2R89A

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n3
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
417
structure length
363
Chain Sequence
b'GNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 87
structure length 363
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r89A00
1T1LA 2R88A 3PGRA 2R8AA 2R4PA 2R89A 3PGSA 3DWNA 3PGUA 3BRYA 2R4OA 2R4LA 1T16A 3DWOX 3BRZA 3BS0A 3PF1A 2R4NA
chains in the Genus database with same CATH superfamily
5IYUA 2LFUA 3AA6B 3SZDA 2Y0HA 2Y7SA 1QJPA 1YS5A 3AA0B 3DWNA 1PRNA 4KR4A 3GP6A 3SYBA 2ERVA 1P4TA 4FSOA 4RLBA 2FGRA 2K0LA 2PORA 4FZNA 3AAEA 4D65A 4G76A 1ZHZA 4N58A 2KDYA 5DL5A 3A2SX 4AZLA 2XTQA 3AAEB 1T1LA 2R88A 4JFBA 3NSGA 4Z3TA 3A0HO 5D5DA 5AFUK 4GCQA 3VE1A 2IWWA 3HW9A 2KZ7A 1QJ9A 1GFQA 3PQSA 2MNHA 3QRCA 4GCPA 3PF1A 5PRNA 3V8UA 4JCHA 4RJWA 2Y2XA 1QJ8A 3PRNA 4GF4A 3NJTA 4RL9A 3SYSA 4E1TA 3LK42 2KZ7B 3PGRA 3SZVA 3T20A 2KXPA 3JCUO 4O3XB 4AYEC 2Y0LA 3C5OA 5GV0A 4FZLA 2XTRA 1BH3A 2GE4A 1MPFA 4N74A 4N75A 3T24A 4C00A 3FYXA 3TZGA 1BT9A 2JQYA 2KXPB 4AYMC 2J1NA 3PGSA 4O4XA 4FMSA 7PRNA 1PHOA 1HXUA 2R4OA 3AA7B 3RBHA 3K19A 4FRTA 4AYDC 4C4VA 4IL6O 2PRNA 3EMNX 3T0SA 5E79O 1T16A 2F1CX 4FZMA 4XNKA 4C4VB 4FQEA 2YNKA 4E1SA 5ADXK 3WU2O 3UAQA 3KVDD 3LK41 3HOEA 1HXTA 3WI5A 4O4UA 4UB8O 3O0EA 4KRAA 5DL6A 5B66O 3SY9A 1ZHWA 5AFUL 3UPGA 2XE2A 2Y0KA 4FT6A 2R4LA 5H2FO 3VY8X 4FUVA 4PUXA 3DZMA 2LHFA 2WJRA 1THQA 5DL7A 1Q9GA 2F1TA 2ZFGA 5GTIO 4AFKA 4XNLA 4AKMA 4O3YA 5G26A 1MM4A 3DWOX 4LSHA 5G38A 1ZHYA 4K3CA 4CTDA 1IZNA 4GCSA 1Q9FA 2M06A 4FESA 4LSIA 2J4UP 3A0BO 4RJXA 3WI4A 4LSEA 4KR8A 2X27X 2OMFA 4B61A 4F4BA 6PRNA 1HXXA 3POUA 2W81C 4PJ0O 1GFMA 5TISO 3DA3A 1GFOA 5ADXL 2WJQA 4PR7A 2XE5A 3VZTX 4FRXA 1G90A 2KC0A 2N2MA 5EE2A 5GTHO 4AYNA 5JDPA 2IWVA 1ORMA 1E54A 4G75A 5KAIO 2MHLA 5KAFO 4O49A 1S5LO 1OSMA 2K4TA 2N2LA 2R4PA 3PORA 4K3BA 1GFPA 3PGUA 3VZUX 4D5UA 3VZWX 4O3WA 4AKRA 3G7GA 5G3AA 3HWBA 8PRNA 3AAAA 2ODJA 2XMXA 2XE1A 4O3ZA 3LK2A 4LSFA 4AKRB 3HOLA 2QTKA 2ZLDA 