4N58A

Crystal structure of pectocin m2 at 1.86 angstroms
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
266
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWATGVLNNLSGTPYEIRIPGELKIKENGKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis pbr1692
molecule tags Hydrolase
molecule keywords Pectocin M2
total genus 74
structure length 266
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n58A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n58A01
1VJKA 1FXAA 3NVYA 3NVVA 2K9XA 2FBWB 4JWUC 1KF6B 3L4PA 3VR9B 4ZHOA 4HROA 4FZMA 4US9A 2WDQB 1NENB 1XO3A 4HRSA 3SFDB 4YSXB 1QF6A 3AE5B 1FM0D 1OQRA 1GPXA 1TYGB 2PIAA 4ZHPA 4N59A 3P4RB 5EE1A 1B9RA 2ACZB 3AEEB 3NVZA 1RM6C 5EE0A 1YQ3B 2AX5A 3ZYYX 1I7HA 1QOFA 2MJ3A 4C80A 2DWQA 1FMAD 1FIQA 1VDVA 1IUEA 4A9AA 2CJNA 2W3RA 3NRZA 3CIRB 1E10A 4ITKA 3AEGB 4JX1C 4N6EB 1N5WA 3AEFB 1XLQA 5G5HA 4C7YA 1NVID 1QOAA 2M56B 3B2GA 3AM9A 1NYQA 1JWAD 3AE2B 3W9CB 1FO4A 3AE1B 1DOXA 2DBYA 1NEKB 1GAQB 1EWYC 3AEAB 1J7AA 1NI3A 3HRDD 2CJOA 3P4PB 4N58A 1E9MA 2BS3B 2PVOD 2WLBA 2WU2B 4ZOHC 4YTNB 3DWGC 1ZP0B 2JQRB 2MH7A 3W5UB 2W54A 1WXQA 2LEKA 2HTME 1FFUA 1AWDA 1CJEA 1WGKA 3SR6A 1SF0A 4G75A 4G76A 1V8CA 1SB3C 1ZXIA 2M19A 2PKOA 1DOIA 2Y5CA 4YTPB 3SFEB 1DOYA 4FZLA 2K22A 5G5GA 3AEBB 1L6UA 2WDRB 2XMXA 1A70A 1QOGA 2L52A 1QLBB 1DGJA 3AE6B 1WRIA 4FZNA 2OHFA 3CWIA 3HUIA 3AH7A 2L83A 1TKGA 3AE7B 4KX6B 5C2TB 1FFVA 2B76B 2BS4B 3RPFC 1PUTA 4WWMA 1CZPA 5GXGB 4US8A 1JQ4A 5MPOA 5AUIA 3NS1A 4IDIA 1WYGA 2KMMA 3AE4B 3VRAB 1F0ZA 2JX5A 2XTQA 3DA3A 2PVGC 2QIEB 4FXCA 3LXFA 1N60A 1SIJA 3WCQA 2Q5WD 1JRPA 1QT9A 1ZUD2 3B9JA 1E6EB 3DA4A 3AN1A 3NVWA 1KFYB 1PDXA 3VRBB 1FXIA 1N62A 3W5VB 2WDVB 2K5PA 1PFDA 3AB5A 3AE3B 4YXDB 3P1MA 1T3QA 2WU5B 1WWTA 1ROEA 1L6VA 4P6VF 3HVZA 4LTUA 3P4QB 2CU3A 1L0VB 1OFFA 2H88B 1FRRA 1YQ4B 2XTRA 1L5PA 3ABVB 3AE8B 3BIID 5H92C 1N61A 1UWMA 1N5XA 1YJIA 3AEDB 1AYFA 5EE9A 1QOBA 1TJEA 2E3TA 2W3SA 3FAHA 3P4SB 4YT0B 1FRDA 2BT6A 1V97A 3B2FA 5AUKA 1NYRA 2BS2B 2WP9B 1XLNA 2WS3B 1J7CA 3AV8A 2MJDA 1JROA 1JWBD 3VR8B 5C3JB 1JALA 1RWSA 4YSZB 3FC4A 3AECB 2WQYB 3LB8C 1R7SA 1KRHA 1JW9D 1YJJA 1N63A 4USAA 3PO0A 5H8YE 3P63A 4YTMB 4YSYB 3AE9B 5EE3A 1OQQA 2QJLA 3EUB2 2H89B 1RYJA 2EKIA 1RFKA 1VLBA 1E0ZA 1XLPA 4C7ZA 3KWLA 2G1EA 2MJEA 3DWMA 1XLOA 1J7BA 2W55A 3ETRA 4WQMA 2KAJA 1TKEA 4JWSC 2N0SB 1TKYA 1ZOYB 1E7PB 3AMZA
chains in the Genus database with same CATH superfamily
3NVYA 4MJSB 2R88A 3T8MA 3L4PA 5BMGA 1FNUA 4E1SA 2BB5A 4FA6A 4PS7A 4FESA 3SD5A 2JPHA 4RM9A 5DL8A 3ZNHB 1B9RA 4AQ7A 2ZNVB 1C78A 2R89A 4N9F4 4FMSA 2MBEA 2CJNA 2N1WA 1WR1A 2MP2B 4DHZB 3B2GA 2L32A 4GCQA 4XC2A 1GFOA 4G50A 4RMAA 1GAQB 4AYMC 3VE1A 3PORA 1N6ZA 3M3JA 4P16A 1NBFC 2W54A 3AA0B 5FR3A 1YNTE 1ENFA 3BVMA 1T0SC 5I4DA 3SFEB 3PQSA 1V2YA 2XBBC 2ZW1A 2LGSA 4HRSA 2KQ4X 3HUIA 3L16A 2C9WB 3AE7B 3Q69A 3VTWA 4JPSA 3QX1A 2WXRA 3QAQA 1ESFA 3B9JA 4K7UA 3NVWA 5LLIA 2PJHA 3AAEB 2O6VB 5E79O 3AE3B 3X0WA 3VH4B 1K51A 3AI5A 5DL7A 3N1YC 4LNIA 4MGZE 3ZGZA 1YQ4B 2DHZA 4OVZA 4HJKA 4XX5A 1WF9A 3OLMD 4W9FA 4BOSC 1SEBD 2KJHB 4JCHA 1Z2MA 3N9YC 4P1CC 5JXVA 2BVCA 1JROA 2KOXA 4TV3A 4ARCA 5BYRA 4ZDVA 3AECB 5LXHA 2A5UA 4PYZA 3PTFC 5T5FA 4AUIA 4E3CA 4BBNC 4YSYB 1E8ZA 3URYA 3GP6A 2KMAA 3EUB2 3TEXA 1T6BX 4O1NA 4WWNA 5E6PA 1KM7A 1V5TA 3V6CB 4HK2A 3DWMA 3ZRCA 1ZHWA 1TKYA 2ZJDA 3TL5A 3U4EG 2V3NA 3QRAA 3SYBA 4W9JA 4US9A 4II3B 3KUZA 1OQRA 4BAXA 4WJPA 7PRNA 5GV0A 5EE0A 3HM3A 5DL6A 1AARA 3ZJTA 5T8IA 2CHZA 2IPKD 4NZLB 2QSDA 2Z59B 2QMTA 1K52A 2D3BA 3ML8A 4OVUA 2XE1A 3H1UA 3BY4B 5J2RA 2PW9A 3KVFB 3SY7A 2G4SA 4AZLA 1E9MA 2WLBA 4BKTA 1XQQA 2J7QB 5ADXL 4KDIC 2KWUB 1IBXA 3Q8AA 2WXPA 1SF0A 4S0RA 2XEWA 2C7NB 4J3OD 2WGSA 4XE0A 3H9DA 3WIMA 1CK1A 1L4ZB 1P98A 3QHTA 4LNOA 1C9FA 4GSWA 4KX6B 3NG0A 3PGRA 3T3NA 2BW2A 1IZNB 3RT3B 3IG3A 1MG4A 1I4RA 1UNSA 1FNWA 2Q5WD 2QILA 3FILA 1T1LA 1P1AA 4AYNA 2KC1A 3VUXA 3A9KA 4MH8A 1C4AA 3L0WB 4GDKA 5CHWA 2C7MB 1ROEA 4IW0A 1GOZA 3JCUO 2KFJA 5H2FO 4ACFA 3BIID 3PRPB 3AE8B 2B3AA 5H92C 1KTKA 3A4SC 3DBSA 2KYWA 2RPQA 2Z8LA 3ZW3A 1NYRA 1G6JA 4FSPA 4GLSC 3NZ3A 3JVZX 3B08A 1XF5L 3NOBA 5GTIO 5FKAC 2RDGA 4GN1A 1UBIA 2W81C 2JWZA 1E0ZA 4TUUA 1FNVA 3P42A 4M01A 4D5UA 1ZPSA 4XWWA 4B0MA 2FBWB 2YNKA 4YSXB 4JWUC 3ZNID 1TBEA 2KD0A 1FM0D 2R4PA 2WXQA 1LQBA 4IM2A 2MBQA 4W9KA 4ZHPA 1MPEA 3HK0A 4EFOA 2W9NA 5BMIA 2INNE 2K6QA 4A55A 1FIQA 1VDVA 3H8HA 3J9CA 3A0BO 1WXAA 3U30A 4OZCA 3VDZA 3NRZA 3Q8EA 3KYDD 2JMMA 1VR9A 2J4UP 3W9CB 1WYWB 4AJYB 3WAPA 3OJ3A 4AS1A 4DBGA 5D5DA 1C76A 3HRDD 1BXWA 3EA6A 1WM2A 4HCNB 5D7GA 3RNCC 2HTME 4RLBA 4TSSA 4KKJA 2AYOB 4CO7A 3Q14C 3SR6A 4DHZE 2PKOA 3VE2A 2KDBA 1GC6A 2IYDB 4I6PA 1A5RA 1WRIA 1WJNA 2Y7SA 4GDLB 1UZXB 2KNBA 2V3PA 4WWMA 2J52A 2VH2A 1WZ0A 2YLMA 4C4VB 3NS1A 2LJIA 3DHHC 2WDTB 1E5WA 2JX5A 4K3CA 3NUHB 1C4CA 1JWMD 3A9JB 2JWUA 1TIFA 1UWXA 4GDKB 4KGTA 3T24A 3QK0A 2ONQA 2KVZA 3V61A 1D3ZA 2BWES 4I6NB 6PRNA 4WJNA 1E90A 4MACA 5EE2A 3Q6BA 4OZBA 4YT0B 4AOFA 2BS2B 5GMVA 1EWCA 1KLUD 2L7RA 1QJ8A 5B5EO 4LDTB 1F77A 2G9HD 1XD3B 2J4XA 4RGOS 4CTDA 3LK3B 4YTMB 1OGWA 3EGRA 2YVCA 4WAFA 3WI5A 2XN9C 1VLBA 3ALBA 4BKSA 1XLOA 4KR8A 3APCA 2OJWA 2WXKA 2X8XX 1WR6E 4FXCA 3PPAA 4A3OA 4FBJB 3KW5B 1VD2A 2JSVX 2RDBC 4PK1A 1SE2A 1TT5B 1GUAB 4PS8A 1FD6A 2WNMA 5CHVC 2HTHA 4KDLB 1YQ3B 3R3MA 4IUMB 2MJ3A 3EMNX 4Q2JA 4RJWA 4IM3A 3QWZB 1MPFA 2KWVB 1M94A 1XLQA 1Y56A 4PUXA 4XDCA 2WX1A 1NYQA 2J0MA 1SE4A 1WGDA 5HHDG 4KIKA 2RD0A 2DENB 2IJ0A 3MC0B 1PGAA 3V6EB 2JRHA 2N2MA 3ZXVA 3I57A 4GGQA 3K9PB 2D2QA 2O6VA 2XMXA 3PZ8A 3AE6B 2QHOA 4K7WA 2O2VA 3GZNB 3W1SA 3ZJUA 4DDID 2LGYA 2DZIA 4OVVA 4A6QA 1JRPA 5L83A 4M0WA 1PDXA 1V80A 1V86A 2NS5A 1VZ7A 4XNKA 1XT9B 4MT5A 3GB1A 3AEDB 3UIPB 3EECA 1XEEA 3B2FA 4GB9A 2JVCA 3POQA 2I38A 2IO3B 3AAAA 1S1QB 3VVWB 5JZEB 5L95C 3N20C 2HE7A 4USAA 4CYEA 1Q0WB 4EZLA 2FUHB 3PGUA 2CHWA 2HJ8A 1Q9FA 1RYJA 5BO4B 4N75A 1ZDXA 1JWUD 3UPGA 2INCC 3W1SC 4IG7B 3AXCA 4MGYE 3I63C 4WWPA 3LYYA 4GHBA 3TCAA 3DCGA 4FRTA 5D3DA 3U7DA 2R4OA 3T3OA 2K0PA 4N74A 3DDCB 3SFDB 3AE5B 4LJPB 1ZHZA 3AU5A 2KFKB 2BB6A 2ACZB 3RNAC 4IC7B 2IWWA 1QKZA 3ZUNA 1ISNA 2N9EB 1SE9A 1WXMA 3PGSA 1WX8A 3DBRI 3RN9C 4GMVA 2HDEA 1IP9A 3BRZA 1YN5A 3ENEA 1S3SG 1T5XD 2FCMA 3NS8A 3C8YA 2AEHA 3DVNV 1TS3A 4W9HA 2JQYA 2FAZA 3VTUA 3IBEA 3PS6A 2OHFA 2UYZB 4IWQA 1QILA 2ON8A 4HEA1 3JW0X 3VHTC 2GBJA 2OJRA 3V60A 2AQ3B 1I4XA 1J8CA 4W9IA 1HZ6A 3WCQA 5IN7A 1MVKA 1V9JA 1FXIA 1WXSA 1WH3A 4M02A 1E7VA 4KSKC 4YXDB 2LHFA 1VZ8A 2HD5B 2D3AA 2R2OA 4IM0A 2DLBA 1FRRA 4E74A 3M63B 2LI5A 1L5PA 1S5LO 4BZAA 1VZ6A 3MHZA 3A9JA 1WMHA 3PQUA 4F8CB 4KGSA 2VH1A 1GNUA 1P0RA 3PO0A 5H8YE 1TS4A 1OQQA 2BF8B 2QJLA 2VRRB 2L76A 2SEBD 3WAMA 2GE4A 5LNK1 5DPWA 3TEWA 3H7PB 1BUIC 4U9CA 5KHQA 2KAJA 1PYWD 1EU4A 4BVUC 