2R89A

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
417
structure length
363
Chain Sequence
GNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
total genus 87
structure length 363
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r89A00
2R4PA 3BRYA 2R4OA 2R8AA 1T1LA 3BS0A 2R4LA 3PF1A 3DWOX 3BRZA 1T16A 3DWNA 2R4NA 3PGUA 3PGRA 2R88A 3PGSA 2R89A
chains in the Genus database with same CATH superfamily
2F1CX 5PRNA 4FT6A 2FGRA 3BRYA 3T0SA 2W81C 3HWBA 2R4LA 3PQSA 4KR4A 4LSFA 3AAEB 5T5FA 4D65A 2ERVA 1THQA 2YNKA 3SY7A 4AKMA 3DA4A 3K19A 3DA3A 4FESA 2R8AA 4FQEA 4RJXA 1T1LA 3NJTA 3UAQA 2J4UP 1H6S1 5DL7A 1PHOA 4E1TA 4GF4A 3LK41 1ZHZA 3C5OA 1YS5A 3A2SX 5E79O 1OSMA 2Y0LA 2ODJA 5KAIO 3GP6A 4RL9A 1P4TA 3AA7A 4JCHA 2IWWA 2JMMA 3G7GA 5G38A 1ZHTA 3AA6B 3QRAA 5H2FO 3VZWX 1PRNA 4FRTA 2XE3A 1BXWA 4IL6O 3PRNA 3PGUA 2K0LA 3NSGA 3PGRA 1ZHWA 4C4VB 2KZ7B 2R89A 5DL6A 2R4PA 2W80C 3LK2B 4AYMC 3HW9A 2OMFA 2ZLDA 2F1TA 4FSPA 1IZNB 4E1SA 4K3BA 3DWOX 7PRNA 3POUA 2KXPA 2QTKA 4C00A 3AA0A 3BRZA 5B5EO 2R4NA 1G90A 3PGSA 2YPVA 1BH3A 4LSHA 4D5UA 4RLCA 2WVPA 3AA1B 2X27X 2Y7SA 5EE2A 3AAEA 2GE4A 2IWVA 4RJWA 3T24A 5B66O 3EMNX 2MNHA 5FVNA 2N2MA 3VY8X 4AYID 3A0HO 5ADXK 2XMXA 1QJ9A 1QJPA 4JFBA 4QQ1A 3AAAB 4FUVA 2R4OA 2M07A 4UB8O 3PF1A 4FZLA 4O49A 5GTIO 2Y0HA 3LK3B 4BUMX 4KR8A 5G3AA 5IYUA 2XTQA 3WI5A 2N2LA 3A0BO 5DL5A 3JCUO 4GCSA 2Y2XA 4N59A 4AYNA 1MM5A 3UU2A 1GFQA 2M06A 2O4VA 4U9CA 2XE5A 5DL8A 4CTDA 2R88A 1ORMA 3HOLA 4F4BA 2XE2A 4FMSA 3DZMA 4GHBA 1GFOA 2KDYA 2XE1A 4C4VA 5D5DA 4D64A 2KZ7A 2WJQA 4FRXA 4G76A 3LK2A 4N74A 5G39A 3SYBA 3VE2A 4AKRB 2FGQX 4AUIA 1HXUA 1ZHXA 4LSIA 3T20A 2PRNA 4O3ZA 1Q9FA 4LSEA 3SY9A 3POQA 1IZNA 2F1VA 2LFUA 3JTYA 3VZTX 4AYEC 5GTHO 4O3WA 3TZGA 1GFPA 4G75A 4GCPA 2K4TA 2XTRA 4AFKA 2MHLA 4FSOA 3SZVA 3UPGA 4GCQA 5AFUK 4PUXA 1HXXA 4XNKA 1T16A 2J1NA 3PQUA 3AA0B 4O4XA 3SZDA 5ADXL 4N75A 3FYXA 8PRNA 3SYSA 1BT9A 3HOEA 3RBHA 4FZNA 4FZMA 5AFUL 5GV0A 2ZFGA 2JQYA 4XNLA 1S5LO 4AYDC 4B61A 