2WVPA

Synthetically modified ompg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
280
structure length
262
Chain Sequence
NDWHFNIGAMYEIENVGLAEPSVYFNAANGPWRIALAYYQEGPVDYKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPCTRIGLDRWSNWDEGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYSFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords OUTER MEMBRANE PROTEIN G
publication title Structural and Functional Characterization of a Synthetically Modified Ompg.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 262
sequence length 280
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2wvpA00
4PR7A 2JQYA 2WJRA 2IWVA 4FQEA 2X9KA 2IWWA 4CTDA 2WJQA 2WVPA 2F1CX
chains in the Genus database with same CATH superfamily
1ZHYA 2QTKA 2J1NA 5G38A 4RJXA 2IWWA 4N59A 4FESA 3AAAA 3PGSA 3A0HO 4N75A 3G7GA 1THQA 5DL8A 3VY8X 2O4VA 3BRZA 2Y0LA 4FT6A 4FRXA 1PHOA 1T1LA 3AA7B 3RBHA 5T5FA 2OMFA 3T0SA 4O49A 2PORA 4UB8O 3WU2O 3DZMA 2K0LA 1ZHWA 2N2MA 4O3XB 4PR7A 5DL7A 2Y0KA 7PRNA 4FRTA 4FMSA 2AXTO 2R88A 3KZIO 3PGRA 2Y7SA 1QJ8A 5G26A 3C5OA 2F1VA 3AA7A 2KZ7B 5E79O 2WJQA 2XE3A 2GE4A 3SZVA 4FZLA 1P4TA 3PRNA 4AYMC 4F4BA 1QJPA 3AAAB 3VZUX 3WI5A 4AYNA 3SZDA 2WVPA 2F1TA 2LHFA 3DWNA 3HW9A 4FUVA 3LK2A 4O4XA 3POXA 2K4TA 2Y2XA 4QQ1A 1OSMA 3JCUO 5KAIO 2X27X 3A0BO 4N58A 4E1TA 2XTQA 3GP6A 2YPVA 2F1CX 4C4VA 3QRAA 2WJRA 4GCQA 3FYXA 2FGRA 5D5DA 4FQEA 4FZMA 2XMXA 1MM5A 3DA3A 4D5UA 1GFQA 1S5LO 4PUXA 3LK42 3QRCA 1ZHZA 2MHLA 3O0EA 4RLCA 2R8AA 3PGUA 2YNKA 1QJ9A 3HOLA 4LSIA 3KVDD 4U9CA 5GV0A 1HXXA 3DA4A 3POUA 4AYDC 2FGQX 2XE2A 2XTRA 3AAEB 3JTYA 4KRAA 3UU2A 4LSFA 5ADXK 5AFUK 2XG6A 2KXPB 2XE1A 3NSGA 4C00A 5FVNA 3LK2B 4AZLA 1G90A 3SY9A 3AA1B 2PRNA 3UAQA 1YS5A 2KDYA 3VY9X 4D64A 1BT9A 3WI4A 3AAEA 4C4VB 3HOEA 2LFUA 2XE5A 2JQYA 1BXWA 1PRNA 2KXPA 3PORA 4AKRA 4GCPA 2KC0A 4GHBA 3TZGA 2N2LA 4G76A 1Q9GA 4FZNA 3AA1A 1ORMA 4JFBA 3VZTX 4O3ZA 4KR4A 3POQA 5AFUL 5ADXL 3A2SX 3VZWX 3PF1A 4FSPA 2ZLDA 1ZHTA 2R4NA 1IZNB 2X9KA 3AA0A 3AA6A 5DL6A 1GFNA 2W81C 1MPFA 1GFPA 4GCSA 2IWVA 4PJ0O 5DL5A 4AYEC 3T20A 4K3BA 3BRYA 5KAFO 4LSEA 4D65A 1GFOA 4FSOA 4JCHA 5H2FO 5PRNA 1IZNA 1MM4A 1OPFA 2JMMA 4RLBA 3DWOX 8PRNA 4B61A 2R89A 4AKRB 3LK3B 3VE1A 1Q9FA 1H6S1 1HXTA 4IL6O 3SY7A 3VE2A 6PRNA 2ERVA 5GTIO 1E54A 3SYSA 3AA6B 3AA0B 2W80C 1HXUA 2M06A 3LK3A 5EE2A 5B5EO 4LSHA 4K3CA 3EMNX 4FOZA 4AKMA 5IYUA 3SYBA 3BS0A 4GF4A 3LK41 2R4LA 4KR8A 2MNHA 2M07A 4XNKA 5G39A 5TISO 4AYID 4BUMX 2Y0HA 3K19A 4G75A 4Z3TA 5JDPA 1ZHXA 3HWBA 4RL9A 2R4OA 3NJTA 4C69X 4RJWA 4AUIA 4E1SA 4UB6O 4O3YA 4CTDA 4N74A 4XNLA 3V8UA 5B66O 3PQUA 1T16A 4O4UA 3T24A 4AFKA 2J4UP 2R4PA 3PQSA 5GTHO 1BH3A 2ODJA 2ZFGA 5G3AA 3UPGA 1GFMA 4O3WA 2KZ7A
chains in the Genus database with same CATH topology
4PR7A 2JQYA 2WJRA 2IWVA 4FQEA 2X9KA 2IWWA 4CTDA 2WJQA 2WVPA 2F1CX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PR7 A;  2JQY A;  2WJR A;  2IWV A;  4FQE A;  2X9K A;  2IWW A;  4CTD A;  2WJQ A;  2WVP A;  2F1C X; 
#chains in the Genus database with same CATH topology
