  1TY2 A;  3AEB B;  1FO4 A;  2KZ7 A;  5BYQ A;  2WXJ A;  4AKR A;  3AA7 A;  3AA7 B;  1LO5 D;  1ZHZ A;  3EMN X;  3K19 A;  3GP7 A;  1CQV A;  1ZP0 B;  1YS5 A;  4KKJ A;  2XE5 A;  1ZOY B;  1MM4 A;  4A8X C;  3SZV A;  3SEB A;  3B2F A;  1QIL A;  4HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...