3IAS1 3CF6E 4DXGA 2BYTA 3DBLB 4RCOA 3BYTB 1NENB 3KVDD 2BKFA 2R4NA 1TYGB 3WU2O 4N59A 2HJ1A 2OMFA 3R7RA 3U52E 2L05A 3I5JC 3MC8A 2ZPYA 1E10A 2R2QA 4N6EB 3SYSA 5PRNA 2N7EA 2FGRA 5IYUA 1C77A 2QC8A 3R8BA 4DXAB 1FO4A 2Y0KA 1NDDA 1ZW7A 1UUPA 3DVGX 3E9SA 4HVBA 4ZOHC 3NSGA 3ZDMC 3IT6B 4NJ7A 3RNBC 3TJPA 1WGKA 2WJRA 1RRBA 3ZIMA 3BK2A 4JGHB 3TZGA 1WJUA 1D5MC 3RFZB 3VUWA 4EUTA 4FHKA 4DHJB 2BS4B 4NAWB 3A4RA 3H6NA 2RMMA 1JQ4A 4KGRA 5BYSA 2ZPNA 3NZUA 3AN1A 3NY5A 2PPHA 2REXA 1F9JA 2LRWA 2WDVB 5CX3A 3RD2A 4KSLC 3DBHI 1WZ3A 2DZKA 1T16A 4FADA 3ABVB 1ZHTA 1I35A 4EKUA 1YOVB 1C4PA 1VCBA 3UU2A 3FAHA 3P4SB 2EELA 1HZ5A 2WP9B 3RNGC 4DK5A 3T20A 4ANXA 4LLGM 2EMTA 4YSZB 3EHVA 3ECIA 1D4BA 1FPYA 1D5ZC 4EZKA 1ET6A 1UH6A 5AFUK 5GTHO 2G4DB 3DHIC 4ZRQA 4C7ZA 3KQ4A 5AFUL 1AN8A 4L1BA 3IFWB 4K7SA 3SY9A 3T0SA 3NVVA 1RAXA 4ZHOA 3C19A 1YMHE 2V9HA 3AA6A 3DHGC 2FCQA 3ZTDA 2D11A 5EE1A 4MELA 2NCNA 4RGMA 1FMAD 3JSVB 2LHEA 3B0AA 5E6NA 3VY9X 2KDFB 1NVID 2N4FA 5DCNA 3T9LA 2ZVNA 2KLCA 2DZMA 1JWAD 4XGAB 1R4NI 4GXBA 3LK3A 3AEAB 1U4AA 2FCNA 4ZRIA 3UQAA 4JQWC 1FCCC 3SDLC 1AWDA 1WMHB 2ZLDA 1V8CA 1XCQL 1ZXIA 4YTPB 1TGZB 1JCKB 3WALA 2GBKA 2M4NA 3QC8B 1L0XB 2B76B 3K19A 3R2IA 4MSMB 4D2KA 2KO3A 2UWQA 4NJ6A 1DYQA 2BTEA 3VXWA 1ZUD2 2ODJA 3L10B 4BFRA 3SHQA 2DAFA 3MTNB 2XK5A 4UB8O 1STEA 1TS2A 2WVPA 3DWOX 3SZDA 1WGYA 3P1MA 5FVNA 3O0EA 2K25A 2KQ7A 2MW5A 1CQVA 2N9KA 3ZNGC 3UQBA 4BKGA 1BH3A 4KKIA 1PQSA 1YJIA 3OAWA 1YJ1A 1AYFA 2DAJA 2XE2A 2W3SA 2KACA 1V97A 2WS3B 2MJDA 2Y3AA 3LK2A 2BWFA 3VR8B 3N1XC 3FC4A 3SZVA 1LM8B 3LB8C 2KX0A 3ZVVA 3HHMA 4PYUA 3I9V1 3VUYA 1I4GA 4M00A 1Q10A 2W82A 2F1TA 5AZFA 4OZAA 2JUOA 5KAFO 2WXMA 3VR9B 2PTLA 4MEMA 2WDQB 1ZHYA 4O49A 2AL6A 1GPXA 4PJ0O 1OPFA 3NVZA 1RM6C 3O65B 4IL6O 3GE8C 2CS4A 4GCSA 3V8UA 4WQOB 2FGQX 2BYVE 4KR4A 2M56B 2YEPF 2QCZA 4NPNA 1R4NB 2G3QB 3KH0A 2KXPA 4TQ1A 1ACCA 1GC7A 4URKA 2BS3B 1D6EC 1UD7A 2V4IB 2F1CX 4IWOA 1ZE3D 1HE8A 4LNKA 3V05A 1P9DU 2WDRB 1P7FA 4YWGG 1FEHA 3WA0A 2GOWA 2MLBA 2IO0B 2AWTA 4II2B 1SSNA 4RGNA 4O3ZA 3DBRB 1GFQA 3R7QA 3ZLZA 5E6JA 1VRAB 4RNAA 2EMSA 2PVGC 3WI4A 1QZEA 1MHHE 1YS5A 3S2AA 1KFYB 3VRBB 1OEYA 1BMLC 1PRNA 3C0RB 1M4VA 3QQ8B 3BWUD 1TZOA 5AZGA 1MI0A 3IT4B 1QJ9A 2RR9A 5IAAC 3LJ3A 4HKQA 5D3IB 4FUVA 2LHDA 1JALA 2EKEC 5G2NA 2FNJB 3ZDTA 4UB6O 1KRHA 1K53A 2NPTA 4WAAA 1N63A 3WAOA 3RUIB 3AE9B 2IO2B 2R4LA 4O4UA 4B61A 1XLPA 5IKCM 1UGJA 1QJPA 1ZGUB 2D3CA 1PGXA 1UF0A 1QF6A 2KKCA 4AYID 4HXDA 4MGKE 1RFAA 4XWTA 2K0LA 2K39A 1IGDA 2LGDA 1QOFA 5KAIO 2JYTA 2LVQA 2JRIB 4D64A 2GB1A 3PGEA 1WJ6A 2KDYA 3BINA 2Y5PA 2MCNB 4DQOC 3P4PB 2TSSA 1NI3A 3APDA 2PVOD 4O3WA 2Z0DB 2KT7A 2MH7A 3R66C 2ZZPB 5D6JB 1CJEA 4BUMX 4G76A 2IZVB 1QOGA 2LASA 2MBHA 4G3XB 4X57B 3AH7A 2MRPA 3ZTCA 3N1ZC 4LSHA 4RLCA 1TS5A 1WGGA 3AA7B 2FE8A 4GOCA 2O4VA 3AE4B 3PF1A 5E6OA 2Y0LA 3GP7A 3EFUA 3TIXA 2ICIA 1EF1A 3V62A 2C60A 3W5VB 2NVUI 2KLGA 4A20A 4AP4C 2V3SA 4B6WA 4ANUA 1E8WA 5TSSA 1IPGA 1T3QA 3PSEB 1UELA 1F2RC 2MHLA 4ZRKA 2NBWB 3UF8A 3R2TA 1JMLA 2KHWB 2IGGA 2BQQA 1SJED 3HVDA 3DWNA 1XLNA 1FXTB 5G38A 3DOWA 4MM3A 4MSQB 2N9LA 1YN3A 4NAMA 2KXPB 2KZRA 2XNAC 4I6LB 3U7ZA 4O3YA 3L17A 3PRZA 5G55A 4GDLA 3PRMB 1WE6A 1RFKA 2N9PC 1Z5SB 4FQEA 2G1EA 3DZMA 4DDGD 2GBMA 3N3KB 1IGCA 2PE6B 2LFUA 1WI0A 2I1JA 3AAAB 1E8XA 1D5XC 2BKRB 2ZVOA 4HPMB 2K4TA 1P4TA 2N7JA 4FOZA 2N9XA 2OOBB 3N32A 4W9LA 4BOZB 2DNFA 3V3XA 3NJTA 4A8XC 3HM6X 5C1ZA 3AU4A 4K1RB 3MJWA 4EEWA 2MBOA 4ASWC 3CSTA 2MEKA 5CTRC 4H2AA 1J7AA 2LMCA 2IGDA 2K8HA 3PRNA 2QDFA 2LEKA 1ZDVA 2LVPA 3PHWB 1BT0A 4LSFA 3RCZA 1SB3C 3JYUA 4AWJA 2M0XA 1YX6B 2BYFA 2LFIA 5C2TB 4FT6A 4F4BA 1EM7A 4NAWA 5MPOA 5AUIA 3RMKC 3VRAB 5J17A 1P3QU 2ZEQA 4JLCA 1N60A 3LDZE 3UINB 2SAKA 3DBHB 4WIPA 5HFYA 2X38A 1NI2A 3L54A 4D65A 2L3ZA 3VAWA 1L0VB 4MH0E 4BBNF 2XTRA 4CHKA 3FYXA 5DL5A 1H4RA 3HW9A 5TR5A 3GZNI 1GG3A 4O4XA 1KH0A 2LUMA 4DXFA 4FN2A 3RNEC 3FILB 1YIWA 2MA9B 3VY8X 3Q3FA 3D32A 4GU2A 4RF0A 2MBBB 2F1VA 4B0EA 4J6IA 3DPDA 1ORMA 2K3UA 2W55A 2LZ6A 2M07A 2MSED 3L08A 1FXAA 2K9XA 4HJGE 2YEPB 2KX3A 2X9KA 2RDHA 4LSEA 1WJ4A 2FCSA 3VFKA 1L4DB 4RJXA 3HIZA 2L0TA 3TUOA 1WIAA 3PLUA 2LXCA 2AX5A 1LGRA 1TZ1A 4KZCA 2J53A 2GLSA 2XE3A 2XG6A 4C69X 2IY1B 3PT2B 2JF5A 3H7PA 4JX1C 5AEKB 3UIOB 1E7UA 3AM9A 4MJSA 2PMVA 1LXDA 3PZDA 4C4VA 1NEKB 1ZXHA 1GB4A 2N2LA 3DWGC 5G39A 1ZP0B 2JQRB 3VZUX 2NMQA 4ICUA 2AXTO 2M19A 2C5LC 1DOIA 2IWVA 1UGMA 2M1MA 1A70A 4AJWA 5HI1A 3BVZA 2FUG1 4F7ZA 3RPFC 1F2RI 5C23A 2Z0EB 3ZJVA 3Q3JA 4K81A 4HKZE 5TISO 1X1MA 2E6XA 2KFKA 2QIEB 2N7DA 5IOIA 1B1ZA 2D10A 5FR6A 3AA1B 2KTRA 1N62A 4RM8A 2L1AA 5IO9A 2KZ7B 1SGHA 1HXTA 2K8CA 3I3TB 3VZWX 3E56A 4AKMA 1JRUA 4AYDC 2RSUA 2KN4A 2J0JA 5EE9A 4QQ1A 3IVFA 4UDUC 3HOEA 2PLPA 4ANWA 2JU6X 5KHOA 2VZKD 5DPRA 1R7SA 1JW9D 2NTSA 4E1TA 4XZ4A 2H89B 3SEBA 4ZRPA 2WWZA 1SE3A 5JH5C 1PGBA 1T0QC 3W2DA 4R3DA 2WJQA 3OWEB 4WQMA 3KYCD 2AQ2B 3Q3OC 1XO3A 2LGXA 1L7YA 1V6EA 4OHJA 3ZNZB 4PS3A 4ARIA 1V81A 4NQLB 4HCPB 1I7HA 1Q9GA 3NHEB 3TBLD 5G5HA 3AEFB 3U8ZA 3IHPC 2KK8A 5LXIB 2DYOA 1R4MB 3AE2B 3HOLA 2W80C 1P7EA 1V1PA 4M8NA 2ASQA 2V0GA 3VQIA 2V1YA 1HQRD 4EE2A 2QTKA 4G75A 2LGIA 1Q5WB 3ONSA 1DOYA 1WSPA 2L52A 4RH6A 1QLBB 4FZNA 3U2SC 2L83A 2J0KA 2RGFA 1FFVA 3Q8FA 4REZA 1PUTA 2DZJA 2M06A 2IY0B 3UGBB 2KMCA 2R8AA 1WYGA 2KMMA 2GBRA 3TSSA 2XTQA 3BK1A 3RZWC 1YX5B 1L0YB 1E6EB 3DA4A 2L0FA 2K1FA 1HA5A 2K5PA 2UU7A 3KUDB 2Y2XA 1KLVA 1L6VA 4LTUA 3P4QB 2LWPA 3RBHA 2L8JA 3OJ4B 4TKNA 4QAYA 2INPE 1HTOA 4WH4A 1T0YA 3IXSA 1YN4A 2ERVA 1RWSA 1GFNA 3QARA 3UAQA 4G0NB 2YPVA 3GE3C 3PHXB 3PLVA 4CQNA 5IP4D 1MHXA 2GBNA 5BYQA 2WXOA 4AYEC 4MDKE 1H8CA 2CR5A 3ZRFA 1WFYA 3KWLA 2OEDA 1J7BA 3Q2AC 3LK2B 4ZYNA 4W9GA 1E7PB 5DPTA 3MC9A 1KF6B 4HDQA 3AAEA 4FJVB 2RPVA 2NBUA 1EO6A 3BVGA 2LJ5A 4FHJA 5JDPA 3ZYYX 3RZFA 4C80A 1ZHXA 2DWQA 3HWBA 2K8BA 4M8MA 4A9AA 3A1QB 1GFPA 1TY0A 4L2YA 3H7SA 1N5WA 4MM3B 4G11A 3MFGA 1IZNA 1EWYC 2A4ZA 3AA0A 1KJTA 3SU8X 1GB1A 2PORA 4LDTD 1HTQA 2DYBA 4TMAB 4FZLA 1G90A 2K22A 2N1VA 3NZSA 2NPTB 1MG8A 3A9KB 2IO1B 2M0AA 1HXUA 3A1QA 3C5OA 2R61A 1WX9A 4A90A 1H6S1 1F0ZA 3POUA 1V5OA 4DWFA 4FULA 1WRDB 1WM3A 3FKYA 4O3XB 2KJ6A 4XDDA 3JSVA 4ANVA 1SXTA 3IAM1 1HXXA 2H88B 4PR7A 2ZNVC 1SIFA 1N61A 1N5XA 3QIJA 3ML9A 5AUKA 1T0RC 4ZRJA 3QCAA 3WANA 2KC0A 1C1YB 2IDYA 1SJHD 5ADXK 3AA1A 1XCTL 2D5GA 1I4HA 3A0HO 2LXAA 2WQYB 4BKSD 3GS2A 4L23A 5JHAA 1E8YA 1I4QA 4GCPA 3QJZA 2EKIA 2K6DB 2JY6A 1L2NA 2VZKB 1C3TA 4JIOU 3ETRA 4W9EA 1RLFA 4GF4A 2I1KA 3KWVA 2KJRA 3B1LX 3AMZA 3A33B 1OQYA 3VTVA 2XK5B 1OEYJ 4HROA 2IGHA 1EUVB 1HXYD 1J19A 2WHIA 2J42A 3N30A 2LUEA 1V49A 2PE9A 3DQVA 3AA6B 2WYQA 1LO5D 4FSOA 3O13A 5AZHA 1ET9A 2PRNA 1IUEA 4A3PA 3TEZA 2GRIA 1EF5A 3DVGY 4C7YA 2KTFA 4JL9A 4EOYA 2KN5A 3AE1B 5G26A 2CKHB 1THQA 1MM4A 8PRNA 4C00A 4HPPA 4LNNA 