 1ZHY A;  2QTK A;  2J1N A;  5G38 A;  4RJX A;  2IWW A;  4N59 A;  4FES A;  3AAA A;  3PGS A;  3A0H O;  4N75 A;  3G7G A;  1THQ A;  5DL8 A;  3VY8 X;  2O4V A;  3BRZ A;  2Y0L A;  4FT6 A;  4FRX A;  1PHO A;  1T1L A;  3AA7 B;  3RBH A;  5T5F A;  2OMF A;  3T0S A;  4O49 A;  2POR A;  4UB8 O;  3WU2 O;  3DZM A;  2K0L A;  1ZHW A;  2N2M A;  4O3X B;  4PR7 A;  5DL7 A;  2Y0K A;  7PRN A;  4FRT A;  4FMS A;  2AXT O;  2R88 A;  3KZI O;  3PGR A;  2Y7S A;  1QJ8 A;  5G26 A;  3C5O A;  2F1V A;  3AA7 A;  2KZ7 B;  5E79 O;  2WJQ A;  2XE3 A;  2GE4 A;  3SZV A;  4FZL A;  1P4T A;  3PRN A;  4AYM C;  4F4B A;  1QJP A;  3AAA B;  3VZU X;  3WI5 A;  4AYN A;  3SZD A;  2WVP A;  2F1T A;  2LHF A;  3DWN A;  3HW9 A;  4FUV A;  3LK2 A;  4O4X A;  3POX A;  2K4T A;  2Y2X A;  4QQ1 A;  1OSM A;  3JCU O;  5KAI O;  2X27 X;  3A0B O;  4N58 A;  4E1T A;  2XTQ A;  3GP6 A;  2YPV A;  2F1C X;  4C4V A;  3QRA A;  2WJR A;  4GCQ A;  3FYX A;  2FGR A;  5D5D A;  4FQE A;  4FZM A;  2XMX A;  1MM5 A;  3DA3 A;  4D5U A;  1GFQ A;  1S5L O;  4PUX A;  3LK4 2;  3QRC A;  1ZHZ A;  2MHL A;  3O0E A;  4RLC A;  2R8A A;  3PGU A;  2YNK A;  1QJ9 A;  3HOL A;  4LSI A;  3KVD D;  4U9C A;  5GV0 A;  1HXX A;  3DA4 A;  3POU A;  4AYD C;  2FGQ X;  2XE2 A;  2XTR A;  3AAE B;  3JTY A;  4KRA A;  3UU2 A;  4LSF A;  5ADX K;  5AFU K;  2XG6 A;  2KXP B;  2XE1 A;  3NSG A;  4C00 A;  5FVN A;  3LK2 B;  4AZL A;  1G90 A;  3SY9 A;  3AA1 B;  2PRN A;  3UAQ A;  1YS5 A;  2KDY A;  3VY9 X;  4D64 A;  1BT9 A;  3WI4 A;  3AAE A;  4C4V B;  3HOE A;  2LFU A;  2XE5 A;  2JQY A;  1BXW A;  1PRN A;  2KXP A;  3POR A;  4AKR A;  4GCP A;  2KC0 A;  4GHB A;  3TZG A;  2N2L A;  4G76 A;  1Q9G A;  4FZN A;  3AA1 A;  1ORM A;  4JFB A;  3VZT X;  4O3Z A;  4KR4 A;  3POQ A;  5AFU L;  5ADX L;  3A2S X;  3VZW X;  3PF1 A;  4FSP A;  2ZLD A;  1ZHT A;  2R4N A;  1IZN B;  2X9K A;  3AA0 A;  3AA6 A;  5DL6 A;  1GFN A;  2W81 C;  1MPF A;  1GFP A;  4GCS A;  2IWV A;  4PJ0 O;  5DL5 A;  4AYE C;  3T20 A;  4K3B A;  3BRY A;  5KAF O;  4LSE A;  4D65 A;  1GFO A;  4FSO A;  4JCH A;  5H2F O;  5PRN A;  1IZN A;  1MM4 A;  1OPF A;  2JMM A;  4RLB A;  3DWO X;  8PRN A;  4B61 A;  2R89 A;  4AKR B;  3LK3 B;  3VE1 A;  1Q9F A;  1H6S 1;  1HXT A;  4IL6 O;  3SY7 A;  3VE2 A;  6PRN A;  2ERV A;  5GTI O;  1E54 A;  3SYS A;  3AA6 B;  3AA0 B;  2W80 C;  1HXU A;  2M06 A;  3LK3 A;  5EE2 A;  5B5E O;  4LSH A;  4K3C A;  3EMN X;  4FOZ A;  4AKM A;  5IYU A;  3SYB A;  3BS0 A;  4GF4 A;  3LK4 1;  2R4L A;  4KR8 A;  2MNH A;  2M07 A;  4XNK A;  5G39 A;  5TIS O;  4AYI D;  4BUM X;  2Y0H A;  3K19 A;  4G75 A;  4Z3T A;  5JDP A;  1ZHX A;  3HWB A;  4RL9 A;  2R4O A;  3NJT A;  4C69 X;  4RJW A;  4AUI A;  4E1S A;  4UB6 O;  4O3Y A;  4CTD A;  4N74 A;  4XNL A;  3V8U A;  5B66 O;  3PQU A;  1T16 A;  4O4U A;  3T24 A;  4AFK A;  2J4U P;  2R4P A;  3PQS A;  5GTH O;  1BH3 A;  2ODJ A;  2ZFG A;  5G3A A;  3UPG A;  1GFM A;  4O3W A;  2KZ7 A; 
#chains in the Genus database with same CATH homology
 4PR7 A;  2JQY A;  2WJR A;  2IWV A;  4FQE A;  2X9K A;  2IWW A;  4CTD A;  2WJQ A;  2WVP A;  2F1C X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...