3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3LK3A 4AKRA 5AFUL 5ADXL 5ADXK 5AFUK 3LK42 3AA7B 2KXPA 3AAEA 1IZNB 3AAAA 2KZ7A 3AA7A 3LK2B 3AAAB 4AKRB 1IZNA 3AA1B 2KXPB 3AAEB 3AA0A 3AA0B 3AA1A 2KZ7B 3LK41 3LK3B 3AA6A 3LK2A 3AA6B
chains in the Genus database with same CATH superfamily
5LOVE 2VKJA 3AE6A 2KLQA 4FZMA 4U72A 4ILUA 4GKKT 2V7KA 3FZMB 2LM9A 4LF9T 3TKLB 4O4UA 3FB2A 3ABVA 4AQYT 4JI3T 5CB4E 4ZS3A 4ADZA 2LSKA 3EDUA 4I4TE 2XQ7A 3UQ7A 3PUZF 2UXXB 5GTHO 4IDQA 4PJJA 3ANWA 5LG4A 2AXDS 3PURA 2LSGA 3O1IA 5FVNA 4MLKA 1ZHTA 5LNKA 1KNZA 4DV7T 5FY0A 1OEDC 2KZ7A 3KFWX 3P4PA 4TV9E 2KNDA 4LMKA 3FZLB 5HXHA 4ZOLE 4CN1A 2NW8A 3C64A 2YDSA 2KINB 4KR4A 4U74A 2VL0A 4D5UA 4H9OC 2Z6EA 4QWNB 4YTNA 4WYVA 2ZMAA 3HR0A 1IZNB 1IAPA 1P4TA 2O4VA 4TZ4C 5FXVA 3V5UA 5AQFB 3UU2A 2V7LA 3VRBA 2DNXA 2V1DB 1IJ6A 3AA6A 4FJOA 3N9LA 1WLXA 2HPJA 1UCUA 1OXZA 1E54A 2BG9E 3K1SA 4DUZT 3RF1A 2VQFT 2E9XD 4WW0A 2VQET 5IWAT 4X64T 4O4IE 5CGMA 5FXZA 3AE9A 1ZHZA 3CQCB 3UFGA 3HWBA 2Y7SA 2XJ7A 4XAXB 2CCQA 2X27X 2QA7A 4WBNE 2DHRA 5G3AA 1VCSA 5ADXL 5LYJE 4O4HE 2XAHB 1HNXT 3T1YT 3TLVA 1BR1A 1XDOA 2CEAA 3UUXB 1WYCA 2WWUA 2YK0A 1Y01A 5HXEA 1WFDA 5AQUB 4LSIA 3RC8A 4CXYA 1WRDA 2HN1A 2XE1A 5LGTB 5J1GA 2BVLA 1OEDB 2BVMA 2W81C 4GF4A 1Q9FA 2BKPA 1THQA 1IBMT 4WNKA 5EK2A 4TWHA 3N9NA 3ZC0A 5LJNA 5B66O 1I94T 2WY2A 3IA3A 5FL0A 1HX8A 4C4VB 3KV6A 3PGRA 3JAFA 2IUBA 6PRNA 4LSHA 2F4VT 3PRNA 2XE3A 2IWVA 4YFSA 4RJXA 3UAQA 4UV8B 1KNPA 2CHNA 4K3BA 2ODJA 4AYMC 1XNQT 5EE2A 3VE2A 3AA7A 1BH3A 3KZIO 3KV9A 1IZNA 4G63A 1J5ET 2XSAA 4JUYA 2XE5A 2H89A 2LEHA 3Q9DA 4U33A 3EDVA 5C3JA 4O4XA 1OEDA 4B6XA 5AQTB 3ZYMA 4UR9A 1OSMA 4CXXA 3AE8A 2PBIA 2HHHT 2F1VA 1VOMA 3HW9A 8PRNA 2CMRA 5JRCA 5KAIO 2XAFB 1UX4A 1ZKEA 4HFBA 2N1GA 3TLWA 3RKOA 5F8PA 4O2BE 4FSOA 2OLTA 3CKDA 4DR3T 5FL1A 2XAGB 4NIQA 2LFUA 3FYXA 5JVDE 4AFKA 4EAHA 5HWYA 1FIOA 3VKGA 5AQKB 2X9YA 4EYYR 4HTEA 5EK3A 4Z90A 3AEEA 5HXRA 1T16A 3GP6A 2NWBA 2J1DG 1N32T 5HEJA 4FZNA 2H3RA 4DBQA 4DV3T 2LE8A 2VB6A 4UEMA 2ZLYA 1GQEA 4C69X 3ZSTA 4V1Av 3PU8A 1D0ZA 5BR8T 3RIUC 2W4XA 2WAUA 4EV6A 1ZOYA 3P8CD 2ERVA 2VVNA 3ONXA 2KZ7B 4DR6T 4A98A 3A5XA 2J4UP 3UU8A 3B5MA 3KINB 5AQIB 2A9UA 4U7YA 4UF0B 3AE1A 2R8AA 1GFMA 2WDQA 1MPFA 2MTQA 3HKCE 3NWIA 4U2ZA 3S4UA 1J1JA 3SZVA 4IE5A 4FSPA 5HXCA 3FXEB 4ZHQE 4ZI3C 3UU5A 1MIYA 3BQKA 1N33T 3HKBE 3IHRA 2YN6A 4U2YA 2WVPA 1U4QA 1SUMB 4N78D 3L09A 3DA3A 2X0HA 3LBXB 4PK6A 2H7OA 4JI8T 3GWHA 3SZDA 5AQOB 4P0BA 5JDQA 2N2NA 3AEAA 1QUUA 1SE7A 1MMNA 2K48A 4DNDA 4DBRA 2VURA 1JNZA 3RYCE 3LSVA 4X1YE 2ZM6T 2IC9A 5IHYA 2D0UA 2W61A 3G7GA 1D1AA 4AYNA 5IUXA 3JCFA 5JDMA 3Q5WA 4UIGA 3ZEFB 3QB5A 1CUNA 3UUNA 2WZIA 4HFIA 4O3YA 2V7MA 4TNVA 3Q2MA 4QHOA 4DO0A 3ZLIA 4LFCT 3B13A 4MFRA 4YSXA 3CIRA 3Q5EA 5LHIB 1N34T 2UUAT 4NXNT 3J7Yq 3SY7A 2V6XA 3KV4A 3PUQA 1G8XA 3EVYA 4BA9A 1HXUA 1G90A 3LBXA 2MOZA 1UGOA 2VK9A 3JAEA 2MNHA 3R84B 3ZC1A 5H2FO 4XNKA 4PR7A 1XMOT 1T98A 5J0ZA 4YJ3E 3A7MA 3P4SA 4DR5T 1XDPA 4NXMT 3UU4A 2HH7A 2XQ9A 2EHOC 1D1CA 2IHR1 5DL8A 2YDQA 2IIUA 2M07A 1BR2A 4EZ4A 2UUCT 3ZYKA 4NPPA 4KUMB 4EZHA 1ZHXA 2WM9A 3ETVA 1YQ4A 1MM4A 4TV8E 2K24A 2WWVA 4KP3C 1WR6A 4LMLA 2M67A 4YTPA 4B3MT 3SY9A 4MBQA 2WBLA 5IYUA 3UULA 4PJ0O 3ZN1B 2AXTO 1ZHCA 2NP9A 2OA5A 4IT4A 4H9PC 4QH1A 4FT6A 4QKNA 2JJ9A 5LHGB 3SOLA 2YINA 5L3EB 1ZV4X 2K0LA 2GE4A 2X68A 3ZN0B 3O1JA 5FYMA 4EGWA 2I6HA 2E9XB 2ES0A 3L3PA 2XY8B 2L3LA 3U3IA 1WCRA 2ZM2A 2WDRA 4KI0F 1FMWA 3RHWA 5JREA 2XG6A 2BBJA 2C5IT 4I55E 4FZLA 5JR9A 4EB6E 4EYUA 2JQQA 1QJ8A 3RIAA 4N75A 4IE0A 3K8PC 3K3QC 2X9HA 5GONE 4C91A 3KBTA 3UTKA 2K3WA 1MM5A 3QRAA 3AE4A 2XE2A 3SRZA 5LGNB 1D1BA 4GCSA 3QUJA 5KMGP 3C98B 1GFNA 3UPGA 4FRTA 5AQJB 1NEKA 4U7IA 5DQWA 2PRNA 4DV1T 3FBZA 3AAEA 4ILCA 2BDEA 3H3AA 3KV5A 3PUVF 1R8IA 2VASA 5GV0A 2LSJA 5L3DB 2C0SA 2ODVA 3RIFA 1KFYA 1H7CA 3AE5A 2VVSA 3A0HO 1YD8G 2WMOA 4IL6O 3CX7B 4PNIA 1IJ5A 1AJ3A 2XQ4A 2Y8DA 1OWAA 3LK3B 2UXDT 3CQXC 2XTRA 3X1DA 3RRCA 4YJ2E 4DV4T 2BBHA 1ORMA 4C90A 1NWMX 2NTXA 5J2TE 4O2AE 5EK4A 4E7ZA 5A1LA 3AE7A 3OJAA 5EZYE 3TLSA 3DA4A 4Q25A 4QX7B 4I43B 3WI5A 2Q9QA 2VKOA 4KRAA 4JI4T 2CA5A 2CLYC 2LSIA 3ZKRA 2CM0A 1CHUA 3N2GE 2VL8A 1I6ZA 1XZYA 3VZUX 3ZCJA 3VRAA 4PUXA 2V5CA 3RC3A 3T8OA 2D5UA 2V7JA 4YT0A 3POUA 4DMVA 1OEDE 3N5LA 3SFEA 4XBFB 2N2LA 4RJWA 5HCMA 5TISO 3HKEE 3RRWA 5DL5A 4GK0E 3QRCA 2X9WA 1HXTA 2M6IA 2YEVC 3PV0F 1T1LA 3TZGA 5PRNA 5HEHA 2BKOA 3RQUA 4BUMX 3DWOX 3O4XE 1QSDA 5DABA 4O3ZA 2Y0LA 2WSSV 1PHOA 2UXCT 2ZM0A 2R4NA 3CX6B 3RIUA 1L0VA 1US7B 5DL6A 2AE9A 5LB7B 2J4GA 2IMLA 4AYEC 3IEEA 1KEYA 2IC6A 4JI0T 4B61A 3FZKB 2BG9C 4GIWA 3JADA 3VR8A 3LK41 3M65A 4ILAA 4OFZA 2F1CX 4UVCB 2Q9QD 5FVKA 2KC0A 3NRXA 2DCFA 2QRXA 3BK9A 3RGLA 3NJTA 4Z3TA 1MMAA 2DWKA 2CXDA 3VZTX 5B5EO 1WR0A 4TWFA 5C8YE 4AIUA 5LGUB 3AA7B 4C4VA 3I0OA 4OK0A 4GHBA 4E1TA 2NOXA 4HEAA 4ZI7E 5G26A 2FJEA 5JDGA 3VU7H 2WP9A 3AE2A 2X66A 4YSZA 4LFBT 2YDRA 1HS7A 2DLRA 2BS3A 4IREA 2SPCA 1HFAA 2N2MA 4N59A 5LHHB 3AAAA 4TUYE 4PFOA 2VKDA 4HWDA 5AQNB 4PK5A 5IYZE 4UB6O 3VZWX 2MYSA 2DL1A 1KK7A 2L9QA 3NRYA 3MJXA 3ZT5A 2KWHA 4D65A 4AI6A 4O8SA 3LK42 3VR9A 3AEGA 3V8UA 2Q9QB 2A72A 1GFQA 3E0ZA 2VWAA 4AZLA 2YOEA 2XHEB 5FKYA 2WU5A 4Z91A 1B7TA 3JC6D 2WCAA 3PJAJ 5KAFO 3V5SA 3PGSA 3O1HA 5AQSB 3T24A 2V26A 1IBLT 4OYKA 4E1SA 2DWGA 4A56A 3QOFA 5FNVE 4TNWA 3AA6B 3RYIE 2M06A 3I9WA 5KDMC 