2GI9A 2BGFA 3TEYA 1WXQA 1FFUA 4B95A 4NQKE 2Y0HA 3CSFA 2J1NA 3KZIO 2KZ7A 3Q8BA 3MP9A 4KV2A 5G5GA 1L6UA 4TQ0A 3CWIA 1GJZA 2X27X 4NNJB 4KZ0A 1BT9A 2KWDA 1CZPA 2KDMA 2BPSA 2ZFGA 4IDIA 2I2YA 2KC2A 5HG2A 5B66O 1JWSD 4HDOA 1SIJA 2KDIA 1QT9A 5BMHA 1K8RB 3BRYA 1WWTA 4P6VF 4S17A 2DX5B 1OFFA 5D94A 1TJEA 3AA7A 2BT6A 2WXHA 1XXGA 1IYFA 1WE7A 4XYCA 1JWBD 5C3JB 3X23A 3GOEA 2ZCBA 4RL9A 2WX0A 2Y5BB 3KLSX 1YD8U 4RFBA 3OG5A 1LFDA 2O6VD 1EU3A 4E71A 2JXXA 2LRUA 1UBQA 2NBVB 2D3GA 4RGTA 2WXFA 1VJKA 2CU1A 3ZKJC 3RYTA 1F1HA 1TY2A 4FRXA 2PIAA 1WY8A 3TMPB 3P4RB 3AEEB 3KUCB 3PV1A 5JHBA 3UI3A 2LD9A 2M17A 5G3AA 2W3RA 4GIVA 4LCDE 1GFMA 3AEGB 2O2VB 2JYEA 1I42A 3POXA 4KVGB 2KDEB 1WGRA 2BBCA 1DOXA 2DBYA 4AFKA 2INDC 4LK0M 4YTNB 4AKRB 2WXJA 2JZPA 2BYEA 1J0GA 4LJOB 2Y5CA 3Q3MC 3G7GA 3QA8A 3AEBB 1DGJA 2M8SA 4NJCA 1TKGA 2KXJA 1ZKHA 2MQJA 4HLEA 1KOTA 5HKHA 3ZQ4A 1R4MI 3APFA 3BYYB 1YQBA 4AKRA 4PT5A 3A2SX 4Z3TA 1WXVA 4FJZA 2NR2A 4P7IA 1C79A 3AB5A 1HEZE 3M95A 2MP2A 5FK9C 1F52A 2CU3A 1Q1OA 5DPSA 3Q8CA 2WXNA 5IA7A 1UWMA 1V1PB 3P2BA 1QOBA 4K3BA 1J7CA 2IBIB 4WWOA 3QRCA 2AL3A 4B9KA 1PHOA 3M62B 3L13A 5D2MB 3P63A 5EE3A 2ZCCA 4JE3B 2L00B 4EZJA 4WJOA 3BZDB 4P1BC 3ZO5B 4RF1A 3BS0A 4JFBA 3PVLA 3JTYA 1E54A 2D07B 1K50A 1TKEA 1ZOYB 3PREA 3EFCA 1WGHA 4FJYA 3AULA 4FZMA 4W9CA 2KWCA 4OW0A 2KQSA 4KRAA 3LK42 2MHJA 2KTRB 3RI7C 3K9OB 2MNHA 1TTNA 3CIRB 4ITKA 4ZYSA 4W9DA 1QOAA 2WXIA 1I4PA 3DBLI 2KANA 4XNLA 3W1YA 5CHFA 5J18A 4KIKB 1SBBB 4LSIA 2CJOA 4N58A 2WU2B 4FLHA 4IKGA 4IOIE 3W5UB 4HWIB 2JT4B 3CMMB 2DYMA 3MHSD 1FCLA 3PZ7A 2FIFA 2PEAA 1QQRA 1KLGD 2WXGA 3RULA 2ZW0A 4WURA 1MFWA 2MX2A 5GXGB 3VZTX 3Q3NC 4US8A 1V1OA 3MJ5A 4HPLB 3DA3A 4YL8A 4F1SA 1MJDA 4DHJD 3LXFA 3EC8A 4M0WB 5EDSA 4ICVA 3VH3B 2WXLA 1PFDA 2XE5A 3ZXRA 2WU5B 4WJQA 2NTTA 3HVZA 1BXTA 1WX7A 3DVNU 2FIDA 3RNFC 1OTRB 2CHXA 3LK41 4LNFA 2E3TA 1AW7A 1FRDA 2JZZA 1Y8RC 3AV8A 2AQ1B 1IBXB 2C7HA 4MGIE 4NY0A 2JZ3B 2GMIC 1YJJA 4C56C 2V4LA 2QEJC 4AUQC 1CMXB 2JXTA 2LVOA 1OSMA 2MJEA 2KVRA 4IWPA 2MWSB 4JWSC 2N0SB 2G45B 1MM5A
chains in the Genus database with same CATH topology
3NVYA 4FRTA 1PGXA 5D3DA 3T3OA 1KF6B 3L4PA 5BMGA 1FNUA 3AAEA 4E1SA 2BB5A 2K0PA 3SFDB 4FESA 1QF6A 2RPVA 3AE5B 4AYID 1ZHZA 4XWTA 5DL8A 3BVGA 1B9RA 2BB6A 2K0LA 2ACZB 4AQ7A 1IGDA 1QKZA 5JDPA 3ZYYX 1QOFA 4C80A 1ZHXA 1C78A 2DWQA 3HWBA 4FMSA 4A9AA 2CJNA 2JYTA 1GFPA 1TY0A 4L2YA 1N5WA 2HDEA 4D64A 2GB1A 3B2GA 4MM3B 2L32A 1YN5A 3MFGA 4GCQA 1IZNA 2KDYA 2Y5PA 1GFOA 1GAQB 1EWYC 3P4PB 2TSSA 1NI3A 4AYMC 3VE1A 4DQOC 2PVOD 3PORA 1T5XD 4O3WA 3AA0A 4P16A 2MH7A 3C8YA 2W54A 1GB1A 3AA0B 5FR3A 2PORA 1YNTE 1CJEA 1ENFA 3BVMA 4BUMX 1TS3A 4G76A 5I4DA 3SFEB 3PQSA 2ZW1A 4TMAB 4FZLA 1G90A 2K22A 1QOGA 2M0AA 4HRSA 2KQ4X 1HXUA 3HUIA 2OHFA 3C5OA 1QILA 2ON8A 2R61A 3AE7B 3AH7A 4HEA1 3Q69A 4JPSA 4LSHA 4RLCA 1TS5A 2WXRA 2AQ3B 3AA7B 2FE8A 1I4XA 2O4VA 3AE4B 4A90A 1H6S1 1F0ZA 3POUA 1HZ6A 3WCQA 2Y0LA 1ESFA 3B9JA 3GP7A 3NVWA 1MVKA 2ICIA 4O3XB 1FXIA 3W5VB 3AAEB 4XDDA 3AE3B 4YXDB 2LHFA 1SXTA 1VZ8A 5TSSA 1T3QA 1K51A 5DL7A 3IAM1 1F2RC 2MHLA 1HXXA 2DLBA 2H88B 3R2TA 1FRRA 1YQ4B 3ZGZA 1L5PA 1JMLA 4OVZA 1N61A 1N5XA 2IGGA 1VZ6A 3MHZA 5AUKA 1SEBD 1SJED 3HVDA 2KC0A 2IDYA 4JCHA 1XLNA 1SJHD 3N9YC 5ADXK 5JXVA 3AA1A 1XCTL 2D5GA 3PQUA 1JROA 1I4HA 2N9LA 4ARCA 4KGSA 1YN3A 5BYRA 4NAMA 3AECB 2WQYB 2KXPB 3GS2A 5T5FA 4AUIA 2XNAC 3PO0A 4L23A 5H8YE 4O3YA 1TS4A 3U7ZA 4YSYB 1I4QA 3URYA 3GP6A 4GCPA 1OQQA 2QJLA 3EUB2 2SEBD 1T6BX 4O1NA 2GE4A 3TEXA 2EKIA 1RFKA 5LNK1 3TEWA 2G1EA 2VZKB 3DWMA 1BUIC 4U9CA 1IGCA 3ETRA 2LFUA 2KAJA 4GF4A 3AAAB 3KWVA 1ZHWA 1PYWD 1EU4A 1TKYA 3AMZA 3IAS1 1D5XC 3U4EG 2V3NA 4DXGA 3QRAA 3SYBA 2BYTA 4HROA 2IGHA 1HXYD 3BYTB 4RCOA 4US9A 2J42A 1NENB 3KVDD 2K4TA 1OQRA 3AA6B 1TYGB 1P4TA 4N59A 2N7JA 3LYYA 1LO5D 4FSOA 2OMFA 7PRNA 4FOZA 5GV0A 3O13A 5EE0A 1ET9A 2PRNA 5DL6A 3ZJTA 5T8IA 3U52E 2IPKD 1IUEA 4NZLB 2QSDA 3V3XA 2QMTA 4A8XC 1K52A 1E10A 3TEZA 2GRIA 4N6EB 4C7YA 3SYSA 5PRNA 2FGRA 5IYUA 1C77A 2XE1A 3R8BA 1FO4A 3AE1B 2MEKA 2Y0KA 5G26A 2PW9A 3SY7A 1UUPA 3E9SA 4H2AA 1THQA 1J7AA 1MM4A 2LMCA 4AZLA 1E9MA 2WLBA 8PRNA 4ZOHC 3NSGA 2IGDA 2GI9A 3PRNA 1WXQA 2LEKA 3TEYA 5ADXL 1ZDVA 3IT6B 1FFUA 1IBXA 4LSFA 1WGKA 2WXPA 3Q8AA 1SF0A 2Y0HA 1SB3C 3BK2A 4J3OD 2J1NA 3Q8BA 2KZ7A 4XE0A 3MP9A 5G5GA 1CK1A 1L4ZB 1L6UA 4TQ0A 1C9FA 3TZGA 3CWIA 1D5MC 3RFZB 2X27X 4KX6B 2LFIA 5C2TB 2BS4B 1BT9A 2KWDA 4FT6A 4NAWB 3T3NA 4F4BA 1CZPA 2KDMA 1EM7A 2ZFGA 2BW2A 2RMMA 1IZNB 4KGRA 5AUIA 4IDIA 5MPOA 1JQ4A 5BYSA 2I2YA 3VRAB 1I4RA 5HG2A 1UNSA 1JWSD 1FNWA 1N60A 1SIJA 2Q5WD 1QT9A 2QILA 3FILA 3AN1A 5BMHA 2SAKA 4AYNA 4WIPA 5HFYA 2WDVB 2X38A 4MH8A 1C4AA 4D65A 1WWTA 1ROEA 4P6VF 1GOZA 1L0VB 1OFFA 2XTRA 1ZHTA 3ABVB 3AE8B 3BIID 3FYXA 5DL5A 5H92C 1C4PA 1KTKA 1TJEA 3HW9A 3UU2A 3FAHA 3AA7A 3P4SB 2BT6A 4O4XA 1KH0A 2EELA 2LUMA 1HZ5A 2Z8LA 1NYRA 2WP9B 4FSPA 1XXGA 2WXHA 4GLSC 4DXFA 3T20A 1JWBD 4LLGM 5C3JB 4YSZB 3NZ3A 3FILB 4RL9A 3VY8X 1D4BA 3KLSX 1XF5L 4RFBA 5FKAC 2RDGA 1D5ZC 1ET6A 4RF0A 5AFUK 2W81C 1EU3A 2F1VA 4ZRQA 1E0ZA 4C7ZA 4B0EA 1FNVA 1ORMA 3KQ4A 2K3UA 5AFUL 3P42A 1AN8A 4D5UA 2W55A 4L1BA 2M07A 1ZPSA 4RGTA 4XWWA 4B0MA 2FBWB 2YNKA 2WXFA 3SY9A 4YSXB 3T0SA 1VJKA 1FXAA 3NVVA 2K9XA 4HJGE 2YEPB 4JWUC 2RDHA 4LSEA 4ZHOA 1YMHE 1L4DB 4RJXA 1TY2A 3AA6A 1FM0D 4FRXA 2WXQA 3TUOA 2PIAA 4ZHPA 5EE1A 3P4RB 1MPEA 3AEEB 3PZ8A 4RGMA 2AX5A 5BMIA 2INNE 2J53A 4A55A 1FMAD 1FIQA 2XE3A 2XG6A 4C69X 1VDVA 3H8HA 3UI3A 3J9CA 2LHEA 2W3RA 4OZCA 1GFMA 3NRZA 3Q8EA 2JMMA 3AEGB 4JX1C 2JYEA 3VY9X 1NVID 3POXA 1VR9A 3AM9A 2PMVA 2J4UP 1JWAD 3W9CB 2BBCA 1DOXA 2DBYA 1NEKB 4AFKA 4AS1A 5D5DA 1ZXHA 3LK3A 1C76A 3AEAB 3HRDD 4LK0M 1GB4A 2N2LA 1BXWA 4YTNB 3DWGC 4AKRB 3EA6A 1ZP0B 2JQRB 2WXJA 5D7GA 1FCCC 3VZUX 2HTME 2NMQA 4RLBA 4TSSA 2JZPA 1AWDA 4KKJA 2ZLDA 3SR6A 2Y5CA 2M19A 2PKOA 1V8CA 1XCQL 1ZXIA 3VE2A 4YTPB 1DOIA 3G7GA 3AEBB 1A70A 1DGJA 1WRIA 1JCKB 4NJCA 1TKGA 2Y7SA 5HI1A 1L0XB 3BVZA 4GDLB 2B76B 3K19A 2FUG1 3R2IA 3RPFC 1F2RI 4D2KA 2V3PA 4WWMA 3ZJVA 2J52A 4HKZE 3NS1A 2LJIA 3ZQ4A 1DYQA 2E6XA 2JX5A 2QIEB 3BYYB 2BTEA 4AKRA 4PT5A 3NUHB 3A2SX 1B1ZA 1C4CA 1ZUD2 2ODJA 4Z3TA 1JWMD 3AA1B 2JWUA 1N62A 2L1AA 1UWXA 1C79A 1STEA 4GDKB 4KGTA 3T24A 1TS2A 3AB5A 2ONQA 3P1MA 3SZDA 2KZ7B 1HEZE 5FVNA 5FK9C 3O0EA 1HXTA 2N9KA 1CQVA 2CU3A 3VZWX 3E56A 4AKMA 6PRNA 1BH3A 4AYDC 3Q8CA 2WXNA 4KKIA 2KN4A 1YJIA 1UWMA 1V1PB 5EE9A 4QQ1A 1AYFA 4MACA 1QOBA 4UDUC 5EE2A 2XE2A 3HOEA 2W3SA 4OZBA 2KACA 4YT0B 1V97A 2PLPA 2WS3B 2BS2B 1J7CA 1EWCA 1KLUD 2MJDA 2Y3AA 3LK2A 2JU6X 3QRCA 2VZKD 3VR8B 1QJ8A 1F77A 2G9HD 3FC4A 3SZVA 2J4XA 1PHOA 3LB8C 1R7SA 4RGOS 1JW9D 2NTSA 3LK3B 4E1TA 3P63A 4YTMB 5EE3A 3EGRA 4JE3B 4WAFA 3WI5A 2H89B 3I9V1 3BZDB 1I4GA 2XN9C 3SEBA 4ZRPA 1SE3A 4RF1A 1VLBA 