2WVPA

Synthetically modified ompg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
262
Chain Sequence
NDWHFNIGAMYEIENVGLAEPSVYFNAANGPWRIALAYYQEGPVDYKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPCTRIGLDRWSNWDEGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Structural and Functional Characterization of a Synthetically Modified Ompg.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 62
structure length 262
sequence length 280
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wvpA00
2F1CX 4PR7A 4FQEA 4CTDA 2IWWA 2IWVA 2X9KA 2WVPA 2WJQA 2JQYA 2WJRA
chains in the Genus database with same CATH superfamily
4O3ZA 2M06A 4RLCA 4O4XA 3NSGA 3T24A 3BRYA 4C69X 3A0HO 3AA1B 3T20A 3VE2A 5ADXK 1OSMA 2XE1A 2J4UP 3AA6B 3HOLA 2LFUA 1GFOA 1YS5A 2GE4A 3PORA 4XNKA 4IL6O 5JDPA 4Z3TA 3LK41 4FOZA 3SY7A 5DL8A 4N74A 2FGQX 3WI5A 3PGUA 4G76A 3POXA 2KXPA 4FMSA 4AYNA 5G26A 1MPFA 2N2LA 2XE2A 4FRXA 4FQEA 5TISO 4XNLA 2IWVA 3VY8X 4D5UA 3SYBA 4E1TA 4PJ0O 1GFQA 4FSPA 4LSFA 2KZ7A 2XTQA 3POUA 4D64A 2ZLDA 2OMFA 2K0LA 1PRNA 1GFPA 1ZHTA 3FYXA 4AKRA 2Y7SA 3A2SX 3HOEA 3QRCA 3RBHA 3AAAA 1BXWA 4RL9A 3SZDA 5IYUA 1BH3A 1HXXA 1Q9FA 3VE1A 4K3CA 1H6S1 2XG6A 2FGRA 2Y0KA 2Y0LA 3NJTA 4KRAA 2R88A 3GP6A 4JCHA 1G90A 2R4LA 2KXPB 3PF1A 4N75A 1HXUA 2YPVA 3POQA 5G3AA 5B5EO 2W81C 3QRAA 4G75A 2WJQA 4O4UA 2O4VA 4JFBA 4U9CA 3VZTX 2F1VA 2X27X 4RJXA 2K4TA 4FRTA 4GCQA 3PGRA 5DL5A 2R8AA 3T0SA 4O49A 3UU2A 3K19A 3LK2A 5FVNA 4FT6A 4LSIA 4RJWA 2KDYA 1T16A 2WJRA 3KVDD 4AKRB 5GTIO 5GV0A 3AA0A 3AAEA 3C5OA 4N59A 5H2FO 3UPGA 5E79O 2M07A 2J1NA 3G7GA 4AYID 1P4TA 3UAQA 1QJ8A 3DWOX 1ZHWA 4FZMA 3KZIO 4LSHA 5T5FA 4E1SA 4PUXA 3SYSA 1ORMA 1IZNA 1ZHZA 2F1TA 4O3XB 2XTRA 3TZGA 2KC0A 3LK3A 4C4VA 3DA3A 4F4BA 3HWBA 2R89A 2QTKA 5KAIO 1ZHXA 4BUMX 4GCSA 6PRNA 2XE5A 3DWNA 3BRZA 4C00A 2PORA 2Y2XA 3V8UA 1QJPA 1OPFA 5DL7A 2W80C 1BT9A 4FSOA 5EE2A 4AFKA 4D65A 4KR4A 3VZUX 3DA4A 3EMNX 5D5DA 2R4NA 2MHLA 3AA7A 4FZLA 1GFNA 2KZ7B 2PRNA 3A0BO 4O3WA 4QQ1A 3SY9A 4AUIA 4N58A 1QJ9A 1MM5A 1S5LO 2XE3A 1ZHYA 3AAEB 3AA0B 3LK42 4GF4A 5DL6A 3VY9X 3WU2O 5AFUK 5ADXL 3JTYA 5PRNA 5GTHO 3AAAB 2LHFA 4AYMC 3BS0A 1Q9GA 4AKMA 2JQYA 2YNKA 1IZNB 5B66O 4FUVA 1HXTA 2ZFGA 3AA1A 3LK3B 3PQUA 3PGSA 3DZMA 4UB6O 4AZLA 4C4VB 1E54A 2X9KA 5G38A 4AYDC 3AA6A 1T1LA 2AXTO 4LSEA 2JMMA 2N2MA 1THQA 2R4PA 2Y0HA 3JCUO 4PR7A 5G39A 3SZVA 3PQSA 5KAFO 1PHOA 4GCPA 2WVPA 1MM4A 4K3BA 2ERVA 4O3YA 2ODJA 4B61A 2MNHA 3VZWX 8PRNA 3AA7B 2R4OA 4FZNA 4RLBA 4KR8A 2F1CX 4AYEC 2IWWA 1GFMA 3O0EA 4CTDA 7PRNA 3LK2B 5AFUL 2XMXA 4GHBA 4FESA 3PRNA 4UB8O 3WI4A 3HW9A
chains in the Genus database with same CATH topology
2F1CX 4PR7A 4FQEA 4CTDA 2IWWA 2IWVA 2X9KA 2WVPA 2WJQA 2JQYA 2WJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1C X;  4PR7 A;  4FQE A;  4CTD A;  2IWW A;  2IWV A;  2X9K A;  2WVP A;  2WJQ A;  2JQY A;  2WJR A; 
#chains in the Genus database with same CATH topology