2V8SV 4XZCA 2KWIB 3P4RA 4A97A 2NW9A 4IE6A 2Y0HA 1BR4A 4G75A 4LSFA 2FUPA 4CI2B 4PJLA 2LHRA 4P1NA 2KMFA 3I1AA 2RP4A 3N9MA 3C4WA 4KHPT 2V7IA 1N36T 4CZZB 2D2SA 4PJMA 3O0EA 3IBPA 4FQEA 3C4XA 4IGUA 3GA8A 1HCIA 2LT3A 1D0YA 3M3ZB 3AE3A 4KX6A 2RA1A 3GN5A 1GFOA 2WJRA 4B3ST 2QYWA 3ETUA 4HFDA 5JR9B 4PK4A 1ZHYA 4HE8A 2XMXA 1X79A 4DMWA 2FBWA 5KXJA 2JMKA 2LLYA 2JMHA 2XQAA 5LG3A 2CLYB 2ZLDA 3I0QA 4D64A 3C51A 2EHOA 4BJNA 2JQ9A 3TLTA 3VKHA 2XZEA 5CFBA 3PGUA 5GTIO 3VE1A 2N9DA 3C50A 2RPAA 1HNWT 5L3GB 1V9DA 1Z8UA 4ERRA 4X62T 3TLUA 2C5KT 1W9RA 4WBOA 3CVRA 4L5GA 3ZMZB 1Q9GA 1MNDA 1ZHWA 5ABGA 3D0TA 4EOZB 5FY7A 1QLBA 2UUBT 4J2CA 2KDYA 2WZHA 3IF8B 4AKRB 4JCHA 1BT9A 3ONJA 1HG2A 2QGSA 1T72A 5AQMB 2JQHA 4CQIA 3LK3A 4DV5T 3EMNX 4B3RT 1HTJF 4O4LE 3B57A 3VHLA 2R6GF 2X0LB 2W63A 5L2LA 4YHJA 4U3CA 3POXA 1HNZT 3UUMA 3SYSA 2IAKA 3EI0A 3OBVE 2CBIA 4RLCA 1PRNA 2BG9B 4CI1B 5ADXK 3PUYF 4IE4A 5E79O 5FVLA 4N74A 5CJ5A 4ZZCA 1HR0T 5LP6E 4BJMA 4LFAT 4CN4A 3ZCIA 3FHNA 3KVBA 3K3NA 1MMDA 1SA0E 3HOEA 3P7IA 4DVDA 2Y2XA 1J5WA 3EHZA 1FMVA 5ABHA 4ZS2A 2OMFA 5FY1A 5FXXA 5D5DA 4RL9A 2JIWA 2LHNA 2H88A 5JDPA 3JCUO 1T8BA 5LMNT 4ZEYA 4QXCB 4K0KT 2XQ5A 1UK5A 3FZHB 1FEWA 2PJQA 2BG9A 2K9AA 3E08A 2EHOD 1BXWA 5HAXA 4B3TT 1NENA 4JEUB 3VY9X 3E22E 4TX5A 2B76A 4QXBB 3T20A 2XSBA 2XTQA 1S94A 3PUAA 3PDYA 4F8HA 3UU3A 4HFCA 2K4TA 2BS2A 2LRKA 3OPCA 4U9CA 2E5LT 4AUIA 2FGRA 3PJAA 3W15B 2XM1A 4WZXA 5AQHB 2PG8A 4LF8T 3HOLA 5ABFA 3L8RA 3R6NA 3CPZA 2YPVA 2B1EA 3Q5DA 2WJQA 4FMSA 3OYZA 3U78A 4I0UA 2E2AA 5LBQB 3BQLA 3RYHE 5ABEA 2V6YB 4JBWF 5LA6E 4L9IA 3DZMA 4JI2T 3RYFE 4AYID 3AB3B 1KNRA 3J9X1 2LHFA 1XMQT 4UVBB 1LVKA 3DTOA 3BRYA 4HWFA 5L4HA 3JTYA 2E9XC 1MIVA 4YHHT 4IDZA 5HXSA 2EHOB 4DUYT 2ODUA 3T1HT 2CWOA 4HFVA 2X0YA 3AA0B 1D0XA 4H9SE 3BS0A 4OYJA 4CI3B 4H9QC 4RLBA 5JDNA 2UXBT 5FXWA 3OVUA 3ZSSA 4ZZBA 3PQSA 2QTKA 5JRCB 2R88A 5HCJA 3T0SA 2G0UA 3HI2A 4IDPA 3O9XA 2ACXA 3CX8B 4DR4T 5AFUK 2W0GA 2W2UA 3NVOA 4H9NC 4FESA 5C2TA 2FJAA 3PTRB 4H9RC 1HXXA 3AAAB 2I0MA 2Y6XA 3AA1B 5JDLA 1LVFA 3MK7C 2WU2A 5G39A 3ZJ2A 3RPUA 5LCYA 3PUWF 4FI5A 4HWCA 3ZMVB 4PFPA 2C5JA 4JI5T 3WAKA 2E5VA 3A2SX 4H63V 2E8IA 3AECA 4ZI3D 3A0BO 5FMNA 2QVAA 5JR9C 2XQ8A 5DL7A 3AXJB 4IHJE 1LKXA 3P4WA 4GKJT 4YXDA 2WQYA 4GCPA 1M7KA 4AKGA 4JI6T 3FZFB 3BRZA 4A5XA 5LJMA 4KBMB 4GK5E 3L39A 4LF6T 4HGAA 4CN6A 5F5WA 1QJPA 3KDSE 3ZPOA 2W62A 1JNRA 3SYBA 3ZMSB 3AA1A 1KF6A 2LSYA 2UU9T 4GOUA 5JDFA 4NUUA 1E7PA 2A3DA 3PQUA 2CBJA 4ZXLA 4BAYB 4F4BA 2NW7A 3SFDA 4HN9A 2IDOB 3N9OA 3F57A 1LRZA 2WB5A 5JQGE 5L3BB 1W09A 4KR8A 4JEHB 5HEUA 1QJ9A 2KXPA 1ZEEA 5J2UE 3VY8X 5AQGB 2XQ6A 5JDHA 2D9DA 5AQLB 4I50E 4KHZF 4DIDB 1UX5A 4QXHB 4OX9T 4AYDC 4G76A 4XNLA 2KXPB 3AA0A 3F2EA 3ZMUB 3P50A 3WAJA 3C4ZA 2NTYA 4COFA 3CWZB 3QC9A 2W00A 2F1TA 3K3OA 2XM2A 5TAOA 2LOPA 2J47A 2YNKA 1FJGT 3PORA 3ZT7A 3N2KE 3PUXF 3CMLA 3OYXA 1S35A 3OKQA 1HF8A 2J1NA 5AFUL 2V6YA 5HYAA 1X9BA 1EZ3A 3BQIA 3NZQA 2A2FX 5L4EA 1M62A 4O3WA 5M4YA 4HFHA 5DQVA 2ZFGA 2PORA 5T5FA 4IIJE 4F6RC 4EEDA 2JQYA 4JV5T 4GYRA 4AKMA 3RQWA 1O3XA 5AQPB 2XAJB 3ANWB 2MPKA 2Y48B 3AEBA 3AXJA 4P09A 3QB5K 1H6S1 3MZKB 1T7SA 2XQYA 1XWMA 4AQFC 3FXDB 4KMCA 3AEFA 2DI4A 3HL6A 3LJCA 3N9QA 4UVAB 2CHOA 4IDOA 1MMGA 3UFEA 4QX8B 4X5TA 3Q5XA 3LDQB 2X9XA 4UV9B 1MNEA 4EEBA 3AAIA 3N2OA 5CA0E 4YTMA 3AAEB 2JMMA 3WI4A 4UB8O 2CXLA 2K5BB 3FBLA 5KX5E 3DP7A 4X65T 5L3CB 5JTGA 1NAFA 1VRBA 4NUVA 1VCTA 4HWIB 2BZBA 4QH4A 3QK6A 2VKHA 3RKGA 3P4QA 2XQ3A 2J62A 2LOSA 5HEOA 3CK6A 2NR4A 2XPKA 2R4OA 1HX1B 5L3FB 4HFEA 4JI7T 4YSYA 2FJBA 2LM2A 4FUVA 4UXNB 3EAMA 2W80C 4FOZA 5HEGA 4MHCA 4ISTA 4E7SA 4GYSA 4QH5A 3ZYLA 3AEDA 1E1HB 2JRKA 4DR2T 4YY3T 3EUHA 4YLHA 2XASB 3NZPA 3MXZA 4AKHA 4CXWA 3UUBA 4CTDA 2LKHA 1YKEB 2WDVA 3RH3A 4O49A 5FP3A 4X66T 1MIWA 3NSGA 2YU1A 2MBGA 4N58A 4C00A 5LXTE 5AQQB 4X20E 4ISSA 1BR0A 2V5DA 5AQRB 3CQGB 2P9BA 2W66A 3GMIA 2MAWA 4H63H 2LKGA 4TWDA 3MA9A 4ANJA 2LJLA 5JH7E 2XTLA 4DV6T 2X9KA 1SHZC 4TN7B 2FJDA 1OPFA 1E2AA 3LK2A 4AQGA 2W67A 5ABFB 2HN2A 4AXPA 3SS1A 3I9YA 3UQ4A 3NKZA 2X51A 1GFPA 2HPLA 4LSEA 1Z0PA 2R4PA 2E9XA 4IDNA 2XUEA 4HKAA 4OHFA 2BKNA 4JFBA 3MKDA 2JQKA 3KVAA 4LF5T 3MACA 3HKDE 1Y64B 2YKSA 4X1KE 2FGQX 4X1IE 5DJQC 2H7VC 3HA4A 3LG7A 2CRBA 4LF4T 3LFMA 5H6QB 5AQVB 3C5OA 3F31A 3GN5B 3LK2B 3DWNA 2L8KA 3A8YC 4PJNA 4ZI2C 2M6BA 4PW8A 4EXTA 3RX6A 2ACZA 2CPTA 2WMNA 4G2AA 4K3CA 3PE0A 4IL4A 2R4LA 4IE7A 3PU3A 2CXFA 4L0RA 1WYBA 3PUSA 1UURA 3RLFF 2ZM8A 3WU2O 4DR7T 3H3MA 3ONLC 1W0BA 4AISA 5LBMA 3KBUA 4O3XB 4DV2T 4DV0T 4ASKA 5G38A 1XNRT 5L47A 3OTOT 4GCQA 3SWHA 5CA1E 2JPFA 4Z8XA 4FRXA 1W0AA 1UUSA 3K19A 4EIWA 5F3JA 2GK9A 4JLEA 2CE7A 4JI1T 4LF7T 3H37A 4UELA 3PUGA 1U5PA 1S5LO 1YKHB 3KVDD 5E0OA 3PF1A 3POQA 3ZMTB 2OV9A 1G73A 5BMVE 4MALA 5ETWA 3UT5E 4HWHA 4O4JE 1ZP0A 2XAQB 1YW0A 5LMUT 2IWWA 4IL9A 2Q9QC 4LMJA 4UF0A 4AQFA 5H6RB 3WI3A 2X67A 2LRLA 4QQ1A 1HG5A 2I59A 7PRNA 4DR1T 4AKRA 3ZT6A 4P0AA 2YU2A 2CWYA 3UU6A 2KT9A 3AVSA 3ZJ1A 2R89A 3G06A 5HWXA 4ZI2D 3N9PA 4K0UA 4AKLA 2WS3A 2KSRA 2PTFA 2IW5B 4ILBA 1YS5A 2PFVA 3AVRA 2MHLA 3QNUA 2D0TA 4U31A 2Y0KA 1YQ3A 4AKIA 2BS4A 3RBHA 1IBKT 1YXRA 4M1PA 3JC6C 3RI5A 3ESLA 2UXNB 4JYAT 3DJBA 4PAGA 3NBXX 3EABA 1DU2A
chains in the Genus database with same CATH topology
