3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3LK41 2KXPA 3LK2B 1IZNB 3AA0B 3LK3B 2KZ7A 3AA6A 3AA1B 3AAEA 1IZNA 5AFUL 3AA0A 3AA7A 2KZ7B 3AA6B 5ADXL 3AA1A 3AAEB 3AA7B 4AKRB 5AFUK 3AAAA 3LK42 2KXPB 3LK2A 4AKRA 5ADXK 3AAAB 3LK3A
chains in the Genus database with same CATH superfamily
3UU8A 4EEBA 2CA5A 4ZXLA 5LYJE 4U7YA 1N34T 1Z0PA 4HWFA 5L3FB 1ZP0A 3RX6A 4NXMT 4JI5T 2CHNA 2L8KA 2CXLA 4H9PC 4JEUB 4Q25A 3ZYKA 1QSDA 3HL6A 4K0UA 1SUMB 5CB4E 2Y2XA 5AFUL 2N2LA 4IE6A 5JREA 3NVOA 4PJLA 2J1DG 3AE7A 3RI5A 4UF0B 2LRLA 1D1CA 4O3YA 1WR0A 3N9LA 4H63V 4UV8B 1S5LO 2J47A 4JI8T 5LG4A 4J2CA 5L3CB 4HTEA 1ORMA 2IDOB 3E0ZA 4O49A 2E9XB 3VRBA 2KSRA 1FMWA 3ONLC 3KVAA 5AQNB 1YKEB 1MM4A 4AKIA 3VKGA 3A2SX 1IBMT 3PJAA 4YTMA 2MYSA 3MJXA 5JDPA 4HFIA 4DMVA 2DWKA 2XQ9A 4Z8XA 2MPKA 4JI1T 1MIWA 3FHNA 2N9DA 2K48A 4BUMX 4PW8A 5ETWA 3NJTA 1JNRA 4EAHA 2Y6XA 1W0AA 3K3NA 4B3TT 2V26A 4ZI3D 4P0BA 3H3MA 4DV5T 1XMQT 3AEGA 3F2EA 3VRAA 4WBNE 4KBMB 4FMSA 3CX8B 2YEVC 2R8AA 3RQWA 3FZHB 1HG5A 1GFMA 4UELA 3JAFA 4K3BA 5DABA 2V5DA 3EDUA 2LT3A 3VY9X 2BKPA 5LBQB 4EYYR 4EB6E 2R4LA 4HFCA 5JRCA 5ADXK 5HXCA 2LSGA 3OPCA 2LRKA 3SFEA 5J1GA 2XE5A 4GKKT 3NZPA 5TISO 4E1TA 3AA6B 4AYNA 1HR0T 4HWCA 4EEDA 7PRNA 2M06A 4PJJA 3HA4A 3D0TA 3RC3A 4AQGA 1D1AA 3PUAA 1KK7A 5L47A 2X66A 1OWAA 4N59A 3AA0B 5LGTB 4TUYE 3T1HT 1QJ9A 4ILCA 3AA6A 3RH3A 3UU5A 3JAEA 1L0VA 2VURA 3OYXA 2DCFA 3Q5WA 2E2AA 2WZIA 2KWIB 2K4TA 4EV6A 2ES0A 2UXXB 4N58A 3F57A 4P0AA 5GTHO 3TLWA 4XNKA 4IT4A 1HS7A 3UUXB 5FL0A 2ZM0A 1M62A 2YN6A 3PUVF 4H9NC 4OK0A 4AQFC 3DWOX 3AA1A 4A97A 3C51A 5L2LA 3RYIE 2LLYA 3BS0A 4IREA 3OTOT 2XG6A 3L09A 4YJ3E 5J0ZA 4O4IE 1LKXA 3AE6A 2AXDS 2CEAA 3LK3B 2WJRA 1N33T 3WI5A 1X9BA 2WU5A 2K0LA 2L3LA 3PGRA 2UUAT 3N2GE 3SY9A 4Z91A 2V7KA 3P4QA 3JCUO 5B5EO 4DR7T 1PHOA 2VVSA 3PUWF 4FOZA 4AYID 2QVAA 2WY2A 3QRAA 3BQIA 3ZMVB 3ETUA 2Y48B 2XASB 1XNRT 5AQUB 4OHFA 1E1HB 2GE4A 3CQXC 2YU2A 1E54A 4PJ0O 3C98B 2H89A 2JMHA 2JPFA 2IWWA 2VL0A 4CZZB 3ZT6A 1YD8G 4X64T 2LHRA 3GA8A 5LBMA 3SRZA 3WU2O 2NTXA 4HKAA 3N9NA 1KFYA 4ZEYA 2K24A 