4JFBA 1Q10A 1PGBA 3JTYA 2W82A 2F1TA 1E54A 3W2DA 4R3DA 1XLOA 4KR8A 4OZAA 2WXKA 3OWEB 4WQMA 1K50A 1TKEA 4FXCA 1ZOYB 2WXMA 3VR9B 2PTLA 2AQ2B 4FZMA 2WDQB 1XO3A 2JSVX 1SE2A 4OHJA 4OW0A 1ZHYA 4O49A 1GPXA 1OPFA 4ARIA 4KRAA 3LK42 2WNMA 1RM6C 3NVZA 1FD6A 1YQ3B 1I7HA 3EMNX 4GCSA 3V8UA 2MJ3A 4Q2JA 1Q9GA 2MNHA 4RJWA 2FGQX 1MPFA 3CIRB 4ITKA 4KR4A 5G5HA 4ZYSA 3AEFB 1XLQA 1Y56A 4PUXA 1QOAA 2M56B 2WXIA 1I4PA 2YEPF 4XDCA 2DYOA 1NYQA 1SE4A 3HOLA 4XNLA 3AE2B 5HHDG 2W80C 1P7EA 2KXPA 1SBBB 4TQ1A 1ACCA 4LSIA 1V1PA 2CJOA 4N58A 2BS3B 1D6EC 2V4IB 2WU2B 2V0GA 2IJ0A 4IKGA 4IOIE 3VQIA 3W5UB 1ZE3D 3MC0B 1PGAA 1HQRD 4EE2A 2QTKA 4G75A 2DYMA 2LGIA 2N2MA 1DOYA 1FCLA 3PZ7A 3I57A 3V05A 1QQRA 1KLGD 1P7FA 2XMXA 1FEHA 1WSPA 2L52A 1QLBB 2WDRB 2WXGA 3AE6B 4FZNA 4RH6A 3U2SC 2L83A 2ZW0A 3W1SA 1SSNA 4WURA 1FFVA 3Q8FA 4RGNA 4O3ZA 1PUTA 4REZA 2M06A 3ZJUA 5GXGB 3VZTX 4US8A 1GFQA 5E6JA 1V1OA 1WYGA 2KMMA 3MJ5A 3TSSA 1VRAB 4RNAA 2XTQA 3DA3A 2PVGC 3BK1A 3WI4A 3LXFA 4A6QA 1JRPA 1L0YB 1MHHE 1YS5A 1E6EB 3DA4A 4M0WA 1KFYB 1PDXA 3VRBB 2WXLA 1VZ7A 1BMLC 1HA5A 2K5PA 1PFDA 1PRNA 2XE5A 4XNKA 1M4VA 2Y2XA 2WU5B 1L6VA 4MT5A 2NTTA 3HVZA 1BXTA 4LTUA 3P4QB 3BWUD 1TZOA 1MI0A 3RBHA 3GB1A 3AEDB 3IT4B 3LK41 1XEEA 2E3TA 2INPE 1AW7A 4YWGG 1QJ9A 1FRDA 3B2FA 3POQA 3IXSA 4WH4A 1YN4A 2I38A 3AV8A 2AQ1B 4HKQA 3AAAA 5D3IB 1IBXB 4FUVA 2ERVA 2LHDA 1JALA 1RWSA 1GFNA 3UAQA 1KRHA 1YJJA 1K53A 1N63A 2YPVA 4USAA 4C56C 4CQNA 1MHXA 2QEJC 3AE9B 5BYQA 2WXOA 4AYEC 1Q9FA 4O4UA 1RYJA 4B61A 1ZDXA 1JWUD 1XLPA 3UPGA 2JXTA 3KWLA 1OSMA 2OEDA 2MJEA 1UGJA 1J7BA 1QJPA 4JWSC 2N0SB 3LK2B 4GHBA 1E7PB 1MM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJK A;  1FXA A;  3NVY A;  3NVV A;  2K9X A;  2FBW B;  4JWU C;  1KF6 B;  3L4P A;  3VR9 B;  4ZHO A;  4HRO A;  4FZM A;  4US9 A;  2WDQ B;  1NEN B;  1XO3 A;  4HRS A;  3SFD B;  4YSX B;  1QF6 A;  3AE5 B;  1FM0 D;  1OQR A;  1GPX A;  1TYG B;  2PIA A;  4ZHP A;  4N59 A;  3P4R B;  5EE1 A;  1B9R A;  2ACZ B;  3AEE B;  3NVZ A;  1RM6 C;  5EE0 A;  1YQ3 B;  2AX5 A;  3ZYY X;  1I7H A;  1QOF A;  2MJ3 A;  4C80 A;  2DWQ A;  1FMA D;  1FIQ A;  1VDV A;  1IUE A;  4A9A A;  2CJN A;  2W3R A;  3NRZ A;  3CIR B;  1E10 A;  4ITK A;  3AEG B;  4JX1 C;  4N6E B;  1N5W A;  3AEF B;  1XLQ A;  5G5H A;  4C7Y A;  1NVI D;  1QOA A;  2M56 B;  3B2G A;  3AM9 A;  1NYQ A;  1JWA D;  3AE2 B;  3W9C B;  1FO4 A;  3AE1 B;  1DOX A;  2DBY A;  1NEK B;  1GAQ B;  1EWY C;  3AEA B;  1J7A A;  1NI3 A;  3HRD D;  2CJO A;  3P4P B;  4N58 A;  1E9M A;  2BS3 B;  2PVO D;  2WLB A;  2WU2 B;  4ZOH C;  4YTN B;  3DWG C;  1ZP0 B;  2JQR B;  2MH7 A;  3W5U B;  2W54 A;  1WXQ A;  2LEK A;  2HTM E;  1FFU A;  1AWD A;  1CJE A;  1WGK A;  3SR6 A;  1SF0 A;  4G75 A;  4G76 A;  1V8C A;  1SB3 C;  1ZXI A;  2M19 A;  2PKO A;  1DOI A;  2Y5C A;  4YTP B;  3SFE B;  1DOY A;  4FZL A;  2K22 A;  5G5G A;  3AEB B;  1L6U A;  2WDR B;  2XMX A;  1A70 A;  1QOG A;  2L52 A;  1QLB B;  1DGJ A;  3AE6 B;  1WRI A;  4FZN A;  2OHF A;  3CWI A;  3HUI A;  3AH7 A;  2L83 A;  1TKG A;  3AE7 B;  4KX6 B;  5C2T B;  1FFV A;  2B76 B;  2BS4 B;  3RPF C;  1PUT A;  4WWM A;  1CZP A;  5GXG B;  4US8 A;  1JQ4 A;  5MPO A;  5AUI A;  3NS1 A;  4IDI A;  1WYG A;  2KMM A;  3AE4 B;  3VRA B;  1F0Z A;  2JX5 A;  2XTQ A;  3DA3 A;  2PVG C;  2QIE B;  4FXC A;  3LXF A;  1N60 A;  1SIJ A;  3WCQ A;  2Q5W D;  1JRP A;  1QT9 A;  1ZUD 2;  3B9J A;  1E6E B;  3DA4 A;  3AN1 A;  3NVW A;  1KFY B;  1PDX A;  3VRB B;  1FXI A;  1N62 A;  3W5V B;  2WDV B;  2K5P A;  1PFD A;  3AB5 A;  3AE3 B;  4YXD B;  3P1M A;  1T3Q A;  2WU5 B;  1WWT A;  1ROE A;  1L6V A;  4P6V F;  3HVZ A;  4LTU A;  3P4Q B;  2CU3 A;  1L0V B;  1OFF A;  2H88 B;  1FRR A;  1YQ4 B;  2XTR A;  1L5P A;  3ABV B;  3AE8 B;  3BII D;  5H92 C;  1N61 A;  1UWM A;  1N5X A;  1YJI A;  3AED B;  1AYF A;  5EE9 A;  1QOB A;  1TJE A;  2E3T A;  2W3S A;  3FAH A;  3P4S B;  4YT0 B;  1FRD A;  2BT6 A;  1V97 A;  3B2F A;  5AUK A;  1NYR A;  2BS2 B;  2WP9 B;  1XLN A;  2WS3 B;  1J7C A;  3AV8 A;  2MJD A;  1JRO A;  1JWB D;  3VR8 B;  5C3J B;  1JAL A;  1RWS A;  4YSZ B;  3FC4 A;  3AEC B;  2WQY B;  3LB8 C;  1R7S A;  1KRH A;  1JW9 D;  1YJJ A;  1N63 A;  4USA A;  3PO0 A;  5H8Y E;  3P63 A;  4YTM B;  4YSY B;  3AE9 B;  5EE3 A;  1OQQ A;  2QJL A;  3EUB 2;  2H89 B;  1RYJ A;  2EKI A;  1RFK A;  1VLB A;  1E0Z A;  1XLP A;  4C7Z A;  3KWL A;  2G1E A;  2MJE A;  3DWM A;  1XLO A;  1J7B A;  2W55 A;  3ETR A;  4WQM A;  2KAJ A;  1TKE A;  4JWS C;  2N0S B;  1TKY A;  1ZOY B;  1E7P B;  3AMZ A; 
#chains in the Genus database with same CATH topology
 3NVY A;  4MJS B;  2R88 A;  3T8M A;  3L4P A;  5BMG A;  1FNU A;  4E1S A;  2BB5 A;  4FA6 A;  4PS7 A;  4FES A;  3SD5 A;  2JPH A;  4RM9 A;  5DL8 A;  3ZNH B;  1B9R A;  4AQ7 A;  2ZNV B;  1C78 A;  2R89 A;  4N9F 4;  4FMS A;  2MBE A;  2CJN A;  2N1W A;  1WR1 A;  2MP2 B;  4DHZ B;  3B2G A;  2L32 A;  4GCQ A;  4XC2 A;  1GFO A;  4G50 A;  4RMA A;  1GAQ B;  4AYM C;  3VE1 A;  3POR A;  1N6Z A;  3M3J A;  4P16 A;  1NBF C;  2W54 A;  3AA0 B;  5FR3 A;  1YNT E;  1ENF A;  3BVM A;  1T0S C;  5I4D A;  3SFE B;  3PQS A;  1V2Y A;  2XBB C;  2ZW1 A;  2LGS A;  4HRS A;  2KQ4 X;  3HUI A;  3L16 A;  2C9W B;  3AE7 B;  3Q69 A;  3VTW A;  4JPS A;  3QX1 A;  2WXR A;  3QAQ A;  1ESF A;  3B9J A;  4K7U A;  3NVW A;  5LLI A;  2PJH A;  3AAE B;  2O6V B;  5E79 O;  3AE3 B;  3X0W A;  3VH4 B;  1K51 A;  3AI5 A;  5DL7 A;  3N1Y C;  4LNI A;  4MGZ E;  3ZGZ A;  1YQ4 B;  2DHZ A;  4OVZ A;  4HJK A;  4XX5 A;  1WF9 A;  3OLM D;  4W9F A;  4BOS C;  1SEB D;  2KJH B;  4JCH A;  1Z2M A;  3N9Y C;  4P1C C;  5JXV A;  2BVC A;  1JRO A;  2KOX A;  4TV3 A;  4ARC A;  5BYR A;  4ZDV A;  3AEC B;  5LXH A;  2A5U A;  4PYZ A;  3PTF C;  5T5F A;  4AUI A;  4E3C A;  4BBN C;  4YSY B;  1E8Z A;  3URY A;  3GP6 A;  2KMA A;  3EUB 2;  3TEX A;  1T6B X;  4O1N A;  4WWN A;  5E6P A;  1KM7 A;  1V5T A;  3V6C B;  4HK2 A;  3DWM A;  3ZRC A;  1ZHW A;  1TKY A;  2ZJD A;  3TL5 A;  3U4E G;  2V3N A;  3QRA A;  3SYB A;  4W9J A;  4US9 A;  4II3 B;  3KUZ A;  1OQR A;  4BAX A;  4WJP A;  7PRN A;  5GV0 A;  5EE0 A;  3HM3 A;  5DL6 A;  1AAR A;  3ZJT A;  5T8I A;  2CHZ A;  2IPK D;  4NZL B;  2QSD A;  2Z59 B;  2QMT A;  1K52 A;  2D3B A;  3ML8 A;  4OVU A;  2XE1 A;  3H1U A;  3BY4 B;  5J2R A;  2PW9 A;  3KVF B;  3SY7 A;  2G4S A;  4AZL A;  1E9M A;  2WLB A;  4BKT A;  1XQQ A;  2J7Q B;  5ADX L;  4KDI C;  2KWU B;  1IBX A;  3Q8A A;  2WXP A;  1SF0 A;  4S0R A;  2XEW A;  2C7N B;  4J3O D;  2WGS A;  4XE0 A;  3H9D A;  3WIM A;  1CK1 A;  1L4Z B;  1P98 A;  3QHT A;  4LNO A;  1C9F A;  4GSW A;  4KX6 B;  3NG0 A;  3PGR A;  3T3N A;  2BW2 A;  1IZN B;  3RT3 B;  3IG3 A;  1MG4 A;  1I4R A;  1UNS A;  1FNW A;  2Q5W D;  2QIL A;  3FIL A;  1T1L A;  1P1A A;  4AYN A;  2KC1 