2RP4A 5LOVE 2VKJA 2M07A 2KLQA 1BR2A 4FZMA 4EZ4A 3ZYKA 3N9MA 3C4WA 4KUMB 4U72A 2V7IA 4ILUA 4EZHA 2KXPA 2V7KA 1ZEEA 2LM9A 5J2UE 1ZHXA 2WM9A 3TKLB 3ETVA 2D2SA 4PJMA 4CZZB 5JDHA 1MM4A 3FB2A 3IBPA 3O0EA 4I50E 4TV8E 3C4XA 2K24A 1UX5A 4QXHB 4IGUA 4KP3C 4AYDC 5CB4E 3GA8A 1WR6A 1HCIA 4ZS3A 4ADZA 4G76A 4XNLA 2KXPB 3AA0A 2LSKA 2LT3A 3F2EA 3ZMUB 3EDUA 1D0YA 4I4TE 2M67A 3WAJA 2UXXB 2RA1A 3C4ZA 3GN5A 1GFOA 3SY9A 2NTYA 4PJJA 3ANWA 4MBQA 5LG4A 3CWZB 3ETUA 2WBLA 3PURA 3QC9A 2W00A 5IYUA 2LSGA 3UULA 5JR9B 2F1TA 3K3OA 3O1IA 4PK4A 5FVNA 1ZHYA 4MLKA 5TAOA 2LOPA 4HE8A 1X79A 3ZN1B 4DMWA 1ZHTA 5LNKA 2XMXA 2JMKA 1KNZA 1ZHCA 5FY0A 2NP9A 3KFWX 2KZ7A 2JMHA 4TV9E 2OA5A 2YNKA 2KNDA 2CLYB 4H9PC 2ZLDA 3I0QA 4FT6A 3PORA 5HXHA 4D64A 4ZOLE 4QKNA 2JJ9A 3N2KE 3C51A 3CMLA 5LHGB 2NW8A 2EHOA 3SOLA 3C64A 3OYXA 1S35A 4BJNA 2YINA 2KINB 4KR4A 5L3EB 3OKQA 4U74A 3VKHA 1HF8A 2J1NA 1ZV4X 5AFUL 2K0LA 2GE4A 4D5UA 5HYAA 4H9OC 2Z6EA 4QWNB 1EZ3A 2X68A 3BQIA 2A2FX 2ZMAA 3HR0A 3NZQA 1IZNB 3ZN0B 1IAPA 1P4TA 3O1JA 2O4VA 3VE1A 5FYMA 2N9DA 3C50A 4TZ4C 4O3WA 5FXVA 3V5UA 5M4YA 5DQVA 2E9XB 2V7LA 2ZFGA 2ES0A 1V9DA 4ERRA 5L3GB 3UU2A 2DNXA 2V1DB 2PORA 3L3PA 5T5FA 2L3LA 2C5KT 4WBOA 3U3IA 4IIJE 1IJ6A 3CVRA 4F6RC 3AA6A 4FJOA 2ZM2A 4L5GA 3N9LA 1FMWA 5JREA 4GYRA 2XG6A 4AKMA 1WLXA 2HPJA 3ZMZB 1Q9GA 1O3XA 2C5IT 1UCUA 4I55E 1OXZA 4FZLA 1E54A 5JR9A 1MNDA 4EB6E 4EYUA 2XAJB 3ANWB 2JQQA 1ZHWA 1QJ8A 4IE0A 3D0TA 2Y48B 3K8PC 4P09A 4EOZB 5FY7A 3K3QC 2E9XD 2X9HA 4WW0A 5GONE 3KBTA 4C91A 3UTKA 1MM5A 1H6S1 3QRAA 4J2CA 2KDYA 3MZKB 4O4IE 3IF8B 4AKRB 4JCHA 5FXZA 1BT9A 1ZHZA 2XQYA 3CQCB 1HG2A 4AQFC 3SRZA 2QGSA 2XE2A 2Y7SA 3HWBA 5LGNB 3FXDB 4XAXB 1D1BA 4GCSA 2CCQA 3QUJA 5KMGP 3C98B 4KMCA 4CQIA 2DI4A 3HL6A 3LK3A 1GFNA 2X27X 4FRTA 3EMNX 2QA7A 3LJCA 3N9QA 4WBNE 3UPGA 5DQWA 2DHRA 2PRNA 5LYJE 4UVAB 3FBZA 1HTJF 5ADXL 4O4HE 2XAHB 4O4LE 1MMGA 3UFEA 3AAEA 1BR1A 2BDEA 3B57A 2CEAA 3H3AA 3KV5A 4QX8B 3UUXB 3VHLA 1WYCA 2X0LB 3Q5XA 2X9XA 2WWUA 4UV9B 1MNEA 2YK0A 2W63A 5HXEA 5L2LA 4YHJA 2VASA 3AAIA 3N2OA 2LSJA 5GV0A 5CA0E 3POXA 3AAEB 5L3DB 4LSIA 3RC8A 2JMMA 2C0SA 4CXYA 1WRDA 2ODVA 3WI4A 3UUMA 2CXLA 2K5BB 3FBLA 5LGTB 2XE1A 3SYSA 5J1GA 5KX5E 2BVLA 2IAKA 3DP7A 3OBVE 1H7CA 2BVMA 4RLCA 5L3CB 1PRNA 4CI1B 5ADXK 1YD8G 2W81C 4IE4A 2WMOA 1NAFA 1VRBA 4GF4A 4NUVA 1Q9FA 3CX7B 4PNIA 1THQA 4WNKA 3VY8X 5EK2A 5LP6E 3N9NA 1IJ5A 3ZC0A 2BZBA 5LJNA 1AJ3A 3QK6A 2VKHA 4BJMA 3ZCIA 1HX8A 2Y8DA 3FHNA 3K3NA 3KVBA 3NBXX 1MMDA 2LOSA 1OWAA 3KV6A 3LK3B 1SA0E 3HOEA 3P7IA 3CQXC 6PRNA 4LSHA 2XTRA 3RRCA 4YJ2E 3PRNA 4DVDA 2Y2XA 5L3FB 1FMVA 2XE3A 1ORMA 4YFSA 4FUVA 4RJXA 3UAQA 4UXNB 4ZS2A 2OMFA 4UV8B 5FY1A 5FXXA 4C90A 1NWMX 5D5DA 2NTXA 2W80C 4RL9A 4FOZA 2ODJA 4MHCA 5J2TE 4AYMC 4O2AE 5EK4A 4E7ZA 4ISTA 2LHNA 5EE2A 4E7SA 4GYSA 5A1LA 3VE2A 3OJAA 5EZYE 3AA7A 5JDPA 1BH3A 3DA4A 3KV9A 4QX7B 4I43B 1IZNA 4G63A 4QXCB 3ZYLA 1E1HB 3WI5A 2JRKA 2Q9QA 2VKOA 4JUYA 4KRAA 2XE5A 1FEWA 2PJQA 2LEHA 3EUHA 3Q9DA 3EDVA 2CA5A 2CLYC 4YLHA 2XASB 2LSIA 3NZPA 2K9AA 3E08A 3MXZA 4AKHA 2EHOD 2CM0A 4O4XA 4B6XA 4CXWA 1BXWA 3N2GE 5HAXA 2VL8A 3VZUX 3ZYMA 3ZCJA 4JEUB 3VY9X 1OSMA 4PUXA 3E22E 1YKEB 4TX5A 3RH3A 4O49A 4CXXA 4QXBB 5FP3A 3RC3A 3T8OA 2D5UA 2V7JA 2PBIA 3T20A 2XTQA 2F1VA 1S94A 3POUA 1VOMA 3PUAA 4DMVA 1MIWA 3NSGA 3PDYA 2YU1A 2MBGA 3HW9A 4N58A 3N5LA 5LXTE 2CMRA 4XBFB 2N2LA 8PRNA 4RJWA 5JRCA 2XAFB 4X20E 4ISSA 1UX4A 1BR0A 2K4TA 1ZKEA 3HKEE 3RRWA 5DL5A 2N1GA 4GK0E 3CQGB 2P9BA 4U9CA 3RKOA 3QRCA 2X9WA 3GMIA 4AUIA 5F8PA 2FGRA 4H63H 4O2BE 1HXTA 4FSOA 3CKDA 3W15B 2YEVC 2XAGB 3TZGA 2LFUA 5PRNA 3MA9A 4ANJA 2PG8A 3HOLA 2LJLA 5JH7E 3FYXA 5JVDE 3R6NA 4BUMX 2XTLA 1SHZC 4TN7B 1OPFA 3O4XE 1QSDA 3CPZA 5DABA 2YPVA 3LK2A 2B1EA 4EAHA 5HWYA 4O3ZA 4AFKA 2Y0LA 2WSSV 1PHOA 4AQGA 1FIOA 4FMSA 3VKGA 2ZM0A 3CX6B 3OYZA 3U78A 1US7B 5DL6A 5LBQB 3BQLA 2X9YA 3RYHE 4EYYR 4AXPA 3SS1A 3I9YA 4AYEC 2X51A 5LA6E 3IEEA 2IC6A 4L9IA 1GFPA 2HPLA 4HTEA 5EK3A 4LSEA 4B61A 1Z0PA 3RYFE 4AYID 3AB3B 2E9XA 4GIWA 5HXRA 3GP6A 3J9X1 2NWBA 2J1DG 2XUEA 2LHFA 4HKAA 4OHFA 4FZNA 2H3RA 4DBQA 3LK41 4JFBA 4UVBB 1LVKA 3MKDA 3M65A 3DTOA 2LE8A 2VB6A 4UEMA 3JTYA 2E9XC 3KVAA 4OFZA 2ZLYA 1MIVA 4IDZA 3MACA 4UVCB 2Q9QD 3HKDE 4C69X 1Y64B 5HXSA 2KC0A 3NRXA 4X1KE 2FGQX 4X1IE 2DCFA 2EHOB 5DJQC 2H7VC 3HA4A 3LG7A 3LFMA 1D0ZA 3BK9A 3PU8A 4V1Av 5H6QB 3C5OA 3F31A 4Z3TA 3GN5B 2ODUA 2WAUA 3LK2B 1MMAA 2CWOA 4HFVA 2L8KA 3P8CD 2ERVA 2DWKA 3AA0B 2CXDA 1D0XA 3ONXA 2KZ7B 4H9SE 3VZTX 4OYJA 4CI3B 4PJNA 3A5XA 5C8YE 4H9QC 4ZI2C 4RLBA 2J4UP 4PW8A 5JDNA 3KINB 4EXTA 5LGUB 3RX6A 4UF0B 5FXWA 1QJ9A 3AA7B 2WMNA 4G2AA 3I0OA 3PE0A 4OK0A 1GFMA 4GHBA 1MPFA 3PQSA 4IE7A 4E1TA 3PU3A 2NOXA 2CXFA 2MTQA 3HKCE 4L0RA 5JRCB 2QTKA 4HEAA 1WYBA 3PUSA 3S4UA 3T0SA 2ZM8A 2G0UA 3SZVA 3HI2A 4IE5A 4FSPA 4ZI7E 5LBMA 5HXCA 3KBUA 4O3XB 3FXEB 4ZHQE 5JDGA 5G26A 3VU7H 4ZI3C 1MIYA 4ASKA 3O9XA 3BQKA 2ACXA 2X66A 3HKBE 3CX8B 3IHRA 4O4UA 4GCQA 1HS7A 2DLRA 3SWHA 1U4QA 5AFUK 2SPCA 2W0GA 5CA1E 1HFAA 2JPFA 2N2MA 4N59A 4H9NC 4Z8XA 4N78D 5LHHB 3AAAA 3L09A 4TUYE 3DA3A 3LBXB 4PFOA 4FESA 4PK6A 2H7OA 4FRXA 2VKDA 3PTRB 4H9RC 3GWHA 3AAAB 4PK5A 4P0BA 5IYZE 1HXXA 3SZDA 5JDQA 2Y6XA 2N2NA 3AA1B 3K19A 2MYSA 3VZWX 5JDLA 1QUUA 1LVFA 1MMNA 2K48A 4EIWA 5F3JA 3MK7C 4DNDA 2GK9A 4JLEA 1KK7A 2CE7A 2L9QA 3NRYA 4DBRA 3H37A 4UELA 3MJXA 3RYCE 3ZJ2A 3PUGA 3RPUA 5LCYA 4X1YE 1U5PA 1YKHB 3KVDD 2KWHA 2IC9A 5IHYA 5E0OA 4FI5A 3ZMVB 3POQA 4D65A 