5G39A 4MALA 4LFAT 4K3CA 2Y8DA 2IHR1 1HXXA 1FEWA 4LSHA 3R6NA 4K0KT 2WWUA 4GOUA 4UB6O 1W0BA 3PU8A 2Q9QC 2R4PA 3W15B 4GYSA 3Q5XA 2SPCA 2WMOA 2C5KT 2A9UA 5LJNA 2LJLA 2ZLYA 3CX6B 1NENA 2IC9A 4HE8A 3J7Yq 4GIWA 1UCUA 4RLBA 4FUVA 4DR6T 3PURA 4V1Av 3EABA 1MIYA 5HEGA 3BQLA 5FMNA 2VVNA 1IZNA 3L8RA 2CLYB 2BDEA 3ZT5A 3KV4A 1WFDA 3A5XA 4CN4A 1Y64B 4CXYA 4IE4A 3A8YC 2PG8A 3DA4A 4PR7A 1GFOA 1YQ4A 3RC8A 1GFNA 2H7OA 3WI4A 3TLSA 2KMFA 2E8IA 2WM9A 3EVYA 3FBLA 4B3ST 1FMVA 1IJ5A 3V5SA 1Q9GA 2XUEA 3PUZF 4O3XB 5IUXA 2XAHB 2LOPA 2WDQA 3IA3A 4OYKA 2Q9QD 5EZYE 4YSYA 3O0EA 4ZI3C 4JFBA 3U78A 1E2AA 1J5WA 5HEUA 3ZYMA 2MOZA 5LNKA 3PQSA 5H6QB 5G3AA 3X1DA 1YW0A 3K1SA 3ZJ2A 4CQIA 2WWVA 3EHZA 2LKGA 1LVFA 1U5PA 2Q9QA 2I59A 1T1LA 2V7LA 4U3CA 2XAJB 4PJMA 4ERRA 4DV0T 1HX1B 2W0GA 3IHRA 2NP9A 1Y01A 3VY8X 3LJCA 2YDRA 4UVAB 5AQOB 5M4YA 3KBTA 3AEAA 3OBVE 3JC6C 4KI0F 2V7JA 3ZSSA 4GHBA 2Z6EA 4KR4A 1S94A 4NUVA 1US7B 3K8PC 2N2NA 3SZDA 4PK5A 1XWMA 5IWAT 3ZMTB 4TWDA 4AYMC 2XQ7A 1MMAA 1OEDB 3ANWA 2HN2A 3TKLB 3HR0A 3HKBE 3ZMUB 5FVLA 1JNZA 3MK7C 1R8IA 5DL6A 3A0HO 2JMMA 3UUNA 3AA7A 1G73A 3LBXA 4PAGA 2X0YA 5AQVB 5AQRB 2CXDA 4FQEA 5HCJA 3ZCJA 4U31A 1B7TA 5F8PA 2YPVA 4TNVA 2CE7A 2IAKA 3AE9A 4RJXA 1XNQT 5LHHB 5CGMA 2DI4A 1T7SA 2CLYC 3Q5EA 3KZIO 4N78D 4IE7A 2BG9B 2RA1A 2XHEB 4DNDA 5JTGA 1OPFA 4X66T 4JUYA 3P4SA 1QJPA 2ZMAA 2XE2A 3AXJA 3AEBA 4BAYB 2RPAA 3AE1A 2KNDA 3AAIA 4C00A 4QX7B 5KXJA 3ZCIA 4AKRA 3JTYA 3OJAA 4E1SA 2MTQA 2Y0LA 4EXTA 4HWHA 2VL8A 4I4TE 1BH3A 4H9SE 3AAEA 3ONJA 2IC6A 2XQ8A 5AQTB 3RLFF 3RKGA 4CI1B 4ZZBA 3MZKB 3LSVA 5AFUK 2VK9A 3UU6A 3QB5A 2V5CA 4QH4A 4EZ4A 3BK9A 2YK0A 4IL6O 4UB8O 3ZN0B 3C50A 3FYXA 4ILUA 2YOEA 4PJNA 5ABFB 2UUCT 3AA0A 2PORA 2XQAA 2BG9C 3HOLA 2J4GA 5HXSA 4X20E 2R89A 2NW9A 4AYEC 4B61A 3SY7A 4C90A 5F5WA 2I0MA 2VKJA 1I6ZA 5GV0A 3I9YA 4O3ZA 5L4HA 2YDQA 4HWDA 2LSJA 4LF9T 3UFEA 2XQ5A 5EK4A 4DV2T 2BKNA 3AVSA 3PV0F 4YY3T 2G0UA 4ZOLE 4IIJE 4KUMB 2F1CX 3E22E 4AKGA 3MACA 2QGSA 3UFGA 4DV6T 4GCQA 4UR9A 1SE7A 2W67A 5FXVA 2FJAA 2XSBA 5FVNA 2XAQB 3FBZA 4HFEA 5DL7A 1YS5A 