 4O3Z A;  2M06 A;  4RLC A;  4O4X A;  3NSG A;  3T24 A;  3BRY A;  4C69 X;  3A0H O;  3AA1 B;  3T20 A;  3VE2 A;  5ADX K;  1OSM A;  2XE1 A;  2J4U P;  3AA6 B;  3HOL A;  2LFU A;  1GFO A;  1YS5 A;  2GE4 A;  3POR A;  4XNK A;  4IL6 O;  5JDP A;  4Z3T A;  3LK4 1;  4FOZ A;  3SY7 A;  5DL8 A;  4N74 A;  2FGQ X;  3WI5 A;  3PGU A;  4G76 A;  3POX A;  2KXP A;  4FMS A;  4AYN A;  5G26 A;  1MPF A;  2N2L A;  2XE2 A;  4FRX A;  4FQE A;  5TIS O;  4XNL A;  2IWV A;  3VY8 X;  4D5U A;  3SYB A;  4E1T A;  4PJ0 O;  1GFQ A;  4FSP A;  4LSF A;  2KZ7 A;  2XTQ A;  3POU A;  4D64 A;  2ZLD A;  2OMF A;  2K0L A;  1PRN A;  1GFP A;  1ZHT A;  3FYX A;  4AKR A;  2Y7S A;  3A2S X;  3HOE A;  3QRC A;  3RBH A;  3AAA A;  1BXW A;  4RL9 A;  3SZD A;  5IYU A;  1BH3 A;  1HXX A;  1Q9F A;  3VE1 A;  4K3C A;  1H6S 1;  2XG6 A;  2FGR A;  2Y0K A;  2Y0L A;  3NJT A;  4KRA A;  2R88 A;  3GP6 A;  4JCH A;  1G90 A;  2R4L A;  2KXP B;  3PF1 A;  4N75 A;  1HXU A;  2YPV A;  3POQ A;  5G3A A;  5B5E O;  2W81 C;  3QRA A;  4G75 A;  2WJQ A;  4O4U A;  2O4V A;  4JFB A;  4U9C A;  3VZT X;  2F1V A;  2X27 X;  4RJX A;  2K4T A;  4FRT A;  4GCQ A;  3PGR A;  5DL5 A;  2R8A A;  3T0S A;  4O49 A;  3UU2 A;  3K19 A;  3LK2 A;  5FVN A;  4FT6 A;  4LSI A;  4RJW A;  2KDY A;  1T16 A;  2WJR A;  3KVD D;  4AKR B;  5GTI O;  5GV0 A;  3AA0 A;  3AAE A;  3C5O A;  4N59 A;  5H2F O;  3UPG A;  5E79 O;  2M07 A;  2J1N A;  3G7G A;  4AYI D;  1P4T A;  3UAQ A;  1QJ8 A;  3DWO X;  1ZHW A;  4FZM A;  3KZI O;  4LSH A;  5T5F A;  4E1S A;  4PUX A;  3SYS A;  1ORM A;  1IZN A;  1ZHZ A;  2F1T A;  4O3X B;  2XTR A;  3TZG A;  2KC0 A;  3LK3 A;  4C4V A;  3DA3 A;  4F4B A;  3HWB A;  2R89 A;  2QTK A;  5KAI O;  1ZHX A;  4BUM X;  4GCS A;  6PRN A;  2XE5 A;  3DWN A;  3BRZ A;  4C00 A;  2POR A;  2Y2X A;  3V8U A;  1QJP A;  1OPF A;  5DL7 A;  2W80 C;  1BT9 A;  4FSO A;  5EE2 A;  4AFK A;  4D65 A;  4KR4 A;  3VZU X;  3DA4 A;  3EMN X;  5D5D A;  2R4N A;  2MHL A;  3AA7 A;  4FZL A;  1GFN A;  2KZ7 B;  2PRN A;  3A0B O;  4O3W A;  4QQ1 A;  3SY9 A;  4AUI A;  4N58 A;  1QJ9 A;  1MM5 A;  1S5L O;  2XE3 A;  1ZHY A;  3AAE B;  3AA0 B;  3LK4 2;  4GF4 A;  5DL6 A;  3VY9 X;  3WU2 O;  5AFU K;  5ADX L;  3JTY A;  5PRN A;  5GTH O;  3AAA B;  2LHF A;  4AYM C;  3BS0 A;  1Q9G A;  4AKM A;  2JQY A;  2YNK A;  1IZN B;  5B66 O;  4FUV A;  1HXT A;  2ZFG A;  3AA1 A;  3LK3 B;  3PQU A;  3PGS A;  3DZM A;  4UB6 O;  4AZL A;  4C4V B;  1E54 A;  2X9K A;  5G38 A;  4AYD C;  3AA6 A;  1T1L A;  2AXT O;  4LSE A;  2JMM A;  2N2M A;  1THQ A;  2R4P A;  2Y0H A;  3JCU O;  4PR7 A;  5G39 A;  3SZV A;  3PQS A;  5KAF O;  1PHO A;  4GCP A;  2WVP A;  1MM4 A;  4K3B A;  2ERV A;  4O3Y A;  2ODJ A;  4B61 A;  2MNH A;  3VZW X;  8PRN A;  3AA7 B;  2R4O A;  4FZN A;  4RLB A;  4KR8 A;  2F1C X;  4AYE C;  2IWW A;  1GFM A;  3O0E A;  4CTD A;  7PRN A;  3LK2 B;  5AFU L;  2XMX A;  4GHB A;  4FES A;  3PRN A;  4UB8 O;  3WI4 A;  3HW9 A; 
#chains in the Genus database with same CATH homology
 2F1C X;  4PR7 A;  4FQE A;  4CTD A;  2IWW A;  2IWV A;  2X9K A;  2WVP A;  2WJQ A;  2JQY A;  2WJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...