2D0UA 4PFPA 2C5JA 2W61A 3ZMTB 4AI6A 4O8SA 3LK42 3WAKA 1G73A 3G7GA 5BMVE 4MALA 1D1AA 4AYNA 3A2SX 2Q9QB 4H63V 2A72A 3V8UA 5ETWA 2E8IA 3E0ZA 3UT5E 1GFQA 2VWAA 5JDMA 3Q5WA 4O4JE 4ZI3D 4UIGA 4AZLA 3ZEFB 2XAQB 5FMNA 1YW0A 5JR9C 2XHEB 1CUNA 3UUNA 5DL7A 2Q9QC 4IHJE 1LKXA 4UF0A 4AQFA 1B7TA 3JC6D 5H6RB 4GCPA 4O3YA 3WI3A 2X67A 4AKGA 4QQ1A 1HG5A 2V7MA 2I59A 3V5SA 7PRNA 5LJMA 4KBMB 4AKRA 4GK5E 3Q2MA 4QHOA 4DO0A 3ZLIA 4HGAA 4P0AA 3B13A 4MFRA 3O1HA 2YU2A 1QJPA 2CWYA 3T24A 3KDSE 2KT9A 2V26A 3AVSA 3ZJ1A 3ZPOA 2W62A 4OYKA 5LHIB 3SYBA 5HWXA 4E1SA 2DWGA 3ZMSB 4ZI2D 3J7Yq 4A56A 3N9PA 4K0UA 3SY7A 5FNVE 3AA1A 2LSYA 3KV4A 3PUQA 4GOUA 1G8XA 3EVYA 5JDFA 4AKLA 4BA9A 1HXUA 3AA6B 4NUUA 2A3DA 1G90A 3RYIE 2M06A 3PQUA 3LBXA 3I9WA 2MOZA 2VK9A 5KDMC 2IW5B 2MNHA 4BAYB 3R84B 2PFVA 3AVRA 4XZCA 1YS5A 3ZC1A 2MHLA 4F4BA 2KWIB 2NW7A 4XNKA 4HN9A 2D0TA 2NW9A 1T98A 3N9OA 2Y0KA 4AKIA 3F57A 4YJ3E 3RBHA 4IE6A 1LRZA 4M1PA 1BR4A 3JC6C 2Y0HA 5JQGE 3ESLA 2UXNB 2HH7A 5L3BB 4G75A 4LSFA 4CI2B 2EHOC 4JEHB 4KR8A 1D1CA 4PJLA 2LHRA 5DL8A 3DJBA 4PAGA 2KMFA 3I1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 A;  4AKR A;  5AFU L;  5ADX L;  5ADX K;  5AFU K;  3LK4 2;  3AA7 B;  2KXP A;  3AAE A;  1IZN B;  3AAA A;  2KZ7 A;  3AA7 A;  3LK2 B;  3AAA B;  4AKR B;  1IZN A;  3AA1 B;  2KXP B;  3AAE B;  3AA0 A;  3AA0 B;  3AA1 A;  2KZ7 B;  3LK4 1;  3LK3 B;  3AA6 A;  3LK2 A;  3AA6 B; 
#chains in the Genus database with same CATH topology
 5LOV E;  2VKJ A;  3AE6 A;  2KLQ A;  4FZM A;  4U72 A;  4ILU A;  4GKK T;  2V7K A;  3FZM B;  2LM9 A;  4LF9 T;  3TKL B;  4O4U A;  3FB2 A;  3ABV A;  4AQY T;  4JI3 T;  5CB4 E;  4ZS3 A;  4ADZ A;  2LSK A;  3EDU A;  4I4T E;  2XQ7 A;  3UQ7 A;  3PUZ F;  2UXX B;  5GTH O;  4IDQ A;  4PJJ A;  3ANW A;  5LG4 A;  2AXD S;  3PUR A;  2LSG A;  3O1I A;  5FVN A;  4MLK A;  1ZHT A;  5LNK A;  1KNZ A;  4DV7 T;  5FY0 A;  1OED C;  2KZ7 A;  3KFW X;  3P4P A;  4TV9 E;  2KND A;  4LMK A;  3FZL B;  5HXH A;  4ZOL E;  4CN1 A;  2NW8 A;  3C64 A;  2YDS A;  2KIN B;  4KR4 A;  4U74 A;  2VL0 A;  4D5U A;  4H9O C;  2Z6E A;  4QWN B;  4YTN A;  4WYV A;  2ZMA A;  3HR0 A;  1IZN B;  1IAP A;  1P4T A;  2O4V A;  4TZ4 C;  5FXV A;  3V5U A;  5AQF B;  3UU2 A;  2V7L A;  3VRB A;  2DNX A;  2V1D B;  1IJ6 A;  3AA6 A;  4FJO A;  3N9L A;  1WLX A;  2HPJ A;  1UCU A;  1OXZ A;  1E54 A;  2BG9 E;  3K1S A;  4DUZ T;  3RF1 A;  2VQF T;  2E9X D;  4WW0 A;  2VQE T;  5IWA T;  4X64 T;  4O4I E;  5CGM A;  5FXZ A;  3AE9 A;  1ZHZ A;  3CQC B;  3UFG A;  3HWB A;  2Y7S A;  2XJ7 A;  4XAX B;  2CCQ A;  2X27 X;  2QA7 A;  4WBN E;  2DHR A;  5G3A A;  1VCS A;  5ADX L;  5LYJ E;  4O4H E;  2XAH B;  1HNX T;  3T1Y T;  3TLV A;  1BR1 A;  1XDO A;  2CEA A;  3UUX B;  1WYC A;  2WWU A;  2YK0 A;  1Y01 A;  5HXE A;  1WFD A;  5AQU B;  4LSI A;  3RC8 A;  4CXY A;  1WRD A;  2HN1 A;  2XE1 A;  5LGT B;  5J1G A;  2BVL A;  1OED B;  2BVM A;  2W81 C;  4GF4 A;  1Q9F A;  2BKP A;  1THQ A;  1IBM T;  4WNK A;  5EK2 A;  4TWH A;  3N9N A;  3ZC0 A;  5LJN A;  5B66 O;  1I94 T;  2WY2 A;  3IA3 A;  5FL0 A;  1HX8 A;  4C4V B;  3KV6 A;  3PGR A;  3JAF A;  2IUB A;  6PRN A;  4LSH A;  2F4V T;  3PRN A;  2XE3 A;  2IWV A;  4YFS A;  4RJX A;  3UAQ A;  4UV8 B;  1KNP A;  2CHN A;  4K3B A;  2ODJ A;  4AYM C;  1XNQ T;  5EE2 A;  3VE2 A;  3AA7 A;  1BH3 A;  3KZI O;  3KV9 A;  1IZN A;  4G63 A;  1J5E T;  2XSA A;  4JUY A;  2XE5 A;  2H89 A;  2LEH A;  3Q9D A;  4U33 A;  3EDV A;  5C3J A;  4O4X A;  1OED A;  4B6X A;  5AQT B;  3ZYM A;  4UR9 A;  1OSM A;  4CXX A;  3AE8 A;  2PBI A;  2HHH T;  2F1V A;  1VOM A;  3HW9 A;  8PRN A;  2CMR A;  5JRC A;  5KAI O;  2XAF B;  1UX4 A;  1ZKE A;  4HFB A;  2N1G A;  3TLW A;  3RKO A;  5F8P A;  4O2B E;  4FSO A;  2OLT A;  3CKD A;  4DR3 T;  5FL1 A;  2XAG B;  4NIQ A;  2LFU A;  3FYX A;  5JVD E;  4AFK A;  4EAH A;  5HWY A;  1FIO A;  3VKG A;  5AQK B;  2X9Y A;  4EYY R;  4HTE A;  5EK3 A;  4Z90 A;  3AEE A;  5HXR A;  1T16 A;  3GP6 A;  2NWB A;  2J1D G;  1N32 T;  5HEJ A;  4FZN A;  2H3R A;  4DBQ A;  4DV3 T;  2LE8 A;  2VB6 A;  4UEM A;  2ZLY A;  1GQE A;  4C69 X;  3ZST A;  4V1A v;  3PU8 A;  1D0Z A;  5BR8 T;  3RIU C;  2W4X A;  2WAU A;  4EV6 A;  1ZOY A;  3P8C D;  2ERV A;  2VVN A;  3ONX A;  2KZ7 B;  4DR6 T;  4A98 A;  3A5X A;  2J4U P;  3UU8 A;  3B5M A;  3KIN B;  5AQI B;  2A9U A;  4U7Y A;  4UF0 B;  3AE1 A;  2R8A A;  1GFM A;  2WDQ A;  1MPF A;  2MTQ A;  3HKC E;  3NWI A;  4U2Z A;  3S4U A;  1J1J A;  3SZV A;  4IE5 A;  4FSP A;  5HXC A;  3FXE B;  4ZHQ E;  4ZI3 C;  3UU5 A;  1MIY A;  3BQK A;  1N33 T;  3HKB E;  3IHR A;  2YN6 A;  4U2Y A;  2WVP A;  1U4Q A;  1SUM B;  4N78 D;  3L09 A;  3DA3 A;  2X0H A;  3LBX B;  4PK6 A;  2H7O A;  4JI8 T;  3GWH A;  3SZD A;  5AQO B;  4P0B A;  5JDQ A;  2N2N A;  3AEA A;  1QUU A;  1SE7 A;  1MMN A;  2K48 A;  4DND A;  4DBR A;  2VUR A;  1JNZ A;  3RYC E;  3LSV A;  4X1Y E;  2ZM6 T;  2IC9 A;  5IHY A;  2D0U A;  2W61 A;  3G7G A;  1D1A A;  4AYN A;  5IUX A;  3JCF A;  5JDM A;  3Q5W A;  4UIG A;  3ZEF B;  3QB5 A;  1CUN A;  3UUN A;  2WZI A;  4HFI A;  4O3Y A;  2V7M A;  4TNV A;  3Q2M A;  4QHO A;  4DO0 A;  3ZLI A;  4LFC T;  3B13 A;  4MFR A;  4YSX A;  3CIR A;  3Q5E A;  5LHI B;  1N34 T;  2UUA T;  4NXN T;  3J7Y q;  3SY7 A;  2V6X A;  3KV4 A;  3PUQ A;  1G8X A;  3EVY A;  4BA9 A;  1HXU A;  1G90 A;  3LBX A;  2MOZ A;  1UGO A;  2VK9 