4AXPA 2LFUA 1MMGA 3KDSE 4O4LE 3Q5DA 3AAEB 3UQ4A 4EGWA 2BG9A 2M6IA 4UF0A 2XJ7A 1HNWT 3UUBA 4AFKA 2P9BA 5HEHA 4BJMA 2X51A 2MAWA 3PUXF 4DV7T 4KRAA 2K3WA 3CIRA 2JQQA 4EYUA 5CJ5A 3I0OA 2K9AA 3CQCB 4F6RC 2QA7A 4GK0E 1BR0A 4B3MT 3Q9DA 2JQYA 3RIUC 2ACXA 3LBXB 2D9DA 3A0BO 2EHOD 1VCSA 5LCYA 3OYZA 1THQA 5HEJA 2V7MA 2WAUA 4EOZB 2HH7A 4LSIA 5JDFA 1ZHCA 2BVLA 4HFVA 1ZHYA 3F31A 5IYZE 4D65A 2LE8A 4ADZA 5LHGB 3N5LA 2NTYA 3VZUX 1XDPA 2V7IA 1EZ3A 4QQ1A 1M7KA 2BG9E 4FT6A 3JCFA 4XNLA 5T5FA 2PTFA 2VWAA 1YKHB 5L3DB 3DJBA 3AB3B 3C5OA 4FESA 3KINB 3M65A 4ZS2A 4E7ZA 5C2TA 4AZLA 5LG3A 1BR1A 4DMWA 1D0XA 4IE5A 3PGUA 4DR3T 3CVRA 3G06A 4C4VB 3I1AA 1HTJF 4RJWA 3HKDE 5H2FO 3LK2A 1ZHXA 2OMFA 2CWYA 2ZM8A 4EIWA 2Q9QB 2CRBA 2MHLA 4I50E 2VKHA 1I94T 3IBPA 2X9YA 3QK6A 4AQYT 3UTKA 4P1NA 3RIUA 4AQFA 1UK5A 4HFHA 2A72A 4LF5T 2BS4A 3HKEE 3HI2A 4HGAA 2D5UA 2V6YB 3TLTA 3ZC1A 3EAMA 3Q2MA 4DUYT 3C4ZA 3C4WA 3KBUA 4YJ2E 2DNXA 5JRCB 4JI2T 3PORA 2V6YA 2F1TA 2KDYA 5LGNB 1G8XA 4TWFA 2BS3A 1BXWA 4U2ZA 4PUXA 5AQJB 3SWHA 1QLBA 3O1IA 5CA1E 3RRCA 5KX5E 2WDRA 2W66A 5L3EB 3KV9A 2PJQA 3GN5A 4X1KE 3DTOA 5AQMB 2W61A 3O1HA 3AEDA 4KHZF 4FRXA 4O4UA 3RIAA 3RYCE 5HEOA 5JQGE 3P4PA 2KINB 3N2OA 3MKDA 2J62A 4PK6A 5E0OA 4YHJA 1CHUA 2ZM2A 4X1YE 4QXHB 2PRNA 4O2AE 3EUHA 4NUUA 4QXBB 2PFVA 4TV8E 1LRZA 4QHOA 2O4VA 2NW8A 2E9XD 4Z90A 4YT0A 2VKOA 2X9XA 2YU1A 3R84B 3DP7A 4O8SA 1E7PA 1KNRA 2W4XA 3ZN1B 5H6RB 3AAAB 4H9OC 3TLUA 4FSPA 3PQUA 2V8SV 1HXTA 3VR8A 4O4XA 4NIQA 3KFWX 3E08A 2WU2A 4U72A 4ZZCA 4IDZA 2WBLA 5ADXL 2N2MA 2Y0HA 1OSMA 4QH1A 2XSAA 1W09A 4H63H 3P50A 2UXBT 2BKOA 1T8BA 3UT5E 3DZMA 4IGUA 4L5GA 3UAQA 5C3JA 2E5VA 3QC9A 4LFCT 2L9QA 2H3RA 1BT9A 3LK41 2C5IT 3AECA 5JDMA 2W63A 4G76A 4NXNT 3AE8A 2W00A 3MXZA 3GN5B 3TLVA 3FXEB 3HWBA 4QWNB 5EK2A 4CTDA 5DQWA 4CI3B 3G7GA 2CWOA 1NAFA 3DWNA 3SS1A 3PUGA 1KNZA 5AQQB 3PJAJ 5FNVE 4ISTA 5HCMA 2EHOA 5DL8A 1HNZT 2W2UA 4TN7B 5FY1A 3UQ7A 4ILAA 4AKRB 5JR9B 2XQ3A 5ABGA 3QOFA 2XTRA 1VCTA 3ZEFB 4UV9B 5FY0A 2NW7A 2EHOB 2UU9T 1IZNB 4O4JE 3N2KE 3B57A 3GMIA 2Y7SA 2WMNA 5JR9A 4DV4T 