2WVPA

Synthetically modified ompg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
262
Chain Sequence
NDWHFNIGAMYEIENVGLAEPSVYFNAANGPWRIALAYYQEGPVDYKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPCTRIGLDRWSNWDEGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of a Synthetically Modified Ompg.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN G
total genus 62
structure length 262
sequence length 280
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wvpA00
2WJQA 2X9KA 4CTDA 4FQEA 2IWVA 4PR7A 2IWWA 2F1CX 2JQYA 2WJRA 2WVPA
chains in the Genus database with same CATH superfamily
3HW9A 5KAFO 5PRNA 3POUA 3A0BO 3PF1A 4FSPA 3AAAB 3GP6A 4AFKA 1H6S1 2MHLA 2J4UP 4LSIA 4GHBA 2K4TA 2KDYA 3FYXA 3VZWX 4UB6O 4O4UA 4Z3TA 5IYUA 5TISO 4XNKA 4FMSA 2XTRA 3JCUO 3SZVA 5ADXK 3LK2B 4O3XB 5G38A 1HXUA 5GTHO 4PJ0O 3K19A 5DL8A 2XMXA 3V8UA 1QJ9A 4IL6O 3PORA 2XG6A 3POXA 5GTIO 4O49A 4LSFA 4RL9A 3BRZA 4KR4A 4LSEA 1P4TA 4FOZA 4N74A 3BS0A 5KAIO 4RLCA 3A0HO 3DA4A 2XE2A 4B61A 3POQA 4FZLA 5EE2A 1T16A 4FESA 2YPVA 1Q9GA 3VE2A 4LSHA 2WJRA 2WVPA 2ZLDA 2WJQA 4FQEA 4GCQA 4K3CA 3AA6B 3AA0A 4AYDC 4K3BA 3PGRA 1MM4A 3KZIO 4AKRB 2IWWA 2R4OA 3A2SX 4GCSA 5D5DA 5G39A 1PRNA 5DL7A 3RBHA 1GFPA 1IZNB 3HOLA 3T0SA 3VY9X 2R4PA 1BXWA 1ZHWA 4JFBA 4KR8A 1HXXA 2M06A 1ZHYA 3VZTX 4F4BA 3DWNA 4XNLA 3UAQA 3EMNX 4O3WA 3HOEA 2KXPB 3DZMA 2XE3A 4N75A 2JQYA 2QTKA 5B66O 4KRAA 4QQ1A 4GCPA 4N59A 2PRNA 1QJPA 2N2LA 3AA7B 3PQSA 3NJTA 5DL5A 2LFUA 5GV0A 2FGQX 1E54A 2Y2XA 2N2MA 4AYMC 5H2FO 2YNKA 2F1TA 3NSGA 2KZ7A 3DA3A 4BUMX 3AAEB 3C5OA 1OPFA 3LK3B 2XE5A 2K0LA 4FZNA 4D64A 3AA0B 4RJXA 4AUIA 4O4XA 4AYEC 5FVNA 2O4VA 3HWBA 2GE4A 5AFUK 3WI5A 3TZGA 3VZUX 4N58A 1GFOA 2LHFA 2Y7SA 3KVDD 4FRTA 4FT6A 4FUVA 4D5UA 3QRAA 3PGSA 2KC0A 4D65A 2AXTO 3JTYA 4G76A 3T20A 3AA1B 1HXTA 3AAAA 5DL6A 3SY9A 2ERVA 1BT9A 2X27X 3AA7A 2W81C 4AZLA 1ZHXA 4AYID 2JMMA 2M07A 4E1SA 5B5EO 2Y0KA 1ORMA 2R8AA 4AYNA 6PRNA 1ZHZA 3UU2A 4UB8O 1QJ8A 1YS5A 3DWOX 3VY8X 3WI4A 1G90A 5AFUL 3WU2O 4CTDA 4E1TA 1Q9FA 4C4VB 1GFQA 4JCHA 3O0EA 1GFMA 3G7GA 1MM5A 2R89A 4FRXA 5T5FA 4AKMA 4C69X 3LK41 2XTQA 4AKRA 4FSOA 3LK2A 1IZNA 3SYSA 1T1LA 2MNHA 3AAEA 2R4NA 4G75A 5G3AA 2X9KA 8PRNA 4C00A 3QRCA 3AA1A 3PGUA 4FZMA 2KXPA 3SY7A 3PQUA 3SZDA 1GFNA 4GF4A 4PR7A 2W80C 2F1CX 1BH3A 4RLBA 3SYBA 2F1VA 1THQA 3PRNA 4O3YA 2Y0LA 2ODJA 3LK42 2R88A 2OMFA 2Y0HA 1PHOA 2IWVA 4RJWA 4U9CA 7PRNA 2XE1A 5ADXL 2ZFGA 3AA6A 2FGRA 4PUXA 3T24A 1OSMA 1MPFA 3VE1A 3UPGA 2PORA 3BRYA 5E79O 4C4VA 4O3ZA 2KZ7B 2R4LA 1S5LO 5G26A 1ZHTA 3LK3A 5JDPA 2J1NA
chains in the Genus database with same CATH topology
2WJQA 2X9KA 4CTDA 4FQEA 2IWVA 4PR7A 2IWWA 2F1CX 2JQYA 2WJRA 2WVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJQ A;  2X9K A;  4CTD A;  4FQE A;  2IWV A;  4PR7 A;  2IWW A;  2F1C X;  2JQY A;  2WJR A;  2WVP A; 
#chains in the Genus database with same CATH topology