A;  3JAE A;  2MNH A;  3R84 B;  3ZC1 A;  5H2F O;  4XNK A;  4PR7 A;  1XMO T;  1T98 A;  5J0Z A;  4YJ3 E;  3A7M A;  3P4S A;  4DR5 T;  1XDP A;  4NXM T;  3UU4 A;  2HH7 A;  2XQ9 A;  2EHO C;  1D1C A;  2IHR 1;  5DL8 A;  2YDQ A;  2IIU A;  2M07 A;  1BR2 A;  4EZ4 A;  2UUC T;  3ZYK A;  4NPP A;  4KUM B;  4EZH A;  1ZHX A;  2WM9 A;  3ETV A;  1YQ4 A;  1MM4 A;  4TV8 E;  2K24 A;  2WWV A;  4KP3 C;  1WR6 A;  4LML A;  2M67 A;  4YTP A;  4B3M T;  3SY9 A;  4MBQ A;  2WBL A;  5IYU A;  3UUL A;  4PJ0 O;  3ZN1 B;  2AXT O;  1ZHC A;  2NP9 A;  2OA5 A;  4IT4 A;  4H9P C;  4QH1 A;  4FT6 A;  4QKN A;  2JJ9 A;  5LHG B;  3SOL A;  2YIN A;  5L3E B;  1ZV4 X;  2K0L A;  2GE4 A;  2X68 A;  3ZN0 B;  3O1J A;  5FYM A;  4EGW A;  2I6H A;  2E9X B;  2ES0 A;  3L3P A;  2XY8 B;  2L3L A;  3U3I A;  1WCR A;  2ZM2 A;  2WDR A;  4KI0 F;  1FMW A;  3RHW A;  5JRE A;  2XG6 A;  2BBJ A;  2C5I T;  4I55 E;  4FZL A;  5JR9 A;  4EB6 E;  4EYU A;  2JQQ A;  1QJ8 A;  3RIA A;  4N75 A;  4IE0 A;  3K8P C;  3K3Q C;  2X9H A;  5GON E;  4C91 A;  3KBT A;  3UTK A;  2K3W A;  1MM5 A;  3QRA A;  3AE4 A;  2XE2 A;  3SRZ A;  5LGN B;  1D1B A;  4GCS A;  3QUJ A;  5KMG P;  3C98 B;  1GFN A;  3UPG A;  4FRT A;  5AQJ B;  1NEK A;  4U7I A;  5DQW A;  2PRN A;  4DV1 T;  3FBZ A;  3AAE A;  4ILC A;  2BDE A;  3H3A A;  3KV5 A;  3PUV F;  1R8I A;  2VAS A;  5GV0 A;  2LSJ A;  5L3D B;  2C0S A;  2ODV A;  3RIF A;  1KFY A;  1H7C A;  3AE5 A;  2VVS A;  3A0H O;  1YD8 G;  2WMO A;  4IL6 O;  3CX7 B;  4PNI A;  1IJ5 A;  1AJ3 A;  2XQ4 A;  2Y8D A;  1OWA A;  3LK3 B;  2UXD T;  3CQX C;  2XTR A;  3X1D A;  3RRC A;  4YJ2 E;  4DV4 T;  2BBH A;  1ORM A;  4C90 A;  1NWM X;  2NTX A;  5J2T E;  4O2A E;  5EK4 A;  4E7Z A;  5A1L A;  3AE7 A;  3OJA A;  5EZY E;  3TLS A;  3DA4 A;  4Q25 A;  4QX7 B;  4I43 B;  3WI5 A;  2Q9Q A;  2VKO A;  4KRA A;  4JI4 T;  2CA5 A;  2CLY C;  2LSI A;  3ZKR A;  2CM0 A;  1CHU A;  3N2G E;  2VL8 A;  1I6Z A;  1XZY A;  3VZU X;  3ZCJ A;  3VRA A;  4PUX A;  2V5C A;  3RC3 A;  3T8O A;  2D5U A;  2V7J A;  4YT0 A;  3POU A;  4DMV A;  1OED E;  3N5L A;  3SFE A;  4XBF B;  2N2L A;  4RJW A;  5HCM A;  5TIS O;  3HKE E;  3RRW A;  5DL5 A;  4GK0 E;  3QRC A;  2X9W A;  1HXT A;  2M6I A;  2YEV C;  3PV0 F;  1T1L A;  3TZG A;  5PRN A;  5HEH A;  2BKO A;  3RQU A;  4BUM X;  3DWO X;  3O4X E;  1QSD A;  5DAB A;  4O3Z A;  2Y0L A;  2WSS V;  1PHO A;  2UXC T;  2ZM0 A;  2R4N A;  3CX6 B;  3RIU A;  1L0V A;  1US7 B;  5DL6 A;  2AE9 A;  5LB7 B;  2J4G A;  2IML A;  4AYE C;  3IEE A;  1KEY A;  2IC6 A;  4JI0 T;  4B61 A;  3FZK B;  2BG9 C;  4GIW A;  3JAD A;  3VR8 A;  3LK4 1;  3M65 A;  4ILA A;  4OFZ A;  2F1C X;  4UVC B;  2Q9Q D;  5FVK A;  2KC0 A;  3NRX A;  2DCF A;  2QRX A;  3BK9 A;  3RGL A;  3NJT A;  4Z3T A;  1MMA A;  2DWK A;  2CXD A;  3VZT X;  5B5E O;  1WR0 A;  4TWF A;  5C8Y E;  4AIU A;  5LGU B;  3AA7 B;  4C4V A;  3I0O A;  4OK0 A;  4GHB A;  4E1T A;  2NOX A;  4HEA A;  4ZI7 E;  5G26 A;  2FJE A;  5JDG A;  3VU7 H;  2WP9 A;  3AE2 A;  2X66 A;  4YSZ A;  4LFB T;  2YDR A;  1HS7 A;  2DLR A;  2BS3 A;  4IRE A;  2SPC A;  1HFA A;  2N2M A;  4N59 A;  5LHH B;  3AAA A;  4TUY E;  4PFO A;  2VKD A;  4HWD A;  5AQN B;  4PK5 A;  5IYZ E;  4UB6 O;  3VZW X;  2MYS A;  2DL1 A;  1KK7 A;  2L9Q A;  3NRY A;  3MJX A;  3ZT5 A;  2KWH A;  4D65 A;  4AI6 A;  4O8S A;  3LK4 2;  3VR9 A;  3AEG A;  3V8U A;  2Q9Q B;  2A72 A;  1GFQ A;  3E0Z A;  2VWA A;  4AZL A;  2YOE A;  2XHE B;  5FKY A;  2WU5 A;  4Z91 A;  1B7T A;  3JC6 D;  2WCA A;  3PJA J;  5KAF O;  3V5S A;  3PGS A;  3O1H A;  5AQS B;  3T24 A;  2V26 A;  1IBL T;  4OYK A;  4E1S A;  2DWG A;  4A56 A;  3QOF A;  5FNV E;  4TNW A;  3AA6 B;  3RYI E;  2M06 A;  3I9W A;  5KDM C;  2V8S V;  4XZC A;  2KWI B;  3P4R A;  4A97 A;  2NW9 A;  4IE6 A;  2Y0H A;  1BR4 A;  4G75 A;  4LSF A;  2FUP A;  4CI2 B;  4PJL A;  2LHR A;  4P1N A;  2KMF A;  3I1A A;  2RP4 A;  3N9M A;  3C4W A;  4KHP T;  2V7I A;  1N36 T;  4CZZ B;  2D2S A;  4PJM A;  3O0E A;  3IBP A;  4FQE A;  3C4X A;  4IGU A;  3GA8 A;  1HCI A;  2LT3 A;  1D0Y A;  3M3Z B;  3AE3 A;  4KX6 A;  2RA1 A;  3GN5 A;  1GFO A;  2WJR A;  4B3S T;  2QYW A;  3ETU A;  4HFD A;  5JR9 B;  4PK4 A;  1ZHY A;  4HE8 A;  2XMX A;  1X79 A;  4DMW A;  2FBW A;  5KXJ A;  2JMK A;  2LLY A;  2JMH A;  2XQA A;  5LG3 A;  2CLY B;  2ZLD A;  3I0Q A;  4D64 A;  3C51 A;  2EHO A;  4BJN A;  2JQ9 A;  3TLT A;  3VKH A;  2XZE A;  5CFB A;  3PGU A;  5GTI O;  3VE1 A;  2N9D A;  3C50 A;  2RPA A;  1HNW T;  5L3G B;  1V9D A;  1Z8U A;  4ERR A;  4X62 T;  3TLU A;  2C5K T;  1W9R A;  4WBO A;  3CVR A;  4L5G A;  3ZMZ B;  1Q9G A;  1MND A;  1ZHW A;  5ABG A;  3D0T A;  4EOZ B;  5FY7 A;  1QLB A;  2UUB T;  4J2C A;  2KDY A;  2WZH A;  3IF8 B;  4AKR B;  4JCH A;  1BT9 A;  3ONJ A;  1HG2 A;  2QGS A;  1T72 A;  5AQM B;  2JQH A;  4CQI A;  3LK3 A;  4DV5 T;  3EMN X;  4B3R T;  1HTJ F;  4O4L E;  3B57 A;  3VHL A;  2R6G F;  2X0L B;  2W63 A;  5L2L A;  4YHJ A;  4U3C A;  3POX A;  1HNZ T;  3UUM A;  3SYS A;  2IAK A;  3EI0 A;  3OBV E;  2CBI A;  4RLC A;  1PRN A;  2BG9 B;  4CI1 B;  5ADX K;  3PUY F;  4IE4 A;  5E79 O;  5FVL A;  4N74 A;  5CJ5 A;  4ZZC A;  1HR0 T;  5LP6 E;  4BJM A;  4LFA T;  4CN4 A;  3ZCI A;  3FHN A;  3KVB A;  3K3N A;  1MMD A;  1SA0 E;  3HOE A;  3P7I A;  4DVD A;  2Y2X A;  1J5W A;  3EHZ A;  1FMV A;  5ABH A;  4ZS2 A;  2OMF A;  5FY1 A;  5FXX A;  5D5D