A;  3VUX A;  3A9K A;  4MH8 A;  1C4A A;  3L0W B;  4GDK A;  5CHW A;  2C7M B;  1ROE A;  4IW0 A;  1GOZ A;  3JCU O;  2KFJ A;  5H2F O;  4ACF A;  3BII D;  3PRP B;  3AE8 B;  2B3A A;  5H92 C;  1KTK A;  3A4S C;  3DBS A;  2KYW A;  2RPQ A;  2Z8L A;  3ZW3 A;  1NYR A;  1G6J A;  4FSP A;  4GLS C;  3NZ3 A;  3JVZ X;  3B08 A;  1XF5 L;  3NOB A;  5GTI O;  5FKA C;  2RDG A;  4GN1 A;  1UBI A;  2W81 C;  2JWZ A;  1E0Z A;  4TUU A;  1FNV A;  3P42 A;  4M01 A;  4D5U A;  1ZPS A;  4XWW A;  4B0M A;  2FBW B;  2YNK A;  4YSX B;  4JWU C;  3ZNI D;  1TBE A;  2KD0 A;  1FM0 D;  2R4P A;  2WXQ A;  1LQB A;  4IM2 A;  2MBQ A;  4W9K A;  4ZHP A;  1MPE A;  3HK0 A;  4EFO A;  2W9N A;  5BMI A;  2INN E;  2K6Q A;  4A55 A;  1FIQ A;  1VDV A;  3H8H A;  3J9C A;  3A0B O;  1WXA A;  3U30 A;  4OZC A;  3VDZ A;  3NRZ A;  3Q8E A;  3KYD D;  2JMM A;  1VR9 A;  2J4U P;  3W9C B;  1WYW B;  4AJY B;  3WAP A;  3OJ3 A;  4AS1 A;  4DBG A;  5D5D A;  1C76 A;  3HRD D;  1BXW A;  3EA6 A;  1WM2 A;  4HCN B;  5D7G A;  3RNC C;  2HTM E;  4RLB A;  4TSS A;  4KKJ A;  2AYO B;  4CO7 A;  3Q14 C;  3SR6 A;  4DHZ E;  2PKO A;  3VE2 A;  2KDB A;  1GC6 A;  2IYD B;  4I6P A;  1A5R A;  1WRI A;  1WJN A;  2Y7S A;  4GDL B;  1UZX B;  2KNB A;  2V3P A;  4WWM A;  2J52 A;  2VH2 A;  1WZ0 A;  2YLM A;  4C4V B;  3NS1 A;  2LJI A;  3DHH C;  2WDT B;  1E5W A;  2JX5 A;  4K3C A;  3NUH B;  1C4C A;  1JWM D;  3A9J B;  2JWU A;  1TIF A;  1UWX A;  4GDK B;  4KGT A;  3T24 A;  3QK0 A;  2ONQ A;  2KVZ A;  3V61 A;  1D3Z A;  2BWE S;  4I6N B;  6PRN A;  4WJN A;  1E90 A;  4MAC A;  5EE2 A;  3Q6B A;  4OZB A;  4YT0 B;  4AOF A;  2BS2 B;  5GMV A;  1EWC A;  1KLU D;  2L7R A;  1QJ8 A;  5B5E O;  4LDT B;  1F77 A;  2G9H D;  1XD3 B;  2J4X A;  4RGO S;  4CTD A;  3LK3 B;  4YTM B;  1OGW A;  3EGR A;  2YVC A;  4WAF A;  3WI5 A;  2XN9 C;  1VLB A;  3ALB A;  4BKS A;  1XLO A;  4KR8 A;  3APC A;  2OJW A;  2WXK A;  2X8X X;  1WR6 E;  4FXC A;  3PPA A;  4A3O A;  4FBJ B;  3KW5 B;  1VD2 A;  2JSV X;  2RDB C;  4PK1 A;  1SE2 A;  1TT5 B;  1GUA B;  4PS8 A;  1FD6 A;  2WNM A;  5CHV C;  2HTH A;  4KDL B;  1YQ3 B;  3R3M A;  4IUM B;  2MJ3 A;  3EMN X;  4Q2J A;  4RJW A;  4IM3 A;  3QWZ B;  1MPF A;  2KWV B;  1M94 A;  1XLQ A;  1Y56 A;  4PUX A;  4XDC A;  2WX1 A;  1NYQ A;  2J0M A;  1SE4 A;  1WGD A;  5HHD G;  4KIK A;  2RD0 A;  2DEN B;  2IJ0 A;  3MC0 B;  1PGA A;  3V6E B;  2JRH A;  2N2M A;  3ZXV A;  3I57 A;  4GGQ A;  3K9P B;  2D2Q A;  2O6V A;  2XMX A;  3PZ8 A;  3AE6 B;  2QHO A;  4K7W A;  2O2V A;  3GZN B;  3W1S A;  3ZJU A;  4DDI D;  2LGY A;  2DZI A;  4OVV A;  4A6Q A;  1JRP A;  5L83 A;  4M0W A;  1PDX A;  1V80 A;  1V86 A;  2NS5 A;  1VZ7 A;  4XNK A;  1XT9 B;  4MT5 A;  3GB1 A;  3AED B;  3UIP B;  3EEC A;  1XEE A;  3B2F A;  4GB9 A;  2JVC A;  3POQ A;  2I38 A;  2IO3 B;  3AAA A;  1S1Q B;  3VVW B;  5JZE B;  5L95 C;  3N20 C;  2HE7 A;  4USA A;  4CYE A;  1Q0W B;  4EZL A;  2FUH B;  3PGU A;  2CHW A;  2HJ8 A;  1Q9F A;  1RYJ A;  5BO4 B;  4N75 A;  1ZDX A;  1JWU D;  3UPG A;  2INC C;  3W1S C;  4IG7 B;  3AXC A;  4MGY E;  3I63 C;  4WWP A;  3LYY A;  4GHB A;  3TCA A;  3DCG A;  4FRT A;  5D3D A;  3U7D A;  2R4O A;  3T3O A;  2K0P A;  4N74 A;  3DDC B;  3SFD B;  3AE5 B;  4LJP B;  1ZHZ A;  3AU5 A;  2KFK B;  2BB6 A;  2ACZ B;  3RNA C;  4IC7 B;  2IWW A;  1QKZ A;  3ZUN A;  1ISN A;  2N9E B;  1SE9 A;  1WXM A;  3PGS A;  1WX8 A;  3DBR I;  3RN9 C;  4GMV A;  2HDE A;  1IP9 A;  3BRZ A;  1YN5 A;  3ENE A;  1S3S G;  1T5X D;  2FCM A;  3NS8 A;  3C8Y A;  2AEH A;  3DVN V;  1TS3 A;  4W9H A;  2JQY A;  2FAZ A;  3VTU A;  3IBE A;  3PS6 A;  2OHF A;  2UYZ B;  4IWQ A;  1QIL A;  2ON8 A;  4HEA 1;  3JW0 X;  3VHT C;  2GBJ A;  2OJR A;  3V60 A;  2AQ3 B;  1I4X A;  1J8C A;  4W9I A;  1HZ6 A;  3WCQ A;  5IN7 A;  1MVK A;  1V9J A;  1FXI A;  1WXS A;  1WH3 A;  4M02 A;  1E7V A;  4KSK C;  4YXD B;  2LHF A;  1VZ8 A;  2HD5 B;  2D3A A;  2R2O A;  4IM0 A;  2DLB A;  1FRR A;  4E74 A;  3M63 B;  2LI5 A;  1L5P A;  1S5L O;  4BZA A;  1VZ6 A;  3MHZ A;  3A9J A;  1WMH A;  3PQU A;  4F8C B;  4KGS A;  2VH1 A;  1GNU A;  1P0R A;  3PO0 A;  5H8Y E;  1TS4 A;  1OQQ A;  2BF8 B;  2QJL A;  2VRR B;  2L76 A;  2SEB D;  3WAM A;  2GE4 A;  5LNK 1;  5DPW A;  3TEW A;  3H7P B;  1BUI C;  4U9C A;  5KHQ A;  2KAJ A;  1PYW D;  1EU4 A;  4BVU C;  3IAS 1;  3CF6 E;  4DXG A;  2BYT A;  3DBL B;  4RCO A;  3BYT B;  1NEN B;  3KVD D;  2BKF A;  2R4N A;  1TYG B;  3WU2 O;  4N59 A;  2HJ1 A;  2OMF A;  3R7R A;  3U52 E;  2L05 A;  3I5J C;  3MC8 A;  2ZPY A;  1E10 A;  2R2Q A;  4N6E B;  3SYS A;  5PRN A;  2N7E A;  2FGR A;  5IYU A;  1C77 A;  2QC8 A;  3R8B A;  4DXA B;  1FO4 A;  2Y0K A;  1NDD A;  1ZW7 A;  1UUP A;  3DVG X;  3E9S A;  4HVB A;  4ZOH C;  3NSG A;  3ZDM C;  3IT6 B;  4NJ7 A;  3RNB C;  3TJP A;  1WGK A;  2WJR A;  1RRB A;  3ZIM A;  3BK2 A;  4JGH B;  3TZG A;  1WJU A;  1D5M C;  3RFZ B;  3VUW A;  4EUT A;  4FHK A;  4DHJ B;  2BS4 B;  4NAW B;  3A4R A;  3H6N A;  2RMM A;  1JQ4 A;  4KGR A;  5BYS A;  2ZPN A;  3NZU A;  3AN1 A;  3NY5 A;  2PPH A;  2REX A;  1F9J A;  2LRW A;  2WDV B;  5CX3 A;  3RD2 A;  4KSL C;  3DBH I;  1WZ3 A;  2DZK A;  1T16 A;  4FAD A;  3ABV B;  1ZHT A;  1I35 A;  4EKU A;  1YOV B;  1C4P A;  1VCB A;  3UU2 A;  3FAH A;  3P4S B;  2EEL A;  1HZ5 A;  2WP9 B;  3RNG C;  4DK5 A;  3T20 A;  4ANX A;  4LLG M;  2EMT A;  4YSZ B;  3EHV A;  3ECI A;  1D4B A;  1FPY A;  1D5Z C;  4EZK A;  1ET6 A;  1UH6 A;  5AFU K;  5GTH O;  2G4D B;  3DHI C;  4ZRQ A;  4C7Z A;  3KQ4 A;  5AFU L;  1AN8 A;  4L1B A;  3IFW B;  4K7S A;  3SY9 A;  3T0S A;  3NVV A;  1RAX A;  4ZHO A;  3C19 A;  1YMH E;  2V9H A;  3AA6 A;  3DHG C;  2FCQ A;  3ZTD A;  2D11 A;  5EE1 A;  4MEL A;  2NCN A;  4RGM A;  1FMA D;  3JSV B;  2LHE A;  3B0A A;  5E6N A;  3VY9 X;  2KDF B;  1NVI D;  2N4F A;  5DCN A;  3T9L A;  2ZVN A;  2KLC A;  2DZM A;  1JWA D;  4XGA B;  1R4N I;  4GXB A;  3LK3 A;  3AEA B;  1U4A A;  2FCN A;  4ZRI A;  3UQA A;  4JQW C;  1FCC C;  3SDL C;  1AWD A;  1WMH B;  2ZLD A;  1V8C A;  1XCQ L;  1ZXI A;  4YTP B;  1TGZ B;  1JCK B;  3WAL A;  2GBK A;  2M4N A;  3QC8 B;  1L0X B;  2B76 B;  3K19 A;  3R2I A;  4MSM B;  4D2K A;  2KO3 A;  2UWQ A;  4NJ6 A;  1DYQ A;  2BTE A;  3VXW A;  1ZUD 2;  2ODJ A;  3L10 B;  4BFR A;  3SHQ A;  2DAF A;  3MTN B;  2XK5 A;  4UB8 O;  1STE A;  1TS2 A;  2WVP A;  3DWO X;  3SZD A;  1WGY A;  3P1M A;  5FVN A;  3O0E A;  2K25 A;  2KQ7 A;  2MW5 A;  1CQV A;  2N9K A;  3ZNG C;  3UQB A;  4BKG A;  1BH3 A;  4KKI A;  1PQS A;  1YJI A;  3OAW A;  1YJ1 A;  1AYF A;  2DAJ A;  2XE2 A;  2W3S A;  2KAC A;  1V97 A;  2WS3 B;  2MJD A;  2Y3A A;  3LK2 A;  2BWF A;  3VR8 B;  3N1X C;  3FC4 A;  3SZV A;  1LM8 B;  3LB8 C;  2KX0 A;  3ZVV A;  3HHM A;  4PYU A;  3I9V 1;  3VUY A;  1I4G A;  4M00 A;  1Q10 A;  2W82 A;  2F1T A;  5AZF