2FBWA 3AAAA 2FUPA 4DV1T 1GFPA 5LXTE 4YXDA 5FP3A 4GYRA 3RGLA 5IYUA 2YNKA 4DBRA 3UPGA 4DR4T 3VR9A 4PFOA 1XDOA 3U3IA 1ZV4X 4MLKA 1MM5A 1T16A 3NSGA 3ZSTA 1V9DA 5AQSB 2N1GA 2XPKA 3GP6A 1KEYA 2XTQA 3CQGB 4YSXA 1WYBA 2F4VT 1GFQA 1MMNA 5FVKA 4H9QC 4ZHQE 1T72A 4HFBA 2JIWA 2JQKA 2KZ7A 3UUMA 3NZQA 5CFBA 1WCRA 3T8OA 1ZHTA 2LOSA 4AI6A 1ZEEA 4FZNA 1WLXA 3OVUA 5EK3A 4YHHT 5KAFO 3N9OA 3ZLIA 2E5LT 2UXDT 4DV3T 4FSOA 1FJGT 2D0UA 4O4HE 5ABFA 3POXA 4IE0A 5D5DA 1H6S1 3T0SA 5JDHA 4UVBB 4UXNB 5AQPB 2WCAA 3LG7A 3SYBA 3OKQA 2C5JA 4YLHA 5EE2A 2FJBA 5G26A 5LHIB 3N9MA 5BR8T 1UUSA 3ZJ1A 4PNIA 3AEFA 4IHJE 3TZGA 2W62A 3VE1A 1KF6A 4E7SA 5AQFB 4F8HA 1WYCA 1FIOA 3CMLA 1MMDA 1NWMX 2KWHA 2WB5A 4GCSA 1OEDA 3ANWB 4HWIB 2UUBT 4FZLA 4ASKA 4LF6T 3AE4A 4DR1T 4JI3T 1OXZA 4FZMA 2WP9A 3FB2A 6PRNA 2KZ7B 4LF7T 2J1NA 3RKOA 1NEKA 3K19A 1HCIA 4I55E 3CKDA 3P8CD 3PUYF 2A2FX 4X65T 3PTRB 4JI7T 2BVMA 1Q9FA 5A1LA 4DUZT 2X9KA 2X9HA 4Z3TA 3KV6A 3ZPOA 4U74A 3MA9A 5PRNA 3AE5A 1U4QA 5KDMC 5JH7E 3KV5A 3LK42 2B1EA 5FXWA 1ZOYA 5HXEA 2R88A 3UU4A 5DL5A 2LM2A 3QRCA 4LSEA 2ZLDA 5JDNA 1BR2A 4YFSA 1XMOT 3M3ZB 2DHRA 2LHNA 1CUNA 3AA1B 3RBHA 4X1IE 3ZMZB 4L9IA 2X68A 3VE2A 5DJQC 3IEEA 2CBIA 4U9CA 3P4RA 2CPTA 2NOXA 3JC6D 3PE0A 4D64A 1D0YA 3J9X1 2XTLA 2NWBA 5L4EA 1Z8UA 5LMUT 4WZXA 4DR5T 2PBIA 4ZS3A 2HPJA 4F4BA 4QXCB 3K3OA 3QB5K 2EHOC 3HOEA 5JDLA 4YTNA 5LGUB 3V8UA 5FKYA 5L3BB 5AQIB 5E79O 4A98A 2XM1A 1VRBA 4DBQA 2V1DB 2ODVA 5ABHA 3ESLA 1W9RA 2WS3A 1WRDA 5HYAA 2LSIA 2UXNB 1IBLT 2FGQX 3N9PA 4C4VA 4LMKA 2K5BB 4XAXB 4X5TA 4H9RC 2UXCT 2W80C 3ZMSB 3RYHE 2X67A 5L3GB 5FL1A 2QYWA 4JI4T 4LF8T 4YSZA 5HXHA 3I0QA 4I0UA 4OYJA 4IL9A 3SOLA 3VZWX 4BJNA 5IHYA 2OV9A 5DQVA 4UEMA 3EDVA 2IW5B 4O2BE 2RP4A 2CBJA 3POQA 3B5MA 3BRYA 1HXUA 1BR4A 1HG2A 5TAOA 1IJ6A 2DLRA 4MFRA 5LOVE 1MNEA 4KHPT 3A7MA 4UIGA 1YXRA 5HWYA 4IL4A 3ZC0A 2XY8B 2WZHA 2JMKA 2AXTO 4EZHA 2XE3A 4L0RA 5FY7A 1PRNA 3I9WA 4JV5T 2VASA 3O4XE 4MBQA 1QJ8A 3FXDB 3CX7B 1HF8A 5HXRA 4GCPA 3NRXA 4HFDA 5G38A 5ABEA 3AE2A 4AISA 2QTKA 4A56A 1D1BA 4LSFA 5F3JA 2I6HA 2DL1A 2KXPB 