A;  4RL9 A;  2JIW A;  2LHN A;  2H88 A;  5JDP A;  3JCU O;  1T8B A;  5LMN T;  4ZEY A;  4QXC B;  4K0K T;  2XQ5 A;  1UK5 A;  3FZH B;  1FEW A;  2PJQ A;  2BG9 A;  2K9A A;  3E08 A;  2EHO D;  1BXW A;  5HAX A;  4B3T T;  1NEN A;  4JEU B;  3VY9 X;  3E22 E;  4TX5 A;  2B76 A;  4QXB B;  3T20 A;  2XSB A;  2XTQ A;  1S94 A;  3PUA A;  3PDY A;  4F8H A;  3UU3 A;  4HFC A;  2K4T A;  2BS2 A;  2LRK A;  3OPC A;  4U9C A;  2E5L T;  4AUI A;  2FGR A;  3PJA A;  3W15 B;  2XM1 A;  4WZX A;  5AQH B;  2PG8 A;  4LF8 T;  3HOL A;  5ABF A;  3L8R A;  3R6N A;  3CPZ A;  2YPV A;  2B1E A;  3Q5D A;  2WJQ A;  4FMS A;  3OYZ A;  3U78 A;  4I0U A;  2E2A A;  5LBQ B;  3BQL A;  3RYH E;  5ABE A;  2V6Y B;  4JBW F;  5LA6 E;  4L9I A;  3DZM A;  4JI2 T;  3RYF E;  4AYI D;  3AB3 B;  1KNR A;  3J9X 1;  2LHF A;  1XMQ T;  4UVB B;  1LVK A;  3DTO A;  3BRY A;  4HWF A;  5L4H A;  3JTY A;  2E9X C;  1MIV A;  4YHH T;  4IDZ A;  5HXS A;  2EHO B;  4DUY T;  2ODU A;  3T1H T;  2CWO A;  4HFV A;  2X0Y A;  3AA0 B;  1D0X A;  4H9S E;  3BS0 A;  4OYJ A;  4CI3 B;  4H9Q C;  4RLB A;  5JDN A;  2UXB T;  5FXW A;  3OVU A;  3ZSS A;  4ZZB A;  3PQS A;  2QTK A;  5JRC B;  2R88 A;  5HCJ A;  3T0S A;  2G0U A;  3HI2 A;  4IDP A;  3O9X A;  2ACX A;  3CX8 B;  4DR4 T;  5AFU K;  2W0G A;  2W2U A;  3NVO A;  4H9N C;  4FES A;  5C2T A;  2FJA A;  3PTR B;  4H9R C;  1HXX A;  3AAA B;  2I0M A;  2Y6X A;  3AA1 B;  5JDL A;  1LVF A;  3MK7 C;  2WU2 A;  5G39 A;  3ZJ2 A;  3RPU A;  5LCY A;  3PUW F;  4FI5 A;  4HWC A;  3ZMV B;  4PFP A;  2C5J A;  4JI5 T;  3WAK A;  2E5V A;  3A2S X;  4H63 V;  2E8I A;  3AEC A;  4ZI3 D;  3A0B O;  5FMN A;  2QVA A;  5JR9 C;  2XQ8 A;  5DL7 A;  3AXJ B;  4IHJ E;  1LKX A;  3P4W A;  4GKJ T;  4YXD A;  2WQY A;  4GCP A;  1M7K A;  4AKG A;  4JI6 T;  3FZF B;  3BRZ A;  4A5X A;  5LJM A;  4KBM B;  4GK5 E;  3L39 A;  4LF6 T;  4HGA A;  4CN6 A;  5F5W A;  1QJP A;  3KDS E;  3ZPO A;  2W62 A;  1JNR A;  3SYB A;  3ZMS B;  3AA1 A;  1KF6 A;  2LSY A;  2UU9 T;  4GOU A;  5JDF A;  4NUU A;  1E7P A;  2A3D A;  3PQU A;  2CBJ A;  4ZXL A;  4BAY B;  4F4B A;  2NW7 A;  3SFD A;  4HN9 A;  2IDO B;  3N9O A;  3F57 A;  1LRZ A;  2WB5 A;  5JQG E;  5L3B B;  1W09 A;  4KR8 A;  4JEH B;  5HEU A;  1QJ9 A;  2KXP A;  1ZEE A;  5J2U E;  3VY8 X;  5AQG B;  2XQ6 A;  5JDH A;  2D9D A;  5AQL B;  4I50 E;  4KHZ F;  4DID B;  1UX5 A;  4QXH B;  4OX9 T;  4AYD C;  4G76 A;  4XNL A;  2KXP B;  3AA0 A;  3F2E A;  3ZMU B;  3P50 A;  3WAJ A;  3C4Z A;  2NTY A;  4COF A;  3CWZ B;  3QC9 A;  2W00 A;  2F1T A;  3K3O A;  2XM2 A;  5TAO A;  2LOP A;  2J47 A;  2YNK A;  1FJG T;  3POR A;  3ZT7 A;  3N2K E;  3PUX F;  3CML A;  3OYX A;  1S35 A;  3OKQ A;  1HF8 A;  2J1N A;  5AFU L;  2V6Y A;  5HYA A;  1X9B A;  1EZ3 A;  3BQI A;  3NZQ A;  2A2F X;  5L4E A;  1M62 A;  4O3W A;  5M4Y A;  4HFH A;  5DQV A;  2ZFG A;  2POR A;  5T5F A;  4IIJ E;  4F6R C;  4EED A;  2JQY A;  4JV5 T;  4GYR A;  4AKM A;  3RQW A;  1O3X A;  5AQP B;  2XAJ B;  3ANW B;  2MPK A;  2Y48 B;  3AEB A;  3AXJ A;  4P09 A;  3QB5 K;  1H6S 1;  3MZK B;  1T7S A;  2XQY A;  1XWM A;  4AQF C;  3FXD B;  4KMC A;  3AEF A;  2DI4 A;  3HL6 A;  3LJC A;  3N9Q A;  4UVA B;  2CHO A;  4IDO A;  1MMG A;  3UFE A;  4QX8 B;  4X5T A;  3Q5X A;  3LDQ B;  2X9X A;  4UV9 B;  1MNE A;  4EEB A;  3AAI A;  3N2O A;  5CA0 E;  4YTM A;  3AAE B;  2JMM A;  3WI4 A;  4UB8 O;  2CXL A;  2K5B B;  3FBL A;  5KX5 E;  3DP7 A;  4X65 T;  5L3C B;  5JTG A;  1NAF A;  1VRB A;  4NUV A;  1VCT A;  4HWI B;  2BZB A;  4QH4 A;  3QK6 A;  2VKH A;  3RKG A;  3P4Q A;  2XQ3 A;  2J62 A;  2LOS A;  5HEO A;  3CK6 A;  2NR4 A;  2XPK A;  2R4O A;  1HX1 B;  5L3F B;  4HFE A;  4JI7 T;  4YSY A;  2FJB A;  2LM2 A;  4FUV A;  4UXN B;  3EAM A;  2W80 C;  4FOZ A;  5HEG A;  4MHC A;  4IST A;  4E7S A;  4GYS A;  4QH5 A;  3ZYL A;  3AED A;  1E1H B;  2JRK A;  4DR2 T;  4YY3 T;  3EUH A;  4YLH A;  2XAS B;  3NZP A;  3MXZ A;  4AKH A;  4CXW A;  3UUB A;  4CTD A;  2LKH A;  1YKE B;  2WDV A;  3RH3 A;  4O49 A;  5FP3 A;  4X66 T;  1MIW A;  3NSG A;  2YU1 A;  2MBG A;  4N58 A;  4C00 A;  5LXT E;  5AQQ B;  4X20 E;  4ISS A;  1BR0 A;  2V5D A;  5AQR B;  3CQG B;  2P9B A;  2W66 A;  3GMI A;  2MAW A;  4H63 H;  2LKG A;  4TWD A;  3MA9 A;  4ANJ A;  2LJL A;  5JH7 E;  2XTL A;  4DV6 T;  2X9K A;  1SHZ C;  4TN7 B;  2FJD A;  1OPF A;  1E2A A;  3LK2 A;  4AQG A;  2W67 A;  5ABF B;  2HN2 A;  4AXP A;  3SS1 A;  3I9Y A;  3UQ4 A;  3NKZ A;  2X51 A;  1GFP A;  2HPL A;  4LSE A;  1Z0P A;  2R4P A;  2E9X A;  4IDN A;  2XUE A;  4HKA A;  4OHF A;  2BKN A;  4JFB A;  3MKD A;  2JQK A;  3KVA A;  4LF5 T;  3MAC A;  3HKD E;  1Y64 B;  2YKS A;  4X1K E;  2FGQ X;  4X1I E;  5DJQ C;  2H7V C;  3HA4 A;  3LG7 A;  2CRB A;  4LF4 T;  3LFM A;  5H6Q B;  5AQV B;  3C5O A;  3F31 A;  3GN5 B;  3LK2 B;  3DWN A;  2L8K A;  3A8Y C;  4PJN A;  4ZI2 C;  2M6B A;  4PW8 A;  4EXT A;  3RX6 A;  2ACZ A;  2CPT A;  2WMN A;  4G2A A;  4K3C A;  3PE0 A;  4IL4 A;  2R4L A;  4IE7 A;  3PU3 A;  2CXF A;  4L0R A;  1WYB A;  3PUS A;  1UUR A;  3RLF F;  2ZM8 A;  3WU2 O;  4DR7 T;  3H3M A;  3ONL C;  1W0B A;  4AIS A;  5LBM A;  3KBU A;  4O3X B;  4DV2 T;  4DV0 T;  4ASK A;  5G38 A;  1XNR T;  5L47 A;  3OTO T;  4GCQ A;  3SWH A;  5CA1 E;  2JPF A;  4Z8X A;  4FRX A;  1W0A A;  1UUS A;  3K19 A;  4EIW A;  5F3J A;  2GK9 A;  4JLE A;  2CE7 A;  4JI1 T;  4LF7 T;  3H37 A;  4UEL A;  3PUG A;  1U5P A;  1S5L O;  1YKH B;  3KVD D;  5E0O A;  3PF1 A;  3POQ A;  3ZMT B;  2OV9 A;  1G73 A;  5BMV E;  4MAL A;  5ETW A;  3UT5 E;  4HWH A;  4O4J E;  1ZP0 A;  2XAQ B;  1YW0 A;  5LMU T;  2IWW A;  4IL9 A;  2Q9Q C;  4LMJ A;  4UF0 A;  4AQF A;  5H6R B;  3WI3 A;  2X67 A;  2LRL A;  4QQ1 A;  1HG5 A;  2I59 A;  7PRN A;  4DR1 T;  4AKR A;  3ZT6 A;  4P0A A;  2YU2 A;  2CWY A;  3UU6 A;  2KT9 A;  3AVS A;  3ZJ1 A;  2R89 A;  3G06 A;  5HWX A;  4ZI2 D;  3N9P A;  4K0U A;  4AKL A;  2WS3 A;  2KSR A;  2PTF A;  2IW5 B;  4ILB A;  1YS5 A;  2PFV A;  3AVR A;  2MHL A;  3QNU A;  2D0T A;  4U31 A;  2Y0K A;  1YQ3 A;  4AKI A;  2BS4 A;  3RBH A;  1IBK T;  1YXR A;  4M1P A;  3JC6 C;  3RI5 A;  3ESL A;  2UXN B;  4JYA T;  3DJB A;  4PAG A;  3NBX X;  3EAB A;  1DU2 A; 