 3HW9 A;  5KAF O;  5PRN A;  3POU A;  3A0B O;  3PF1 A;  4FSP A;  3AAA B;  3GP6 A;  4AFK A;  1H6S 1;  2MHL A;  2J4U P;  4LSI A;  4GHB A;  2K4T A;  2KDY A;  3FYX A;  3VZW X;  4UB6 O;  4O4U A;  4Z3T A;  5IYU A;  5TIS O;  4XNK A;  4FMS A;  2XTR A;  3JCU O;  3SZV A;  5ADX K;  3LK2 B;  4O3X B;  5G38 A;  1HXU A;  5GTH O;  4PJ0 O;  3K19 A;  5DL8 A;  2XMX A;  3V8U A;  1QJ9 A;  4IL6 O;  3POR A;  2XG6 A;  3POX A;  5GTI O;  4O49 A;  4LSF A;  4RL9 A;  3BRZ A;  4KR4 A;  4LSE A;  1P4T A;  4FOZ A;  4N74 A;  3BS0 A;  5KAI O;  4RLC A;  3A0H O;  3DA4 A;  2XE2 A;  4B61 A;  3POQ A;  4FZL A;  5EE2 A;  1T16 A;  4FES A;  2YPV A;  1Q9G A;  3VE2 A;  4LSH A;  2WJR A;  2WVP A;  2ZLD A;  2WJQ A;  4FQE A;  4GCQ A;  4K3C A;  3AA6 B;  3AA0 A;  4AYD C;  4K3B A;  3PGR A;  1MM4 A;  3KZI O;  4AKR B;  2IWW A;  2R4O A;  3A2S X;  4GCS A;  5D5D A;  5G39 A;  1PRN A;  5DL7 A;  3RBH A;  1GFP A;  1IZN B;  3HOL A;  3T0S A;  3VY9 X;  2R4P A;  1BXW A;  1ZHW A;  4JFB A;  4KR8 A;  1HXX A;  2M06 A;  1ZHY A;  3VZT X;  4F4B A;  3DWN A;  4XNL A;  3UAQ A;  3EMN X;  4O3W A;  3HOE A;  2KXP B;  3DZM A;  2XE3 A;  4N75 A;  2JQY A;  2QTK A;  5B66 O;  4KRA A;  4QQ1 A;  4GCP A;  4N59 A;  2PRN A;  1QJP A;  2N2L A;  3AA7 B;  3PQS A;  3NJT A;  5DL5 A;  2LFU A;  5GV0 A;  2FGQ X;  1E54 A;  2Y2X A;  2N2M A;  4AYM C;  5H2F O;  2YNK A;  2F1T A;  3NSG A;  2KZ7 A;  3DA3 A;  4BUM X;  3AAE B;  3C5O A;  1OPF A;  3LK3 B;  2XE5 A;  2K0L A;  4FZN A;  4D64 A;  3AA0 B;  4RJX A;  4AUI A;  4O4X A;  4AYE C;  5FVN A;  2O4V A;  3HWB A;  2GE4 A;  5AFU K;  3WI5 A;  3TZG A;  3VZU X;  4N58 A;  1GFO A;  2LHF A;  2Y7S A;  3KVD D;  4FRT A;  4FT6 A;  4FUV A;  4D5U A;  3QRA A;  3PGS A;  2KC0 A;  4D65 A;  2AXT O;  3JTY A;  4G76 A;  3T20 A;  3AA1 B;  1HXT A;  3AAA A;  5DL6 A;  3SY9 A;  2ERV A;  1BT9 A;  2X27 X;  3AA7 A;  2W81 C;  4AZL A;  1ZHX A;  4AYI D;  2JMM A;  2M07 A;  4E1S A;  5B5E O;  2Y0K A;  1ORM A;  2R8A A;  4AYN A;  6PRN A;  1ZHZ A;  3UU2 A;  4UB8 O;  1QJ8 A;  1YS5 A;  3DWO X;  3VY8 X;  3WI4 A;  1G90 A;  5AFU L;  3WU2 O;  4CTD A;  4E1T A;  1Q9F A;  4C4V B;  1GFQ A;  4JCH A;  3O0E A;  1GFM A;  3G7G A;  1MM5 A;  2R89 A;  4FRX A;  5T5F A;  4AKM A;  4C69 X;  3LK4 1;  2XTQ A;  4AKR A;  4FSO A;  3LK2 A;  1IZN A;  3SYS A;  1T1L A;  2MNH A;  3AAE A;  2R4N A;  4G75 A;  5G3A A;  2X9K A;  8PRN A;  4C00 A;  3QRC A;  3AA1 A;  3PGU A;  4FZM A;  2KXP A;  3SY7 A;  3PQU A;  3SZD A;  1GFN A;  4GF4 A;  4PR7 A;  2W80 C;  2F1C X;  1BH3 A;  4RLB A;  3SYB A;  2F1V A;  1THQ A;  3PRN A;  4O3Y A;  2Y0L A;  2ODJ A;  3LK4 2;  2R88 A;  2OMF A;  2Y0H A;  1PHO A;  2IWV A;  4RJW A;  4U9C A;  7PRN A;  2XE1 A;  5ADX L;  2ZFG A;  3AA6 A;  2FGR A;  4PUX A;  3T24 A;  1OSM A;  1MPF A;  3VE1 A;  3UPG A;  2POR A;  3BRY A;  5E79 O;  4C4V A;  4O3Z A;  2KZ7 B;  2R4L A;  1S5L O;  5G26 A;  1ZHT A;  3LK3 A;  5JDP A;  2J1N A; 
#chains in the Genus database with same CATH homology
 2WJQ A;  2X9K A;  4CTD A;  4FQE A;  2IWV A;  4PR7 A;  2IWW A;  2F1C X;  2JQY A;  2WJR A;  2WVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...