5CA0E 1XZYA 3ZYLA 2WSSV 2X0HA 3H37A 1X79A 4A5XA 2KT9A 3RYFE 2XAGB 2WJQA 5LP6E 2V6XA 3BRZA 3CK6A 4NPPA 1KNPA 1D0ZA 3BQKA 1ZHWA 2VB6A 2X27X 4AIUA 2WDVA 3VHLA 2HN1A 1P4TA 3SZVA 4BA9A 4B6XA 1LVKA 2WVPA 2CXFA 1N36T 2XQ6A 2BBJA 4ILBA 5FXXA 4C69X 4LF4T 3RIFA 4YTPA 3PDYA 3PUQA 5AQHB 8PRNA 1GQEA 2IWVA 3ZKRA 2H88A 2D0TA 3UULA 1ZKEA 1MIVA 2MNHA 4IDNA 5JDGA 3WAKA 5J2UE 5HWXA 5JR9C 3FZKB 2FGRA 4IDQA 3KVBA 4B3RT 4JI0T 4AKLA 4KMCA 3AEEA 3FZLB 5AQGB 1IBKT 2KC0A 2BS2A 4LMLA 5FXZA 2M07A 3PF1A 5C8YE 4COFA 2XQYA 4AKMA 2GK9A 4GKJT 2XZEA 1S35A 3RF1A 4LFBT 4TZ4C 2ACZA 4O3WA 2ZFGA 2DWGA 4XBFB 2HPLA 4TNWA 2OLTA 2XE1A 2LM9A 3PGSA 2E9XA 2KLQA 4KP3C 3SYSA 2FJEA 4XZCA 2A3DA 3P7IA 1UX5A 3L39A 2OA5A 4FRTA 3HKCE 5B66O 1SHZC 3PU3A 4IDOA 3T1YT 2VQFT 3T24A 3KVDD 3PRNA 1OEDE 2BZBA 4ZI7E 2YKSA 4GK5E 4JCHA 1N32T 2CM0A 5GTIO 4ISSA 4JI6T 2VKDA 3N9QA 4G75A 3VKHA 2M6BA 3FZMB 4WNKA 4HEAA 1HFAA 2CHOA 2YINA 4FJOA 5AQKB 4CXWA 2AE9A 3GWHA 3LDQB 5JDQA 4CI2B 4OFZA 3ZT7A 4GF4A 4RLCA 2R4NA 4CN6A 2CCQA 3ONXA 4G2AA 2QRXA 4N75A 4I43B 2LHFA 3L3PA 3DA3A 4WW0A 4DO0A 3RHWA 2J4UP 1IAPA 2LSYA 4WYVA 4HN9A 2C0SA 1UGOA 4QH5A 2WQYA 3IF8B 4QKNA 4ANJA 1AJ3A 3UU2A 3EMNX 4U2YA 3O9XA 2KXPA 2M67A 5LMNT 2ZM6T 3C4XA 3CWZB 5LB7B 2R6GF 4M1PA 3V5UA 2YDSA 4UVCB 1HNXT 4QX8B 1T98A 3LFMA 4PFPA 3NBXX 5LA6E 2VQET 3AXJB 3FZFB 3POUA 1DU2A 3ABVA 2LKHA 3QNUA 4PK4A 1UX4A 4ZI2D 4DVDA 4TV9E 4KR8A 3AE3A 4AYDC 3O1JA 2HHHT 2H7VC 4JEHB 5AQLB 3LK2B 2Y0KA 1YQ3A 3ETVA 2LSKA 3VZTX 4TX5A 2D2SA 4WBOA 1MPFA 4CN1A 2X0LB 4C91A 4DR2T 3WAJA 2IMLA 4N74A 1HX8A 2LEHA 2MBGA 2XM2A 3RQUA 3C64A 4D5UA 5BMVE 1H7CA 3K3QC 2FJDA 2XQ4A 4CXXA 4JYAT 4U7IA 2R4OA 5KMGP 3S4UA 1WR6A 3CPZA 4G63A 3EI0A 3RPUA 3AA7B 2ODJA 4OX9T 3B13A 4JLEA 2ERVA 1O3XA 2JQ9A 3T20A 3LK3A 1MNDA 3NRYA 4U33A 5FYMA 2W81C 3UU3A 2E9XC 2JRKA 4AKHA 1ZHZA 3QUJA 2IUBA 2X9WA 3WI3A 1J5ET 4FI5A 3SFDA 3AVRA 4LMJA 3PUSA 4P09A 2XMXA 2IIUA 4RL9A 2BBHA 4JBWF 3RRWA 4DIDB 5KAIO 2JQHA 3H3AA 5J2TE 4IDPA 5HAXA 2ODUA 2B76A 4MHCA 3HW9A 5JVDE 4TWHA 1G90A 4ZI2C 1J1JA 1OEDC 3NKZA 2JJ9A 1QUUA 3JADA 2F1VA 2XAFB 4AUIA 3NWIA 5GONE 1UURA 1VOMA 3P4WA 5LJMA 4KX6A 1SA0E 2NR4A 2CMRA 3VU7H 4X62T