#chains in the Genus database with same CATH homology
 2RP4 A;  5LOV E;  2VKJ A;  2M07 A;  2KLQ A;  1BR2 A;  4FZM A;  4EZ4 A;  3ZYK A;  3N9M A;  3C4W A;  4KUM B;  4U72 A;  2V7I A;  4ILU A;  4EZH A;  2KXP A;  2V7K A;  1ZEE A;  2LM9 A;  5J2U E;  1ZHX A;  2WM9 A;  3TKL B;  3ETV A;  2D2S A;  4PJM A;  4CZZ B;  5JDH A;  1MM4 A;  3FB2 A;  3IBP A;  3O0E A;  4I50 E;  4TV8 E;  3C4X A;  2K24 A;  1UX5 A;  4QXH B;  4IGU A;  4KP3 C;  4AYD C;  5CB4 E;  3GA8 A;  1WR6 A;  1HCI A;  4ZS3 A;  4ADZ A;  4G76 A;  4XNL A;  2KXP B;  3AA0 A;  2LSK A;  2LT3 A;  3F2E A;  3ZMU B;  3EDU A;  1D0Y A;  4I4T E;  2M67 A;  3WAJ A;  2UXX B;  2RA1 A;  3C4Z A;  3GN5 A;  1GFO A;  3SY9 A;  2NTY A;  4PJJ A;  3ANW A;  4MBQ A;  5LG4 A;  3CWZ B;  3ETU A;  2WBL A;  3PUR A;  3QC9 A;  2W00 A;  5IYU A;  2LSG A;  3UUL A;  5JR9 B;  2F1T A;  3K3O A;  3O1I A;  4PK4 A;  5FVN A;  1ZHY A;  4MLK A;  5TAO A;  2LOP A;  4HE8 A;  1X79 A;  3ZN1 B;  4DMW A;  1ZHT A;  5LNK A;  2XMX A;  2JMK A;  1KNZ A;  1ZHC A;  5FY0 A;  2NP9 A;  3KFW X;  2KZ7 A;  2JMH A;  4TV9 E;  2OA5 A;  2YNK A;  2KND A;  2CLY B;  4H9P C;  2ZLD A;  3I0Q A;  4FT6 A;  3POR A;  5HXH A;  4D64 A;  4ZOL E;  4QKN A;  2JJ9 A;  3N2K E;  3C51 A;  3CML A;  5LHG B;  2NW8 A;  2EHO A;  3SOL A;  3C64 A;  3OYX A;  1S35 A;  4BJN A;  2YIN A;  2KIN B;  4KR4 A;  5L3E B;  3OKQ A;  4U74 A;  3VKH A;  1HF8 A;  2J1N A;  1ZV4 X;  5AFU L;  2K0L A;  2GE4 A;  4D5U A;  5HYA A;  4H9O C;  2Z6E A;  4QWN B;  1EZ3 A;  2X68 A;  3BQI A;  2A2F X;  2ZMA A;  3HR0 A;  3NZQ A;  1IZN B;  3ZN0 B;  1IAP A;  1P4T A;  3O1J A;  2O4V A;  3VE1 A;  5FYM A;  2N9D A;  3C50 A;  4TZ4 C;  4O3W A;  5FXV A;  3V5U A;  5M4Y A;  5DQV A;  2E9X B;  2V7L A;  2ZFG A;  2ES0 A;  1V9D A;  4ERR A;  5L3G B;  3UU2 A;  2DNX A;  2V1D B;  2POR A;  3L3P A;  5T5F A;  2L3L A;  2C5K T;  4WBO A;  3U3I A;  4IIJ E;  1IJ6 A;  3CVR A;  4F6R C;  3AA6 A;  4FJO A;  2ZM2 A;  4L5G A;  3N9L A;  1FMW A;  5JRE A;  4GYR A;  2XG6 A;  4AKM A;  1WLX A;  2HPJ A;  3ZMZ B;  1Q9G A;  1O3X A;  2C5I T;  1UCU A;  4I55 E;  1OXZ A;  4FZL A;  1E54 A;  5JR9 A;  1MND A;  4EB6 E;  4EYU A;  2XAJ B;  3ANW B;  2JQQ A;  1ZHW A;  1QJ8 A;  4IE0 A;  3D0T A;  2Y48 B;  3K8P C;  4P09 A;  4EOZ B;  5FY7 A;  3K3Q C;  2E9X D;  2X9H A;  4WW0 A;  5GON E;  3KBT A;  4C91 A;  3UTK A;  1MM5 A;  1H6S 1;  3QRA A;  4J2C A;  2KDY A;  3MZK B;  4O4I E;  3IF8 B;  4AKR B;  4JCH A;  5FXZ A;  1BT9 A;  1ZHZ A;  2XQY A;  3CQC B;  1HG2 A;  4AQF C;  3SRZ A;  2QGS A;  2XE2 A;  2Y7S A;  3HWB A;  5LGN B;  3FXD B;  4XAX B;  1D1B A;  4GCS A;  2CCQ A;  3QUJ A;  5KMG P;  3C98 B;  4KMC A;  4CQI A;  2DI4 A;  3HL6 A;  3LK3 A;  1GFN A;  2X27 X;  4FRT A;  3EMN X;  2QA7 A;  3LJC A;  3N9Q A;  4WBN E;  3UPG A;  5DQW A;  2DHR A;  2PRN A;  5LYJ E;  4UVA B;  3FBZ A;  1HTJ F;  5ADX L;  4O4H E;  2XAH B;  4O4L E;  1MMG A;  3UFE A;  3AAE A;  1BR1 A;  2BDE A;  3B57 A;  2CEA A;  3H3A A;  3KV5 A;  4QX8 B;  3UUX B;  3VHL A;  1WYC A;  2X0L B;  3Q5X A;  2X9X A;  2WWU A;  4UV9 B;  1MNE A;  2YK0 A;  2W63 A;  5HXE A;  5L2L A;  4YHJ A;  2VAS A;  3AAI A;  3N2O A;  2LSJ A;  5GV0 A;  5CA0 E;  3POX A;  3AAE B;  5L3D B;  4LSI A;  3RC8 A;  2JMM A;  2C0S A;  4CXY A;  1WRD A;  2ODV A;  3WI4 A;  3UUM A;  2CXL A;  2K5B B;  3FBL A;  5LGT B;  2XE1 A;  3SYS A;  5J1G A;  5KX5 E;  2BVL A;  2IAK A;  3DP7 A;  3OBV E;  1H7C A;  2BVM A;  4RLC A;  5L3C B;  1PRN A;  4CI1 B;  5ADX K;  1YD8 G;  2W81 C;  4IE4 A;  2WMO A;  1NAF A;  1VRB A;  4GF4 A;  4NUV A;  1Q9F A;  3CX7 B;  4PNI A;  1THQ A;  4WNK A;  3VY8 X;  5EK2 A;  5LP6 E;  3N9N A;  1IJ5 A;  3ZC0 A;  2BZB A;  5LJN A;  1AJ3 A;  3QK6 A;  2VKH A;  4BJM A;  3ZCI A;  1HX8 A;  2Y8D A;  3FHN A;  3K3N A;  3KVB A;  3NBX X;  1MMD A;  2LOS A;  1OWA A;  3KV6 A;  3LK3 B;  1SA0 E;  3HOE A;  3P7I A;  3CQX C;  6PRN A;  4LSH A;  2XTR A;  3RRC A;  4YJ2 E;  3PRN A;  4DVD A;  2Y2X A;  5L3F B;  1FMV A;  2XE3 A;  1ORM A;  4YFS A;  4FUV A;  4RJX A;  3UAQ A;  4UXN B;  4ZS2 A;  2OMF A;  4UV8 B;  5FY1 A;  5FXX A;  4C90 A;  1NWM X;  5D5D A;  2NTX A;  2W80 C;  4RL9 A;  4FOZ A;  2ODJ A;  4MHC A;  5J2T E;  4AYM C;  4O2A E;  5EK4 A;  4E7Z A;  4IST A;  2LHN A;  5EE2 A;  4E7S A;  4GYS A;  5A1L A;  3VE2 A;  3OJA A;  5EZY E;  3AA7 A;  5JDP A;  1BH3 A;  3DA4 A;  3KV9 A;  4QX7 B;  4I43 B;  1IZN A;  4G63 A;  4QXC B;  3ZYL A;  1E1H B;  3WI5 A;  2JRK A;  2Q9Q A;  2VKO A;  4JUY A;  4KRA A;  2XE5 A;  1FEW A;  2PJQ A;  2LEH A;  3EUH A;  3Q9D A;  3EDV A;  2CA5 A;  2CLY