1ZHYA 2PORA 3AA7B 3KVDD 3AAAA 4O3YA 3AA6A 3WU2O 2Y0KA 4KRAA 3LK3A 1GFNA 3POXA 4PJ0O 3WI4A 4AZLA 3VY9X 1HXTA 1MPFA 2KC0A 3DWNA 2AXTO 2WJRA 3VZUX 3VE1A 5TISO 4C69X 1Q9GA 1QJ8A 4O3XB 3LK42 3QRCA 4O4UA 1GFMA 2X9KA 4N58A 6PRNA 1MM4A 4PR7A 3BS0A 1OPFA 5G26A 5JDPA 4K3CA 4RLBA 4UB6O 1E54A 2LHFA 3O0EA 4AKRA 2KXPB 5KAFO 3V8UA 4FOZA 4Z3TA 3KZIO 2XG6A 3AA1A 3PORA
chains in the Genus database with same CATH topology
2R4PA 3BRYA 2R4OA 2R8AA 1T1LA 3BS0A 2R4LA 3PF1A 3DWOX 3BRZA 1T16A 3DWNA 2R4NA 3PGUA 3PGRA 2R88A 3PGSA 2R89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4P A;  3BRY A;  2R4O A;  2R8A A;  1T1L A;  3BS0 A;  2R4L A;  3PF1 A;  3DWO X;  3BRZ A;  1T16 A;  3DWN A;  2R4N A;  3PGU A;  3PGR A;  2R88 A;  3PGS A;  2R89 A; 
#chains in the Genus database with same CATH topology
 2F1C X;  5PRN A;  4FT6 A;  2FGR A;  3BRY A;  3T0S A;  2W81 C;  3HWB A;  2R4L A;  3PQS A;  4KR4 A;  4LSF A;  3AAE B;  5T5F A;  4D65 A;  2ERV A;  1THQ A;  2YNK A;  3SY7 A;  4AKM A;  3DA4 A;  3K19 A;  3DA3 A;  4FES A;  2R8A A;  4FQE A;  4RJX A;  1T1L A;  3NJT A;  3UAQ A;  2J4U P;  1H6S 1;  5DL7 A;  1PHO A;  4E1T A;  4GF4 A;  3LK4 1;  1ZHZ A;  3C5O A;  1YS5 A;  3A2S X;  5E79 O;  1OSM A;  2Y0L A;  2ODJ A;  5KAI O;  3GP6 A;  4RL9 A;  1P4T A;  3AA7 A;  4JCH A;  2IWW A;  2JMM A;  3G7G A;  5G38 A;  1ZHT A;  3AA6 B;  3QRA A;  5H2F O;  3VZW X;  1PRN A;  4FRT A;  2XE3 A;  1BXW A;  4IL6 O;  3PRN A;  3PGU A;  2K0L A;  3NSG A;  3PGR A;  1ZHW A;  4C4V B;  2KZ7 B;  2R89 A;  5DL6 A;  2R4P A;  2W80 C;  3LK2 B;  4AYM C;  3HW9 A;  2OMF A;  2ZLD A;  2F1T A;  4FSP A;  1IZN B;  4E1S A;  4K3B A;  3DWO X;  7PRN A;  3POU A;  2KXP A;  2QTK A;  4C00 A;  3AA0 A;  3BRZ A;  5B5E O;  2R4N A;  1G90 A;  3PGS A;  2YPV A;  1BH3 A;  4LSH A;  4D5U A;  4RLC A;  2WVP A;  3AA1 B;  2X27 X;  2Y7S A;  5EE2 A;  3AAE A;  2GE4 A;  2IWV A;  4RJW A;  3T24 A;  5B66 O;  3EMN X;  2MNH A;  5FVN A;  2N2M A;  3VY8 X;  4AYI D;  3A0H O;  5ADX K;  2XMX A;  