3LK3A 3AAAB 2W80C 4RLCA 3JTYA 5FVNA 2R8AA 3LK2B 3QRAA 2F1VA 5DL8A 3BRYA 3POQA 3LK3B 3BS0A 3PQUA 1MM5A 2O4VA 2XE3A 1IZNB 1OPFA 2JMMA 2YPVA 3DA4A 1H6S1 5T5FA 3VE2A 3VY9X 2AXTO 3AA1A 1ZHXA 4QQ1A 4FSPA 3SY7A 3UU2A 2WVPA 3BRZA 1GFNA 4UB6O 2FGQX 2M07A 2XG6A 4GHBA 4BUMX 3POXA 4AUIA 1ZHTA 4D64A 3AA1B 4C69X 4N59A 2X9KA 5G39A 3AA6A 2R89A 4U9CA 5B5EO 4FOZA 4AYID 3AA7A 1BXWA 3AA0A 3KZIO 2R4NA
chains in the Genus database with same CATH topology
1T1LA 2R88A 3PGRA 2R8AA 2R4PA 2R89A 3PGSA 3DWNA 3PGUA 3BRYA 2R4OA 2R4LA 1T16A 3DWOX 3BRZA 3BS0A 3PF1A 2R4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  2R88 A;  3PGR A;  2R8A A;  2R4P A;  2R89 A;  3PGS A;  3DWN A;  3PGU A;  3BRY A;  2R4O A;  2R4L A;  1T16 A;  3DWO X;  3BRZ A;  3BS0 A;  3PF1 A;  2R4N A; 
#chains in the Genus database with same CATH topology
 5IYU A;  2LFU A;  3AA6 B;  3SZD A;  2Y0H A;  2Y7S A;  1QJP A;  1YS5 A;  3AA0 B;  3DWN A;  1PRN A;  4KR4 A;  3GP6 A;  3SYB A;  2ERV A;  1P4T A;  4FSO A;  4RLB A;  2FGR A;  2K0L A;  2POR A;  4FZN A;  3AAE A;  4D65 A;  4G76 A;  1ZHZ A;  4N58 A;  2KDY A;  5DL5 A;  3A2S X;  4AZL A;  2XTQ A;  3AAE B;  1T1L A;  2R88 A;  4JFB A;  3NSG A;  4Z3T A;  3A0H O;  5D5D A;  5AFU K;  4GCQ A;  3VE1 A;  2IWW A;  3HW9 A;  2KZ7 A;  1QJ9 A;  1GFQ A;  3PQS A;  2MNH A;  3QRC A;  4GCP A;  3PF1 A;  5PRN A;  3V8U A;  4JCH A;  4RJW A;  2Y2X A;  1QJ8 A;  3PRN A;  4GF4 A;  3NJT A;  4RL9 A;  3SYS A;  4E1T A;  3LK4 2;  2KZ7 B;  3PGR A;  3SZV A;  3T20 A;  2KXP A;  3JCU O;  4O3X B;  4AYE C;  2Y0L A;  3C5O A;  5GV0 A;  4FZL A;  2XTR A;  1BH3 A;  2GE4 A;  1MPF A;  4N74 A;  4N75 A;  3T24 A;  4C00 A;  3FYX A;  3TZG A;  1BT9 A;  2JQY A;  2KXP B;  4AYM C;  2J1N A;  3PGS A;  4O4X A;  4FMS A;  7PRN A;  1PHO A;  1HXU A;  2R4O A;  3AA7 B;  3RBH A;  3K19 A;  4FRT A;  4AYD C;  4C4V A;  4IL6 O;  2PRN A;  3EMN X;  3T0S A;  5E79 O;  1T16 A;  2F1C X;  4FZM A;  4XNK A;  4C4V B;  4FQE A;  2YNK A;  4E1S A;  5ADX K;  3WU2 O;  3UAQ A;  3KVD