C;  4YLH A;  2XAS B;  2LSI A;  3NZP A;  2K9A A;  3E08 A;  3MXZ A;  4AKH A;  2EHO D;  2CM0 A;  4O4X A;  4B6X A;  4CXW A;  1BXW A;  3N2G E;  5HAX A;  2VL8 A;  3VZU X;  3ZYM A;  3ZCJ A;  4JEU B;  3VY9 X;  1OSM A;  4PUX A;  3E22 E;  1YKE B;  4TX5 A;  3RH3 A;  4O49 A;  4CXX A;  4QXB B;  5FP3 A;  3RC3 A;  3T8O A;  2D5U A;  2V7J A;  2PBI A;  3T20 A;  2XTQ A;  2F1V A;  1S94 A;  3POU A;  1VOM A;  3PUA A;  4DMV A;  1MIW A;  3NSG A;  3PDY A;  2YU1 A;  2MBG A;  3HW9 A;  4N58 A;  3N5L A;  5LXT E;  2CMR A;  4XBF B;  2N2L A;  8PRN A;  4RJW A;  5JRC A;  2XAF B;  4X20 E;  4ISS A;  1UX4 A;  1BR0 A;  2K4T A;  1ZKE A;  3HKE E;  3RRW A;  5DL5 A;  2N1G A;  4GK0 E;  3CQG B;  2P9B A;  4U9C A;  3RKO A;  3QRC A;  2X9W A;  3GMI A;  4AUI A;  5F8P A;  2FGR A;  4H63 H;  4O2B E;  1HXT A;  4FSO A;  3CKD A;  3W15 B;  2YEV C;  2XAG B;  3TZG A;  2LFU A;  5PRN A;  3MA9 A;  4ANJ A;  2PG8 A;  3HOL A;  2LJL A;  5JH7 E;  3FYX A;  5JVD E;  3R6N A;  4BUM X;  2XTL A;  1SHZ C;  4TN7 B;  1OPF A;  3O4X E;  1QSD A;  3CPZ A;  5DAB A;  2YPV A;  3LK2 A;  2B1E A;  4EAH A;  5HWY A;  4O3Z A;  4AFK A;  2Y0L A;  2WSS V;  1PHO A;  4AQG A;  1FIO A;  4FMS A;  3VKG A;  2ZM0 A;  3CX6 B;  3OYZ A;  3U78 A;  1US7 B;  5DL6 A;  5LBQ B;  3BQL A;  2X9Y A;  3RYH E;  4EYY R;  4AXP A;  3SS1 A;  3I9Y A;  4AYE C;  2X51 A;  5LA6 E;  3IEE A;  2IC6 A;  4L9I A;  1GFP A;  2HPL A;  4HTE A;  5EK3 A;  4LSE A;  4B61 A;  1Z0P A;  3RYF E;  4AYI D;  3AB3 B;  2E9X A;  4GIW A;  5HXR A;  3GP6 A;  3J9X 1;  2NWB A;  2J1D G;  2XUE A;  2LHF A;  4HKA A;  4OHF A;  4FZN A;  2H3R A;  4DBQ A;  3LK4 1;  4JFB A;  4UVB B;  1LVK A;  3MKD A;  3M65 A;  3DTO A;  2LE8 A;  2VB6 A;  4UEM A;  3JTY A;  2E9X C;  3KVA A;  4OFZ A;  2ZLY A;  1MIV A;  4IDZ A;  3MAC A;  4UVC B;  2Q9Q D;  3HKD E;  4C69 X;  1Y64 B;  5HXS A;  2KC0 A;  3NRX A;  4X1K E;  2FGQ X;  4X1I E;  2DCF A;  2EHO B;  5DJQ C;  2H7V C;  3HA4 A;  3LG7 A;  3LFM A;  1D0Z A;  3BK9 A;  3PU8 A;  4V1A v;  5H6Q B;  3C5O A;  3F31 A;  4Z3T A;  3GN5 B;  2ODU A;  2WAU A;  3LK2 B;  1MMA A;  2CWO A;  4HFV A;  2L8K A;  3P8C D;  2ERV A;  2DWK A;  3AA0 B;  2CXD A;  1D0X A;  3ONX A;  2KZ7 B;  4H9S E;  3VZT X;  4OYJ A;  4CI3 B;  4PJN A;  3A5X A;  5C8Y E;  4H9Q C;  4ZI2 C;  4RLB A;  2J4U P;  4PW8 A;  5JDN A;  3KIN B;  4EXT A;  5LGU B;  3RX6 A;  4UF0 B;  5FXW A;  1QJ9 A;  3AA7 B;  2WMN A;  4G2A A;  3I0O A;  3PE0 A;  4OK0 A;  1GFM A;  4GHB A;  1MPF A;  3PQS A;  4IE7 A;  4E1T A;  3PU3 A;  2NOX A;  2CXF A;  2MTQ A;  3HKC E;  4L0R A;  5JRC B;  2QTK A;  4HEA A;  1WYB A;  3PUS A;  3S4U A;  3T0S A;  2ZM8 A;  2G0U A;  3SZV A;  3HI2 A;  4IE5 A;  4FSP A;  4ZI7 E;  5LBM A;  5HXC A;  3KBU A;  4O3X B;  3FXE B;  4ZHQ E;  5JDG A;  5G26 A;  3VU7 H;  4ZI3 C;  1MIY A;  4ASK A;  3O9X A;  3BQK A;  2ACX A;  2X66 A;  3HKB E;  3CX8 B;  3IHR A;  4O4U A;  4GCQ A;  1HS7 A;  2DLR A;  3SWH A;  1U4Q A;  5AFU K;  2SPC A;  2W0G A;  5CA1 E;  1HFA A;  2JPF A;  2N2M A;  4N59 A;  4H9N C;  4Z8X A;  4N78 D;  5LHH B;  3AAA A;  3L09 A;  4TUY E;  3DA3 A;  3LBX B;  4PFO A;  4FES A;  4PK6 A;  2H7O A;  4FRX A;  2VKD A;  3PTR B;  4H9R C;  3GWH A;  3AAA B;  4PK5 A;  4P0B A;  5IYZ E;  1HXX A;  3SZD A;  5JDQ A;  2Y6X A;  2N2N A;  3AA1 B;  3K19 A;  2MYS A;  3VZW X;  5JDL A;  1QUU A;  1LVF A;  1MMN A;  2K48 A;  4EIW A;  5F3J A;  3MK7 C;  4DND A;  2GK9 A;  4JLE A;  1KK7 A;  2CE7 A;  2L9Q A;  3NRY A;  4DBR A;  3H37 A;  4UEL A;  3MJX A;  3RYC E;  3ZJ2 A;  3PUG A;  3RPU A;  5LCY A;  4X1Y E;  1U5P A;  1YKH B;  3KVD D;  2KWH A;  2IC9 A;  5IHY A;  5E0O A;  4FI5 A;  3ZMV B;  3POQ A;  4D65 A;  2D0U A;  4PFP A;  2C5J A;  2W61 A;  3ZMT B;  4AI6 A;  4O8S A;  3LK4 2;  3WAK A;  1G73 A;  3G7G A;  5BMV E;  4MAL A;  1D1A A;  4AYN A;  3A2S X;  2Q9Q B;  4H63 V;  2A72 A;  3V8U A;  5ETW A;  2E8I A;  3E0Z A;  3UT5 E;  1GFQ A;  2VWA A;  5JDM A;  3Q5W A;  4O4J E;  4ZI3 D;  4UIG A;  4AZL A;  3ZEF B;  2XAQ B;  5FMN A;  1YW0 A;  5JR9 C;  2XHE B;  1CUN A;  3UUN A;  5DL7 A;  2Q9Q C;  4IHJ E;  1LKX A;  4UF0 A;  4AQF A;  1B7T A;  3JC6 D;  5H6R B;  4GCP A;  4O3Y A;  3WI3 A;  2X67 A;  4AKG A;  4QQ1 A;  1HG5 A;  2V7M A;  2I59 A;  3V5S A;  7PRN A;  5LJM A;  4KBM B;  4AKR A;  4GK5 E;  3Q2M A;  4QHO A;  4DO0 A;  3ZLI A;  4HGA A;  4P0A A;  3B13 A;  4MFR A;  3O1H A;  2YU2 A;  1QJP A;  2CWY A;  3T24 A;  3KDS E;  2KT9 A;  2V26 A;  3AVS A;  3ZJ1 A;  3ZPO A;  2W62 A;  4OYK A;  5LHI B;  3SYB A;  5HWX A;  4E1S A;  2DWG A;  3ZMS B;  4ZI2 D;  3J7Y q;  4A56 A;  3N9P A;  4K0U A;  3SY7 A;  5FNV E;  3AA1 A;  2LSY A;  3KV4 A;  3PUQ A;  4GOU A;  1G8X A;  3EVY A;  5JDF A;  4AKL A;  4BA9 A;  1HXU A;  3AA6 B;  4NUU A;  2A3D A;  1G90 A;  3RYI E;  2M06 A;  3PQU A;  3LBX A;  3I9W A;  2MOZ A;  2VK9 A;  5KDM C;  2IW5 B;  2MNH A;  4BAY B;  3R84 B;  2PFV A;  3AVR A;  4XZC A;  1YS5 A;  3ZC1 A;  2MHL A;  4F4B A;  2KWI B;  2NW7 A;  4XNK A;  4HN9 A;  2D0T A;  2NW9 A;  1T98 A;  3N9O A;  2Y0K A;  4AKI A;  3F57 A;  4YJ3 E;  3RBH A;  4IE6 A;  1LRZ A;  4M1P A;  1BR4 A;  3JC6 C;  2Y0H A;  5JQG E;  3ESL A;  2UXN B;  2HH7 A;  5L3B B;  4G75 A;  4LSF A;  4CI2 B;  2EHO C;  4JEH B;  4KR8 A;  1D1C A;  4PJL A;  2LHR A;  5DL8 A;  3DJB A;  4PAG A;  2KMF A;  3I1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...