A;  4OZA A;  2JUO A;  5KAF O;  2WXM A;  3VR9 B;  2PTL A;  4MEM A;  2WDQ B;  1ZHY A;  4O49 A;  2AL6 A;  1GPX A;  4PJ0 O;  1OPF A;  3NVZ A;  1RM6 C;  3O65 B;  4IL6 O;  3GE8 C;  2CS4 A;  4GCS A;  3V8U A;  4WQO B;  2FGQ X;  2BYV E;  4KR4 A;  2M56 B;  2YEP F;  2QCZ A;  4NPN A;  1R4N B;  2G3Q B;  3KH0 A;  2KXP A;  4TQ1 A;  1ACC A;  1GC7 A;  4URK A;  2BS3 B;  1D6E C;  1UD7 A;  2V4I B;  2F1C X;  4IWO A;  1ZE3 D;  1HE8 A;  4LNK A;  3V05 A;  1P9D U;  2WDR B;  1P7F A;  4YWG G;  1FEH A;  3WA0 A;  2GOW A;  2MLB A;  2IO0 B;  2AWT A;  4II2 B;  1SSN A;  4RGN A;  4O3Z A;  3DBR B;  1GFQ A;  3R7Q A;  3ZLZ A;  5E6J A;  1VRA B;  4RNA A;  2EMS A;  2PVG C;  3WI4 A;  1QZE A;  1MHH E;  1YS5 A;  3S2A A;  1KFY B;  3VRB B;  1OEY A;  1BML C;  1PRN A;  3C0R B;  1M4V A;  3QQ8 B;  3BWU D;  1TZO A;  5AZG A;  1MI0 A;  3IT4 B;  1QJ9 A;  2RR9 A;  5IAA C;  3LJ3 A;  4HKQ A;  5D3I B;  4FUV A;  2LHD A;  1JAL A;  2EKE C;  5G2N A;  2FNJ B;  3ZDT A;  4UB6 O;  1KRH A;  1K53 A;  2NPT A;  4WAA A;  1N63 A;  3WAO A;  3RUI B;  3AE9 B;  2IO2 B;  2R4L A;  4O4U A;  4B61 A;  1XLP A;  5IKC M;  1UGJ A;  1QJP A;  1ZGU B;  2D3C A;  1PGX A;  1UF0 A;  1QF6 A;  2KKC A;  4AYI D;  4HXD A;  4MGK E;  1RFA A;  4XWT A;  2K0L A;  2K39 A;  1IGD A;  2LGD A;  1QOF A;  5KAI O;  2JYT A;  2LVQ A;  2JRI B;  4D64 A;  2GB1 A;  3PGE A;  1WJ6 A;  2KDY A;  3BIN A;  2Y5P A;  2MCN B;  4DQO C;  3P4P B;  2TSS A;  1NI3 A;  3APD A;  2PVO D;  4O3W A;  2Z0D B;  2KT7 A;  2MH7 A;  3R66 C;  2ZZP B;  5D6J B;  1CJE A;  4BUM X;  4G76 A;  2IZV B;  1QOG A;  2LAS A;  2MBH A;  4G3X B;  4X57 B;  3AH7 A;  2MRP A;  3ZTC A;  3N1Z C;  4LSH A;  4RLC A;  1TS5 A;  1WGG A;  3AA7 B;  2FE8 A;  4GOC A;  2O4V A;  3AE4 B;  3PF1 A;  5E6O A;  2Y0L A;  3GP7 A;  3EFU A;  3TIX A;  2ICI A;  1EF1 A;  3V62 A;  2C60 A;  3W5V B;  2NVU I;  2KLG A;  4A20 A;  4AP4 C;  2V3S A;  4B6W A;  4ANU A;  1E8W A;  5TSS A;  1IPG A;  1T3Q A;  3PSE B;  1UEL A;  1F2R C;  2MHL A;  4ZRK A;  2NBW B;  3UF8 A;  3R2T A;  1JML A;  2KHW B;  2IGG A;  2BQQ A;  1SJE D;  3HVD A;  3DWN A;  1XLN A;  1FXT B;  5G38 A;  3DOW A;  4MM3 A;  4MSQ B;  2N9L A;  1YN3 A;  4NAM A;  2KXP B;  2KZR A;  2XNA C;  4I6L B;  3U7Z A;  4O3Y A;  3L17 A;  3PRZ A;  5G55 A;  4GDL A;  3PRM B;  1WE6 A;  1RFK A;  2N9P C;  1Z5S B;  4FQE A;  2G1E A;  3DZM A;  4DDG D;  2GBM A;  3N3K B;  1IGC A;  2PE6 B;  2LFU A;  1WI0 A;  2I1J A;  3AAA B;  1E8X A;  1D5X C;  2BKR B;  2ZVO A;  4HPM B;  2K4T A;  1P4T A;  2N7J A;  4FOZ A;  2N9X A;  2OOB B;  3N32 A;  4W9L A;  4BOZ B;  2DNF A;  3V3X A;  3NJT A;  4A8X C;  3HM6 X;  5C1Z A;  3AU4 A;  4K1R B;  3MJW A;  4EEW A;  2MBO A;  4ASW C;  3CST A;  2MEK A;  5CTR C;  4H2A A;  1J7A A;  2LMC A;  2IGD A;  2K8H A;  3PRN A;  2QDF A;  2LEK A;  1ZDV A;  2LVP A;  3PHW B;  1BT0 A;  4LSF A;  3RCZ A;  1SB3 C;  3JYU A;  4AWJ A;  2M0X A;  1YX6 B;  2BYF A;  2LFI A;  5C2T B;  4FT6 A;  4F4B A;  1EM7 A;  4NAW A;  5MPO A;  5AUI A;  3RMK C;  3VRA B;  5J17 A;  1P3Q U;  2ZEQ A;  4JLC A;  1N60 A;  3LDZ E;  3UIN B;  2SAK A;  3DBH B;  4WIP A;  5HFY A;  2X38 A;  1NI2 A;  3L54 A;  4D65 A;  2L3Z A;  3VAW A;  1L0V B;  4MH0 E;  4BBN F;  2XTR A;  4CHK A;  3FYX A;  5DL5 A;  1H4R A;  3HW9 A;  5TR5 A;  3GZN I;  1GG3 A;  4O4X A;  1KH0 A;  2LUM A;  4DXF A;  4FN2 A;  3RNE C;  3FIL B;  1YIW A;  2MA9 B;  3VY8 X;  3Q3F A;  3D32 A;  4GU2 A;  4RF0 A;  2MBB B;  2F1V A;  4B0E A;  4J6I A;  3DPD A;  1ORM A;  2K3U A;  2W55 A;  2LZ6 A;  2M07 A;  2MSE D;  3L08 A;  1FXA A;  2K9X A;  4HJG E;  2YEP B;  2KX3 A;  2X9K A;  2RDH A;  4LSE A;  1WJ4 A;  2FCS A;  3VFK A;  1L4D B;  4RJX A;  3HIZ A;  2L0T A;  3TUO A;  1WIA A;  3PLU A;  2LXC A;  2AX5 A;  1LGR A;  1TZ1 A;  4KZC A;  2J53 A;  2GLS A;  2XE3 A;  2XG6 A;  4C69 X;  2IY1 B;  3PT2 B;  2JF5 A;  3H7P A;  4JX1 C;  5AEK B;  3UIO B;  1E7U A;  3AM9 A;  4MJS A;  2PMV A;  1LXD A;  3PZD A;  4C4V A;  1NEK B;  1ZXH A;  1GB4 A;  2N2L A;  3DWG C;  5G39 A;  1ZP0 B;  2JQR B;  3VZU X;  2NMQ A;  4ICU A;  2AXT O;  2M19 A;  2C5L C;  1DOI A;  2IWV A;  1UGM A;  2M1M A;  1A70 A;  4AJW A;  5HI1 A;  3BVZ A;  2FUG 1;  4F7Z A;  3RPF C;  1F2R I;  5C23 A;  2Z0E B;  3ZJV A;  3Q3J A;  4K81 A;  4HKZ E;  5TIS O;  1X1M A;  2E6X A;  2KFK A;  2QIE B;  2N7D A;  5IOI A;  1B1Z A;  2D10 A;  5FR6 A;  3AA1 B;  2KTR A;  1N62 A;  4RM8 A;  2L1A A;  5IO9 A;  2KZ7 B;  1SGH A;  1HXT A;  2K8C A;  3I3T B;  3VZW X;  3E56 A;  4AKM A;  1JRU A;  4AYD C;  2RSU A;  2KN4 A;  2J0J A;  5EE9 A;  4QQ1 A;  3IVF A;  4UDU C;  3HOE A;  2PLP A;  4ANW A;  2JU6 X;  5KHO A;  2VZK D;  5DPR A;  1R7S A;  1JW9 D;  2NTS A;  4E1T A;  4XZ4 A;  2H89 B;  3SEB A;  4ZRP A;  2WWZ A;  1SE3 A;  5JH5 C;  1PGB A;  1T0Q C;  3W2D A;  4R3D A;  2WJQ A;  3OWE B;  4WQM A;  3KYC D;  2AQ2 B;  3Q3O C;  1XO3 A;  2LGX A;  1L7Y A;  1V6E A;  4OHJ A;  3ZNZ B;  4PS3 A;  4ARI A;  1V81 A;  4NQL B;  4HCP B;  1I7H A;  1Q9G A;  3NHE B;  3TBL D;  5G5H A;  3AEF B;  3U8Z A;  3IHP C;  2KK8 A;  5LXI B;  2DYO A;  1R4M B;  3AE2 B;  3HOL A;  2W80 C;  1P7E A;  1V1P A;  4M8N A;  2ASQ A;  2V0G A;  3VQI A;  2V1Y A;  1HQR D;  4EE2 A;  2QTK A;  4G75 A;  2LGI A;  1Q5W B;  3ONS A;  1DOY A;  1WSP A;  2L52 A;  4RH6 A;  1QLB B;  4FZN A;  3U2S C;  2L83 A;  2J0K A;  2RGF A;  1FFV A;  3Q8F A;  4REZ A;  1PUT A;  2DZJ A;  2M06 A;  2IY0 B;  3UGB B;  2KMC A;  2R8A A;  1WYG A;  2KMM A;  2GBR A;  3TSS A;  2XTQ A;  3BK1 A;  3RZW C;  1YX5 B;  1L0Y B;  1E6E B;  3DA4 A;  2L0F A;  2K1F A;  1HA5 A;  2K5P A;  2UU7 A;  3KUD B;  2Y2X A;  1KLV A;  1L6V A;  4LTU A;  3P4Q B;  2LWP A;  3RBH A;  2L8J A;  3OJ4 B;  4TKN A;  4QAY A;  2INP E;  1HTO A;  4WH4 A;  1T0Y A;  3IXS A;  1YN4 A;  2ERV A;  1RWS A;  1GFN A;  3QAR A;  3UAQ A;  4G0N B;  2YPV A;  3GE3 C;  3PHX B;  3PLV A;  4CQN A;  5IP4 D;  1MHX A;  2GBN A;  5BYQ A;  2WXO A;  4AYE C;  4MDK E;  1H8C A;  2CR5 A;  3ZRF A;  1WFY A;  3KWL A;  2OED A;  1J7B A;  3Q2A C;  3LK2 B;  4ZYN A;  4W9G A;  1E7P B;  5DPT A;  3MC9 A;  1KF6 B;  4HDQ A;  3AAE A;  4FJV B;  2RPV A;  2NBU A;  1EO6 A;  3BVG A;  2LJ5 A;  4FHJ A;  5JDP A;  3ZYY X;  3RZF A;  4C80 A;  1ZHX A;  2DWQ A;  3HWB A;  2K8B A;  4M8M A;  4A9A A;  3A1Q B;  1GFP A;  1TY0 A;  4L2Y A;  3H7S A;  1N5W A;  4MM3 B;  4G11 A;  3MFG A;  1IZN A;  1EWY C;  2A4Z A;  3AA0 A;  1KJT A;  3SU8 X;  1GB1 A;  2POR A;  4LDT D;  1HTQ A;  2DYB A;  4TMA B;  4FZL A;  1G90 A;  2K22 A;  2N1V A;  3NZS A;  2NPT B;  1MG8 A;  3A9K B;  2IO1 B;  2M0A A;  1HXU A;  3A1Q A;  3C5O A;  2R61 A;  1WX9 A;  4A90 A;  1H6S 1;  1F0Z A;  3POU A;  1V5O A;  4DWF A;  4FUL A;  1WRD B;  1WM3 A;  3FKY A;  4O3X B;  2KJ6 A;  4XDD A;  3JSV A;  4ANV A;  1SXT A;  3IAM 1;  1HXX