chains in the Genus database with same CATH topology
3ZJ2A 2W80C 3ZMSB 4CQIA 2W61A 3RYHE 3O1HA 2X67A 5L3GB 1LVFA 2CA5A 1U5PA 4FRXA 4O4UA 3RYCE 2Q9QA 5LYJE 2I59A 2V7LA 3I0QA 2XAJB 5HXHA 1Z0PA 4PJMA 5JQGE 4ERRA 4OYJA 5L3FB 3SOLA 2W0GA 3IHRA 4BJNA 3VZWX 2KINB 2NP9A 3N2OA 5IHYA 3MKDA 4PK6A 5DQVA 5E0OA 4UEMA 4YHJA 3RX6A 3EDVA 3VY8X 3LJCA 2IW5B 2ZM2A 4X1YE 4UVAB 4QXHB 5M4YA 4O2BE 2RP4A 2L8KA 2PRNA 2CXLA 4H9PC 3EUHA 4JEUB 4O2AE 3POQA 4NUUA 3KBTA 3OBVE 4QXBB 1QSDA 3ZYKA 1HXUA 2PFVA 4TV8E 1BR4A 3HL6A 1HG2A 4K0UA 1LRZA 3JC6C 5TAOA 2V7JA 4QHOA 5CB4E 2O4VA 2NW8A 2Y2XA 4GHBA 2Z6EA 1IJ6A 2DLRA 2E9XD 4KR4A 4MFRA 1S94A 4NUVA 1US7B 5AFUL 2N2LA 3K8PC 2N2NA 4IE6A 5JREA 2VKOA 2X9XA 3SZDA 4PJLA 4PK5A 2J1DG 5LOVE 4UF0B 2YU1A 1D1CA 1MNEA 3R84B 3ZMTB 4O3YA 3DP7A 4O8SA 4UIGA 4AYMC 3N9LA 4H63V 4UV8B 5HWYA 1MMAA 3ZN1B 3ZC0A 3ANWA 3TKLB 5H6RB 3AAAB 3HR0A 5LG4A 2JMKA 4H9OC 4J2CA 5L3CB 4FSPA 3HKBE 3PQUA 1HXTA 4HTEA 3ZMUB 3MK7C 4O4XA 3KFWX 3E08A 4EZHA 1ORMA 2XE3A 3E0ZA 4O49A 4U72A 5DL6A 4L0RA 2JMMA 5FY7A 3UUNA 3AA7A 2E9XB 1PRNA 4IDZA 1G73A 3I9WA 2WBLA 5ADXL 1FMWA 2VASA 3LBXA 3O4XE 4MBQA 1QJ8A 3FXDB 4PAGA 3CX7B 2N2MA 2Y0HA 1HF8A 5HXRA 1OSMA 2CXDA 4GCPA 3KVAA 3ZCJA 3NRXA 1YKEB 1MM4A 4AKIA 3VKGA 3A2SX 1B7TA 4H63H 5F8PA 2YPVA 2MYSA 2CE7A 3MJXA 5JDPA 2IAKA 3UT5E 4DMVA 4RJXA 2DWKA 4Z8XA 5LHHB 1MIWA 4IGUA 4L5GA 3UAQA 2DI4A 2CLYC 3QC9A 2QTKA 4A56A 3FHNA 1D1BA 4LSFA 5F3JA 2L9QA 2K48A 2KXPB 2N9DA 2H3RA 4N78D 5CA0E 1BT9A 4IE7A 4BUMX 4PW8A 3ZYLA 5ETWA 2WSSV 3H37A 1X79A 2KT9A 3LK41 4EAHA 2C5IT 2RA1A 2Y6XA 2XHEB 4DNDA 3RYFE 1OPFA 2XAGB 3K3NA 5JDMA 4JUYA 2V26A 2W63A 1QJPA 4G76A 5LP6E 4ZI3D 2ZMAA 4P0BA 2XE2A 1D0ZA 3BQKA 1ZHWA 2W00A 3MXZA 4BAYB 2VB6A 3GN5B 2X27X 2KNDA 3F2EA 3VHLA 3AAIA 3FXEB 3HWBA 1P4TA 4QWNB 4WBNE 5EK2A 3SZVA 4KBMB 4BA9A 4QX7B 5DQWA 3ZCIA 4CI3B 4FMSA 3JTYA 3CX8B 2YEVC 3G7GA 4AKRA 4B6XA 3OJAA 2CWOA 1LVKA 1NAFA 2CXFA 4E1SA 2MTQA 1HG5A 3SS1A 3PUGA 1KNZA 2Y0LA 