D;  3LK4 1;  3HOE A;  1HXT A;  3WI5 A;  4O4U A;  4UB8 O;  3O0E A;  4KRA A;  5DL6 A;  5B66 O;  3SY9 A;  1ZHW A;  5AFU L;  3UPG A;  2XE2 A;  2Y0K A;  4FT6 A;  2R4L A;  5H2F O;  3VY8 X;  4FUV A;  4PUX A;  3DZM A;  2LHF A;  2WJR A;  1THQ A;  5DL7 A;  1Q9G A;  2F1T A;  2ZFG A;  5GTI O;  4AFK A;  4XNL A;  4AKM A;  4O3Y A;  5G26 A;  1MM4 A;  3DWO X;  4LSH A;  5G38 A;  1ZHY A;  4K3C A;  4CTD A;  1IZN A;  4GCS A;  1Q9F A;  2M06 A;  4FES A;  4LSI A;  2J4U P;  3A0B O;  4RJX A;  3WI4 A;  4LSE A;  4KR8 A;  2X27 X;  2OMF A;  4B61 A;  4F4B A;  6PRN A;  1HXX A;  3POU A;  2W81 C;  4PJ0 O;  1GFM A;  5TIS O;  3DA3 A;  1GFO A;  5ADX L;  2WJQ A;  4PR7 A;  2XE5 A;  3VZT X;  4FRX A;  1G90 A;  2KC0 A;  2N2M A;  5EE2 A;  5GTH O;  4AYN A;  5JDP A;  2IWV A;  1ORM A;  1E54 A;  4G75 A;  5KAI O;  2MHL A;  5KAF O;  4O49 A;  1S5L O;  1OSM A;  2K4T A;  2N2L A;  2R4P A;  3POR A;  4K3B A;  1GFP A;  3PGU A;  3VZU X;  4D5U A;  3VZW X;  4O3W A;  4AKR A;  3G7G A;  5G3A A;  3HWB A;  8PRN A;  3AAA A;  2ODJ A;  2XMX A;  2XE1 A;  4O3Z A;  3LK2 A;  4LSF A;  4AKR B;  3HOL A;  2QTK A;  2ZLD A;  3LK3 A;  3AAA B;  2W80 C;  4RLC A;  3JTY A;  5FVN A;  2R8A A;  3LK2 B;  3QRA A;  2F1V A;  5DL8 A;  3BRY A;  3POQ A;  3LK3 B;  3BS0 A;  3PQU A;  1MM5 A;  2O4V A;  2XE3 A;  1IZN B;  1OPF A;  2JMM A;  2YPV A;  3DA4 A;  1H6S 1;  5T5F A;  3VE2 A;  3VY9 X;  2AXT O;  3AA1 A;  1ZHX A;  4QQ1 A;  4FSP A;  3SY7 A;  3UU2 A;  2WVP A;  3BRZ A;  1GFN A;  4UB6 O;  2FGQ X;  2M07 A;  2XG6 A;  4GHB A;  4BUM X;  3POX A;  4AUI A;  1ZHT A;  4D64 A;  3AA1 B;  4C69 X;  4N59 A;  2X9K A;  5G39 A;  3AA6 A;  2R89 A;  4U9C A;  5B5E O;  4FOZ A;  4AYI D;  3AA7 A;  1BXW A;  3AA0 A;  3KZI O;  2R4N A; 
#chains in the Genus database with same CATH homology
 1T1L A;  2R88 A;  3PGR A;  2R8A A;  2R4P A;  2R89 A;  3PGS A;  3DWN A;  3PGU A;  3BRY A;  2R4O A;  2R4L A;  1T16 A;  3DWO X;  3BRZ A;  3BS0 A;  3PF1 A;  2R4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...