A;  2H88 B;  4PR7 A;  2ZNV C;  1SIF A;  1N61 A;  1N5X A;  3QIJ A;  3ML9 A;  5AUK A;  1T0R C;  4ZRJ A;  3QCA A;  3WAN A;  2KC0 A;  1C1Y B;  2IDY A;  1SJH D;  5ADX K;  3AA1 A;  1XCT L;  2D5G A;  1I4H A;  3A0H O;  2LXA A;  2WQY B;  4BKS D;  3GS2 A;  4L23 A;  5JHA A;  1E8Y A;  1I4Q A;  4GCP A;  3QJZ A;  2EKI A;  2K6D B;  2JY6 A;  1L2N A;  2VZK B;  1C3T A;  4JIO U;  3ETR A;  4W9E A;  1RLF A;  4GF4 A;  2I1K A;  3KWV A;  2KJR A;  3B1L X;  3AMZ A;  3A33 B;  1OQY A;  3VTV A;  2XK5 B;  1OEY J;  4HRO A;  2IGH A;  1EUV B;  1HXY D;  1J19 A;  2WHI A;  2J42 A;  3N30 A;  2LUE A;  1V49 A;  2PE9 A;  3DQV A;  3AA6 B;  2WYQ A;  1LO5 D;  4FSO A;  3O13 A;  5AZH A;  1ET9 A;  2PRN A;  1IUE A;  4A3P A;  3TEZ A;  2GRI A;  1EF5 A;  3DVG Y;  4C7Y A;  2KTF A;  4JL9 A;  4EOY A;  2KN5 A;  3AE1 B;  5G26 A;  2CKH B;  1THQ A;  1MM4 A;  8PRN A;  4C00 A;  4HPP A;  4LNN A;  2GI9 A;  2BGF A;  3TEY A;  1WXQ A;  1FFU A;  4B95 A;  4NQK E;  2Y0H A;  3CSF A;  2J1N A;  3KZI O;  2KZ7 A;  3Q8B A;  3MP9 A;  4KV2 A;  5G5G A;  1L6U A;  4TQ0 A;  3CWI A;  1GJZ A;  2X27 X;  4NNJ B;  4KZ0 A;  1BT9 A;  2KWD A;  1CZP A;  2KDM A;  2BPS A;  2ZFG A;  4IDI A;  2I2Y A;  2KC2 A;  5HG2 A;  5B66 O;  1JWS D;  4HDO A;  1SIJ A;  2KDI A;  1QT9 A;  5BMH A;  1K8R B;  3BRY A;  1WWT A;  4P6V F;  4S17 A;  2DX5 B;  1OFF A;  5D94 A;  1TJE A;  3AA7 A;  2BT6 A;  2WXH A;  1XXG A;  1IYF A;  1WE7 A;  4XYC A;  1JWB D;  5C3J B;  3X23 A;  3GOE A;  2ZCB A;  4RL9 A;  2WX0 A;  2Y5B B;  3KLS X;  1YD8 U;  4RFB A;  3OG5 A;  1LFD A;  2O6V D;  1EU3 A;  4E71 A;  2JXX A;  2LRU A;  1UBQ A;  2NBV B;  2D3G A;  4RGT A;  2WXF A;  1VJK A;  2CU1 A;  3ZKJ C;  3RYT A;  1F1H A;  1TY2 A;  4FRX A;  2PIA A;  1WY8 A;  3TMP B;  3P4R B;  3AEE B;  3KUC B;  3PV1 A;  5JHB A;  3UI3 A;  2LD9 A;  2M17 A;  5G3A A;  2W3R A;  4GIV A;  4LCD E;  1GFM A;  3AEG B;  2O2V B;  2JYE A;  1I42 A;  3POX A;  4KVG B;  2KDE B;  1WGR A;  2BBC A;  1DOX A;  2DBY A;  4AFK A;  2IND C;  4LK0 M;  4YTN B;  4AKR B;  2WXJ A;  2JZP A;  2BYE A;  1J0G A;  4LJO B;  2Y5C A;  3Q3M C;  3G7G A;  3QA8 A;  3AEB B;  1DGJ A;  2M8S A;  4NJC A;  1TKG A;  2KXJ A;  1ZKH A;  2MQJ A;  4HLE A;  1KOT A;  5HKH A;  3ZQ4 A;  1R4M I;  3APF A;  3BYY B;  1YQB A;  4AKR A;  4PT5 A;  3A2S X;  4Z3T A;  1WXV A;  4FJZ A;  2NR2 A;  4P7I A;  1C79 A;  3AB5 A;  1HEZ E;  3M95 A;  2MP2 A;  5FK9 C;  1F52 A;  2CU3 A;  1Q1O A;  5DPS A;  3Q8C A;  2WXN A;  5IA7 A;  1UWM A;  1V1P B;  3P2B A;  1QOB A;  4K3B A;  1J7C A;  2IBI B;  4WWO A;  3QRC A;  2AL3 A;  4B9K A;  1PHO A;  3M62 B;  3L13 A;  5D2M B;  3P63 A;  5EE3 A;  2ZCC A;  4JE3 B;  2L00 B;  4EZJ A;  4WJO A;  3BZD B;  4P1B C;  3ZO5 B;  4RF1 A;  3BS0 A;  4JFB A;  3PVL A;  3JTY A;  1E54 A;  2D07 B;  1K50 A;  1TKE A;  1ZOY B;  3PRE A;  3EFC A;  1WGH A;  4FJY A;  3AUL A;  4FZM A;  4W9C A;  2KWC A;  4OW0 A;  2KQS A;  4KRA A;  3LK4 2;  2MHJ A;  2KTR B;  3RI7 C;  3K9O B;  2MNH A;  1TTN A;  3CIR B;  4ITK A;  4ZYS A;  4W9D A;  1QOA A;  2WXI A;  1I4P A;  3DBL I;  2KAN A;  4XNL A;  3W1Y A;  5CHF A;  5J18 A;  4KIK B;  1SBB B;  4LSI A;  2CJO A;  4N58 A;  2WU2 B;  4FLH A;  4IKG A;  4IOI E;  3W5U B;  4HWI B;  2JT4 B;  3CMM B;  2DYM A;  3MHS D;  1FCL A;  3PZ7 A;  2FIF A;  2PEA A;  1QQR A;  1KLG D;  2WXG A;  3RUL A;  2ZW0 A;  4WUR A;  1MFW A;  2MX2 A;  5GXG B;  3VZT X;  3Q3N C;  4US8 A;  1V1O A;  3MJ5 A;  4HPL B;  3DA3 A;  4YL8 A;  4F1S A;  1MJD A;  4DHJ D;  3LXF A;  3EC8 A;  4M0W B;  5EDS A;  4ICV A;  3VH3 B;  2WXL A;  1PFD A;  2XE5 A;  3ZXR A;  2WU5 B;  4WJQ A;  2NTT A;  3HVZ A;  1BXT A;  1WX7 A;  3DVN U;  2FID A;  3RNF C;  1OTR B;  2CHX A;  3LK4 1;  4LNF A;  2E3T A;  1AW7 A;  1FRD A;  2JZZ A;  1Y8R C;  3AV8 A;  2AQ1 B;  1IBX B;  2C7H A;  4MGI E;  4NY0 A;  2JZ3 B;  2GMI C;  1YJJ A;  4C56 C;  2V4L A;  2QEJ C;  4AUQ C;  1CMX B;  2JXT A;  2LVO A;  1OSM A;  2MJE A;  2KVR A;  4IWP A;  2MWS B;  4JWS C;  2N0S B;  2G45 B;  1MM5 A; 
#chains in the Genus database with same CATH homology
 3NVY A;  4FRT A;  1PGX A;  5D3D A;  3T3O A;  1KF6 B;  3L4P A;  5BMG A;  1FNU A;  3AAE A;  4E1S A;  2BB5 A;  2K0P A;  3SFD B;  4FES A;  1QF6 A;  2RPV A;  3AE5 B;  4AYI D;  1ZHZ A;  4XWT A;  5DL8 A;  3BVG A;  1B9R A;  2BB6 A;  2K0L A;  2ACZ B;  4AQ7 A;  1IGD A;  1QKZ A;  5JDP A;  3ZYY X;  1QOF A;  4C80 A;  1ZHX A;  1C78 A;  2DWQ A;  3HWB A;  4FMS A;  4A9A A;  2CJN A;  2JYT A;  1GFP A;  1TY0 A;  4L2Y A;  1N5W A;  2HDE A;  4D64 A;  2GB1 A;  3B2G A;  4MM3 B;  2L32 A;  1YN5 A;  3MFG A;  4GCQ A;  1IZN A;  2KDY A;  2Y5P A;  1GFO A;  1GAQ B;  1EWY C;  3P4P B;  2TSS A;  1NI3 A;  4AYM C;  3VE1 A;  4DQO C;  2PVO D;  3POR A;  1T5X D;  4O3W A;  3AA0 A;  4P16 A;  2MH7 A;  3C8Y A;  2W54 A;  1GB1 A;  3AA0 B;  5FR3 A;  2POR A;  1YNT E;  1CJE A;  1ENF A;  3BVM A;  4BUM X;  1TS3 A;  4G76 A;  5I4D A;  3SFE B;  3PQS A;  2ZW1 A;  4TMA B;  4FZL A;  1G90 A;  2K22 A;  1QOG A;  2M0A A;  4HRS A;  2KQ4 X;  1HXU A;  3HUI A;  2OHF A;  3C5O A;  1QIL A;  2ON8 A;  2R61 A;  3AE7 B;  3AH7 A;  4HEA 1;  3Q69 A;  4JPS A;  4LSH A;  4RLC A;  1TS5 A;  2WXR A;  2AQ3 B;  3AA7 B;  2FE8 A;  1I4X A;  2O4V A;  3AE4 B;  4A90 A;  1H6S 1;  1F0Z A;  3POU A;  1HZ6 A;  3WCQ A;  2Y0L A;  1ESF A;  3B9J A;  3GP7 A;  3NVW A;  1MVK A;  2ICI A;  4O3X B;  1FXI A;  3W5V B;  3AAE B;  4XDD A;  3AE3 B;  4YXD B;  2LHF A;  1SXT A;  1VZ8 A;  5TSS A;  1T3Q A;  1K51 A;  5DL7 A;  3IAM 1;  1F2R C;  2MHL A;  1HXX A;  2DLB A;  2H88 B;  3R2T A;  1FRR A;  1YQ4 B;  3ZGZ A;  1L5P A;  1JML A;  4OVZ A;  1N61 A;  1N5X A;  2IGG A;  1VZ6 A;  3MHZ A;  5AUK A;  1SEB D;  1SJE D;  3HVD A;  2KC0 A;  2IDY A;  4JCH A;  1XLN A;  1SJH D;  3N9Y C;  5ADX K;  5JXV A;  3AA1 A;  1XCT L;  2D5G A;  3PQU A;  1JRO A;  1I4H A;  2N9L A;  4ARC A;  4KGS A;  1YN3 A;  5BYR A;  4NAM A;  3AEC B;  2WQY B;  2KXP B;  3GS2 A;  5T5F A;  4AUI A;  2XNA C;  3PO0 A;  4L23 A;  5H8Y E;  4O3Y A;  1TS4 A;  3U7Z A;  4YSY B;  1I4Q A;  3URY A;  3GP6 A;  4GCP A;  1OQQ A;  2QJL A;  3EUB 2;  2SEB D;  1T6B X;  4O1N A;  2GE4 A;  3TEX A;  2EKI A;  1RFK A;  5LNK 1;  3TEW A;  2G1E A;  2VZK B;  3DWM A;  1BUI C;  4U9C A;  1IGC A;  3ETR A;  2LFU A;  2KAJ A;  4GF4 A;  3AAA B;  3KWV A;  1ZHW A;  1PYW D;  1EU4 A;  1TKY A;  3AMZ A;  3IAS 1;  1D5X C;  3U4E G;  2V3N A;  4DXG A;  3QRA A;  3SYB A;  2BYT A;  4HRO A;  2IGH A;  1HXY D;  3BYT B;  4RCO A;  4US9 A;  2J42 A;  1NEN B;  3KVD D;  2K4T A;  1OQR A;  3AA6 B;  1TYG B;  1P4T A;  4N59 A;  2N7J A;  3LYY A;  1LO5 D;  4FSO A;  2OMF A;  7PRN A;  4FOZ A;  5GV0 A;  3O13 A;  5EE0 A;  1ET9 A;  2PRN A;  5DL6 A;  3ZJT A;  5T8I A;  3U52 E;  2IPK D;  1IUE A;  4NZL B;  2QSD A;  3V3X A;  2QMT