4EXTA 5FXXA 2VL8A 4I4TE 5FNVE 4ISTA 1BH3A 4C69X 1GFMA 2EHOA 3PDYA 4H9SE 3PUQA 4UELA 3AAEA 5DABA 5DL8A 2IC6A 8PRNA 4TN7B 4CI1B 3EDUA 2LT3A 5FY1A 3VY9X 3MZKB 2D0TA 4AKRB 5AFUK 5LBQB 1ZKEA 1MIVA 2VK9A 3UULA 4EYYR 2MNHA 5JR9B 5JDGA 3WAKA 4EB6E 5J2UE 5HWXA 4EZ4A 5JR9C 5ADXK 5JRCA 2XTRA 3BK9A 5HXCA 3ZEFB 2YK0A 4UV9B 5FY0A 2FGRA 2LSGA 2NW7A 2EHOB 3ZN0B 3KVBA 1IZNB 3C50A 4O4JE 3FYXA 4ILUA 3N2KE 4PJNA 4AKLA 4KMCA 3B57A 5J1GA 2KC0A 2XE5A 3GMIA 5FXZA 2M07A 3NZPA 2Y7SA 3AA0A 5C8YE 2PORA 4E1TA 3AA6B 2WMNA 2XQYA 5JR9A 3HOLA 4AKMA 2GK9A 4AYNA 5HXSA 4X20E 1S35A 2NW9A 2M06A 3AAAA 7PRNA 4AYEC 4PJJA 3HA4A 4TZ4C 3SY7A 4C90A 4B61A 3D0TA 3RC3A 4AQGA 1D1AA 2VKJA 5LXTE 1GFPA 4O3WA 3PUAA 2ZFGA 5FP3A 1KK7A 2DWGA 4GYRA 5GV0A 3I9YA 4O3ZA 2X66A 4XBFB 2HPLA 1OWAA 2XE1A 5IYUA 2LSJA 2LM9A 2YNKA 4N59A 3AA0B 5LGTB 3UFEA 4TUYE 2E9XA 2KLQA 4DBRA 4KP3C 1QJ9A 3AA6A 3SYSA 3UPGA 4PFOA 5EK4A 4XZCA 3RH3A 2A3DA 3U3IA 3AVSA 1ZV4X 3P7IA 1UX5A 4MLKA 2OA5A 4FRTA 3HKCE 1MM5A 2G0UA 4ZOLE 3NSGA 4IIJE 4KUMB 1SHZC 3OYXA 1V9DA 2DCFA 3PU3A 2N1GA 3E22E 3Q5WA 4AKGA 3GP6A 3MACA 2XTQA 2QGSA 3CQGB 3LK3A 3T24A 2KWIB 1HS7A 2K4TA 3KVDD 3PRNA 4GCQA 1WYBA 2BZBA 5FXVA 1GFQA 1MMNA 2ES0A 2UXXB 4ZI7E 5FVNA 2XAQB 4GK5E 4N58A 3FBZA 4H9QC 3F57A 4ZHQE 4P0AA 5DL7A 1YS5A 4JCHA 4XNKA 2KZ7A 3UUMA 2CM0A 3NZQA 4AXPA 3UUXB 2ZM0A 1MMGA 4H9NC 4ISSA 4OK0A 3T8OA 3KDSE 2LFUA 2VKDA 3N9QA 4O4LE 4AQFC 4G75A 3VKHA 1ZHTA 2LOSA 4AI6A 3AA1A 1ZEEA 4WNKA 1WLXA 3AAEB 3C51A 4FZNA 4HEAA 5L2LA 3RYIE 4UF0A 5EK3A 1HFAA 4AFKA 2P9BA 2XG6A 3L09A 4YJ3E 2YINA 4O4IE 3N9OA 4FJOA 1LKXA 3ZLIA 4CXWA 4BJMA 3GWHA 2CEAA 2X51A 3LK3B 5JDQA 4CI2B 4OFZA 4GF4A 4KRAA 4RLCA 4FSOA 2D0UA 3WI5A 4O4HE 3POXA 2JQQA 4IE0A 5D5DA 1H6S1 2K0LA 3T0SA 4EYUA 5JDHA 2CCQA 4UXNB 2L3LA 3I0OA 4UVBB 3ONXA 3SY9A 2K9AA 3CQCB 3N2GE 3LG7A 4G2AA 4F6RC 2QA7A 3SYBA 3OKQA 2V7KA 4GK0E 4I43B 1BR0A 2LHFA 3L3PA 2C5JA 3DA3A 3Q9DA 4YLHA 4WW0A 4DO0A 5EE2A 2ACXA 3LBXB 5G26A 2J4UP 1IAPA 5LHIB 2LSYA 3N9MA 2EHOD 1PHOA 5LCYA 3OYZA 3ZJ1A 4HN9A 4FOZA 4PNIA 1THQA 4AYID 4IHJE 2C0SA 