1QJ9 A;  1QJP A;  4JFB A;  4QQ1 A;  3AAA B;  4FUV A;  2R4O A;  2M07 A;  4UB8 O;  3PF1 A;  4FZL A;  4O49 A;  5GTI O;  2Y0H A;  3LK3 B;  4BUM X;  4KR8 A;  5G3A A;  5IYU A;  2XTQ A;  3WI5 A;  2N2L A;  3A0B O;  5DL5 A;  3JCU O;  4GCS A;  2Y2X A;  4N59 A;  4AYN A;  1MM5 A;  3UU2 A;  1GFQ A;  2M06 A;  2O4V A;  4U9C A;  2XE5 A;  5DL8 A;  4CTD A;  2R88 A;  1ORM A;  3HOL A;  4F4B A;  2XE2 A;  4FMS A;  3DZM A;  4GHB A;  1GFO A;  2KDY A;  2XE1 A;  4C4V A;  5D5D A;  4D64 A;  2KZ7 A;  2WJQ A;  4FRX A;  4G76 A;  3LK2 A;  4N74 A;  5G39 A;  3SYB A;  3VE2 A;  4AKR B;  2FGQ X;  4AUI A;  1HXU A;  1ZHX A;  4LSI A;  3T20 A;  2PRN A;  4O3Z A;  1Q9F A;  4LSE A;  3SY9 A;  3POQ A;  1IZN A;  2F1V A;  2LFU A;  3JTY A;  3VZT X;  4AYE C;  5GTH O;  4O3W A;  3TZG A;  1GFP A;  4G75 A;  4GCP A;  2K4T A;  2XTR A;  4AFK A;  2MHL A;  4FSO A;  3SZV A;  3UPG A;  4GCQ A;  5AFU K;  4PUX A;  1HXX A;  4XNK A;  1T16 A;  2J1N A;  3PQU A;  3AA0 B;  4O4X A;  3SZD A;  5ADX L;  4N75 A;  3FYX A;  8PRN A;  3SYS A;  1BT9 A;  3HOE A;  3RBH A;  4FZN A;  4FZM A;  5AFU L;  5GV0 A;  2ZFG A;  2JQY A;  4XNL A;  1S5L O;  4AYD C;  4B61 A;  1ZHY A;  2POR A;  3AA7 B;  3KVD D;  3AAA A;  4O3Y A;  3AA6 A;  3WU2 O;  2Y0K A;  4KRA A;  3LK3 A;  1GFN A;  3POX A;  4PJ0 O;  3WI4 A;  4AZL A;  3VY9 X;  1HXT A;  1MPF A;  2KC0 A;  3DWN A;  2AXT O;  2WJR A;  3VZU X;  3VE1 A;  5TIS O;  4C69 X;  1Q9G A;  1QJ8 A;  4O3X B;  3LK4 2;  3QRC A;  4O4U A;  1GFM A;  2X9K A;  4N58 A;  6PRN A;  1MM4 A;  4PR7 A;  3BS0 A;  1OPF A;  5G26 A;  5JDP A;  4K3C A;  4RLB A;  4UB6 O;  1E54 A;  2LHF A;  3O0E A;  4AKR A;  2KXP B;  5KAF O;  3V8U A;  4FOZ A;  4Z3T A;  3KZI O;  2XG6 A;  3AA1 A;  3POR A; 
#chains in the Genus database with same CATH homology
 2R4P A;  3BRY A;  2R4O A;  2R8A A;  1T1L A;  3BS0 A;  2R4L A;  3PF1 A;  3DWO X;  3BRZ A;  1T16 A;  3DWN A;  2R4N A;  3PGU A;  3PGR A;  2R88 A;  3PGS A;  2R89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...