A;  4A8X C;  1K52 A;  1E10 A;  3TEZ A;  2GRI A;  4N6E B;  4C7Y A;  3SYS A;  5PRN A;  2FGR A;  5IYU A;  1C77 A;  2XE1 A;  3R8B A;  1FO4 A;  3AE1 B;  2MEK A;  2Y0K A;  5G26 A;  2PW9 A;  3SY7 A;  1UUP A;  3E9S A;  4H2A A;  1THQ A;  1J7A A;  1MM4 A;  2LMC A;  4AZL A;  1E9M A;  2WLB A;  8PRN A;  4ZOH C;  3NSG A;  2IGD A;  2GI9 A;  3PRN A;  1WXQ A;  2LEK A;  3TEY A;  5ADX L;  1ZDV A;  3IT6 B;  1FFU A;  1IBX A;  4LSF A;  1WGK A;  2WXP A;  3Q8A A;  1SF0 A;  2Y0H A;  1SB3 C;  3BK2 A;  4J3O D;  2J1N A;  3Q8B A;  2KZ7 A;  4XE0 A;  3MP9 A;  5G5G A;  1CK1 A;  1L4Z B;  1L6U A;  4TQ0 A;  1C9F A;  3TZG A;  3CWI A;  1D5M C;  3RFZ B;  2X27 X;  4KX6 B;  2LFI A;  5C2T B;  2BS4 B;  1BT9 A;  2KWD A;  4FT6 A;  4NAW B;  3T3N A;  4F4B A;  1CZP A;  2KDM A;  1EM7 A;  2ZFG A;  2BW2 A;  2RMM A;  1IZN B;  4KGR A;  5AUI A;  4IDI A;  5MPO A;  1JQ4 A;  5BYS A;  2I2Y A;  3VRA B;  1I4R A;  5HG2 A;  1UNS A;  1JWS D;  1FNW A;  1N60 A;  1SIJ A;  2Q5W D;  1QT9 A;  2QIL A;  3FIL A;  3AN1 A;  5BMH A;  2SAK A;  4AYN A;  4WIP A;  5HFY A;  2WDV B;  2X38 A;  4MH8 A;  1C4A A;  4D65 A;  1WWT A;  1ROE A;  4P6V F;  1GOZ A;  1L0V B;  1OFF A;  2XTR A;  1ZHT A;  3ABV B;  3AE8 B;  3BII D;  3FYX A;  5DL5 A;  5H92 C;  1C4P A;  1KTK A;  1TJE A;  3HW9 A;  3UU2 A;  3FAH A;  3AA7 A;  3P4S B;  2BT6 A;  4O4X A;  1KH0 A;  2EEL A;  2LUM A;  1HZ5 A;  2Z8L A;  1NYR A;  2WP9 B;  4FSP A;  1XXG A;  2WXH A;  4GLS C;  4DXF A;  3T20 A;  1JWB D;  4LLG M;  5C3J B;  4YSZ B;  3NZ3 A;  3FIL B;  4RL9 A;  3VY8 X;  1D4B A;  3KLS X;  1XF5 L;  4RFB A;  5FKA C;  2RDG A;  1D5Z C;  1ET6 A;  4RF0 A;  5AFU K;  2W81 C;  1EU3 A;  2F1V A;  4ZRQ A;  1E0Z A;  4C7Z A;  4B0E A;  1FNV A;  1ORM A;  3KQ4 A;  2K3U A;  5AFU L;  3P42 A;  1AN8 A;  4D5U A;  2W55 A;  4L1B A;  2M07 A;  1ZPS A;  4RGT A;  4XWW A;  4B0M A;  2FBW B;  2YNK A;  2WXF A;  3SY9 A;  4YSX B;  3T0S A;  1VJK A;  1FXA A;  3NVV A;  2K9X A;  4HJG E;  2YEP B;  4JWU C;  2RDH A;  4LSE A;  4ZHO A;  1YMH E;  1L4D B;  4RJX A;  1TY2 A;  3AA6 A;  1FM0 D;  4FRX A;  2WXQ A;  3TUO A;  2PIA A;  4ZHP A;  5EE1 A;  3P4R B;  1MPE A;  3AEE B;  3PZ8 A;  4RGM A;  2AX5 A;  5BMI A;  2INN E;  2J53 A;  4A55 A;  1FMA D;  1FIQ A;  2XE3 A;  2XG6 A;  4C69 X;  1VDV A;  3H8H A;  3UI3 A;  3J9C A;  2LHE A;  2W3R A;  4OZC A;  1GFM A;  3NRZ A;  3Q8E A;  2JMM A;  3AEG B;  4JX1 C;  2JYE A;  3VY9 X;  1NVI D;  3POX A;  1VR9 A;  3AM9 A;  2PMV A;  2J4U P;  1JWA D;  3W9C B;  2BBC A;  1DOX A;  2DBY A;  1NEK B;  4AFK A;  4AS1 A;  5D5D A;  1ZXH A;  3LK3 A;  1C76 A;  3AEA B;  3HRD D;  4LK0 M;  1GB4 A;  2N2L A;  1BXW A;  4YTN B;  3DWG C;  4AKR B;  3EA6 A;  1ZP0 B;  2JQR B;  2WXJ A;  5D7G A;  1FCC C;  3VZU X;  2HTM E;  2NMQ A;  4RLB A;  4TSS A;  2JZP A;  1AWD A;  4KKJ A;  2ZLD A;  3SR6 A;  2Y5C A;  2M19 A;  2PKO A;  1V8C A;  1XCQ L;  1ZXI A;  3VE2 A;  4YTP B;  1DOI A;  3G7G A;  3AEB B;  1A70 A;  1DGJ A;  1WRI A;  1JCK B;  4NJC A;  1TKG A;  2Y7S A;  5HI1 A;  1L0X B;  3BVZ A;  4GDL B;  2B76 B;  3K19 A;  2FUG 1;  3R2I A;  3RPF C;  1F2R I;  4D2K A;  2V3P A;  4WWM A;  3ZJV A;  2J52 A;  4HKZ E;  3NS1 A;  2LJI A;  3ZQ4 A;  1DYQ A;  2E6X A;  2JX5 A;  2QIE B;  3BYY B;  2BTE A;  4AKR A;  4PT5 A;  3NUH B;  3A2S X;  1B1Z A;  1C4C A;  1ZUD 2;  2ODJ A;  4Z3T A;  1JWM D;  3AA1 B;  2JWU A;  1N62 A;  2L1A A;  1UWX A;  1C79 A;  1STE A;  4GDK B;  4KGT A;  3T24 A;  1TS2 A;  3AB5 A;  2ONQ A;  3P1M A;  3SZD A;  2KZ7 B;  1HEZ E;  5FVN A;  5FK9 C;  3O0E A;  1HXT A;  2N9K A;  1CQV A;  2CU3 A;  3VZW X;  3E56 A;  4AKM A;  6PRN A;  1BH3 A;  4AYD C;  3Q8C A;  2WXN A;  4KKI A;  2KN4 A;  1YJI A;  1UWM A;  1V1P B;  5EE9 A;  4QQ1 A;  1AYF A;  4MAC A;  1QOB A;  4UDU C;  5EE2 A;  2XE2 A;  3HOE A;  2W3S A;  4OZB A;  2KAC A;  4YT0 B;  1V97 A;  2PLP A;  2WS3 B;  2BS2 B;  1J7C A;  1EWC A;  1KLU D;  2MJD A;  2Y3A A;  3LK2 A;  2JU6 X;  3QRC A;  2VZK D;  3VR8 B;  1QJ8 A;  1F77 A;  2G9H D;  3FC4 A;  3SZV A;  2J4X A;  1PHO A;  3LB8 C;  1R7S A;  4RGO S;  1JW9 D;  2NTS A;  3LK3 B;  4E1T A;  3P63 A;  4YTM B;  5EE3 A;  3EGR A;  4JE3 B;  4WAF A;  3WI5 A;  2H89 B;  3I9V 1;  3BZD B;  1I4G A;  2XN9 C;  3SEB A;  4ZRP A;  1SE3 A;  4RF1 A;  1VLB A;  4JFB A;  1Q10 A;  1PGB A;  3JTY A;  2W82 A;  2F1T A;  1E54 A;  3W2D A;  4R3D A;  1XLO A;  4KR8 A;  4OZA A;  2WXK A;  3OWE B;  4WQM A;  1K50 A;  1TKE A;  4FXC A;  1ZOY B;  2WXM A;  3VR9 B;  2PTL A;  2AQ2 B;  4FZM A;  2WDQ B;  1XO3 A;  2JSV X;  1SE2 A;  4OHJ A;  4OW0 A;  1ZHY A;  4O49 A;  1GPX A;  1OPF A;  4ARI A;  4KRA A;  3LK4 2;  2WNM A;  1RM6 C;  3NVZ A;  1FD6 A;  1YQ3 B;  1I7H A;  3EMN X;  4GCS A;  3V8U A;  2MJ3 A;  4Q2J A;  1Q9G A;  2MNH A;  4RJW A;  2FGQ X;  1MPF A;  3CIR B;  4ITK A;  4KR4 A;  5G5H A;  4ZYS A;  3AEF B;  1XLQ A;  1Y56 A;  4PUX A;  1QOA A;  2M56 B;  2WXI A;  1I4P A;  2YEP F;  4XDC A;  2DYO A;  1NYQ A;  1SE4 A;  3HOL A;  4XNL A;  3AE2 B;  5HHD G;  2W80 C;  1P7E A;  2KXP A;  1SBB B;  4TQ1 A;  1ACC A;  4LSI A;  1V1P A;  2CJO A;  4N58 A;  2BS3 B;  1D6E C;  2V4I B;  2WU2 B;  2V0G A;  2IJ0 A;  4IKG A;  4IOI E;  3VQI A;  3W5U B;  1ZE3 D;  3MC0 B;  1PGA A;  1HQR D;  4EE2 A;  2QTK A;  4G75 A;  2DYM A;  2LGI A;  2N2M A;  1DOY A;  1FCL A;  3PZ7 A;  3I57 A;  3V05 A;  1QQR A;  1KLG D;  1P7F A;  2XMX A;  1FEH A;  1WSP A;  2L52 A;  1QLB B;  2WDR B;  2WXG A;  3AE6 B;  4FZN A;  4RH6 A;  3U2S C;  2L83 A;  2ZW0 A;  3W1S A;  1SSN A;  4WUR A;  1FFV A;  3Q8F A;  4RGN A;  4O3Z A;  1PUT A;  4REZ A;  2M06 A;  3ZJU A;  5GXG B;  3VZT X;  4US8 A;  1GFQ A;  5E6J A;  1V1O A;  1WYG A;  2KMM A;  3MJ5 A;  3TSS A;  1VRA B;  4RNA A;  2XTQ A;  3DA3 A;  2PVG C;  3BK1 A;  3WI4 A;  3LXF A;  4A6Q A;  1JRP A;  1L0Y B;  1MHH E;  1YS5 A;  1E6E B;  3DA4 A;  4M0W A;  1KFY B;  1PDX A;  3VRB B;  2WXL A;  1VZ7 A;  1BML C;  1HA5 A;  2K5P A;  1PFD A;  1PRN A;  2XE5 A;  4XNK A;  1M4V A;  2Y2X A;  2WU5 B;  1L6V A;  4MT5 A;  2NTT A;  3HVZ A;  1BXT A;  4LTU A;  3P4Q B;  3BWU D;  1TZO A;  1MI0 A;  3RBH A;  3GB1 A;  3AED B;  3IT4 B;  3LK4 1;  1XEE A;  2E3T A;  2INP E;  1AW7 A;  4YWG G;  1QJ9 A;  1FRD A;  3B2F A;  3POQ A;  3IXS A;  4WH4 A;  1YN4 A;  2I38 A;  3AV8 A;  2AQ1 B;  4HKQ A;  3AAA A;  5D3I B;  1IBX B;  4FUV A;  2ERV A;  2LHD A;  1JAL A;  1RWS A;  1GFN A;  3UAQ A;  1KRH A;  1YJJ A;  1K53 A;  1N63 A;  2YPV A;  4USA A;  4C56 C;  4CQN A;  1MHX A;  2QEJ C;  3AE9 B;  5BYQ A;  2WXO A;  4AYE C;  1Q9F A;  4O4U A;  1RYJ A;  4B61 A;  1ZDX A;  1JWU D;  1XLP A;  3UPG A;  2JXT A;  3KWL A;  1OSM A;  2OED A;  2MJE A;  1UGJ A;  1J7B A;  1QJP A;  4JWS C;  2N0S B;  3LK2 B;  4GHB A;  1E7P B;  1MM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...