3TZGA 2W62A 3VE1A 2V7MA 2WAUA 4E7SA 4EOZB 3QRAA 2HH7A 3BQIA 3IF8B 4LSIA 1WYCA 3ZMVB 3ETUA 4QKNA 2Y48B 5JDFA 2XASB 1FIOA 3CMLA 4ANJA 1MMDA 1NWMX 1ZHCA 2KWHA 2BVLA 4HFVA 1AJ3A 3UU2A 4GCSA 1ZHYA 3ANWB 4OHFA 3F31A 1E1HB 2GE4A 3CQXC 5IYZE 2YU2A 3EMNX 1E54A 4D65A 2LE8A 4ADZA 3C98B 5LHGB 2JMHA 2JPFA 3O9XA 3N5LA 4CZZB 4FZLA 1YD8G 2NTYA 2KXPA 3VZUX 2LHRA 2M67A 3GA8A 4ASKA 5LBMA 3C4XA 2V7IA 3SRZA 3CWZB 2NTXA 3V5UA 4M1PA 1EZ3A 4HKAA 1OXZA 3N9NA 4QQ1A 4FZMA 4FT6A 4XNLA 4UVCB 3FB2A 2K24A 6PRNA 4MALA 5T5FA 4QX8B 2KZ7B 1T98A 3LFMA 4PFPA 3RKOA 2J1NA 2VWAA 1YKHB 3NBXX 2Y8DA 5LA6E 5L3DB 3K19A 3DJBA 1HCIA 3POUA 3AB3B 4I55E 1FEWA 1HXXA 3R6NA 3C5OA 4FESA 3CKDA 2WWUA 4GOUA 4PK4A 4LSHA 1UX4A 3KINB 3M65A 3P8CD 4ZI2D 4DVDA 4TV9E 3PU8A 2A2FX 4ZS2A 3O1JA 4E7ZA 2H7VC 4KR8A 2Q9QC 3PTRB 4JEHB 3LK2B 2BVMA 3W15B 3ETVA 2Y0KA 1Q9FA 4AZLA 4GYSA 3RBHA 1BR1A 2LSKA 3Q5XA 5A1LA 3VZTX 2SPCA 2X9HA 4TX5A 4Z3TA 3KV6A 4DMWA 2D2SA 1D0XA 2WMOA 4WBOA 2X0LB 1MPFA 2C5KT 4IE5A 4C91A 3CVRA 4U74A 3MA9A 3ZPOA 3WAJA 5LJNA 5PRNA 1U4QA 1HX8A 2LJLA 2ZLYA 3I1AA 5KDMC 2LEHA 3CX6B 2MBGA 1HTJF 2IC9A 5JH7E 3KV5A 3LK42 4HE8A 3C64A 4RJWA 3HKDE 3J7Yq 2B1EA 5BMVE 3LK2A 4D5UA 1ZHXA 5FXWA 1H7CA 4GIWA 1UCUA 5HXEA 4RLBA 3K3QC 2OMFA 4FUVA 5DL5A 2CWYA 2ZM8A 3QRCA 4LSEA 2ZLDA 4EIWA 3PURA 2Q9QB 4V1Av 5JDNA 1BR2A 4YFSA 1MIYA 3BQLA 2MHLA 2DHRA 3AA1B 1CUNA 2LHNA 4I50E 2VKHA 4X1IE 3IBPA 5FMNA 3ZMZB 4CXXA 5KMGP 1IZNA 4L9IA 3S4UA 2X68A 1WR6A 2X9YA 3CPZA 3VE2A 2CLYB 5DJQC 4G63A 3QK6A 3IEEA 3UTKA 3RPUA 3AA7B 2BDEA 2ODJA 3KV4A 4U9CA 3A5XA 4AQFA 3B13A 4JLEA 2ERVA 2A72A 4AYDC 1O3XA 1Y64B 3T20A 4CXYA 4IE4A 1MNDA 2NOXA 3JC6D 2PG8A 3HI2A 3HKEE 3NRYA 2D5UA 3PE0A 4HGAA 3DA4A 1D0YA 5FYMA 2W81C 2E9XC 4D64A 3J9X1 2JRKA 2XTLA 4AKHA 1ZHZA 3ZC1A 2NWBA 1GFOA 3QUJA 1GFNA 3RC8A 2X9WA 2H7OA 3WI3A 4FI5A 3WI4A 2PBIA 3AVRA 2KMFA 2E8IA 2WM9A 3EVYA 3FBLA 3Q2MA 4ZS3A 2HPJA 3PUSA 1FMVA 4P09A 3C4ZA 2XMXA 3C4WA 3KBUA 4QXCB 4RL9A 4F4BA 1IJ5A 3K3OA 2DNXA 4YJ2E 3V5SA 5JRCB 2EHOC 3HOEA 1Q9GA 3RRWA 5JDLA 3PORA 5LGUB 2XUEA 3H3AA 3V8UA 5J2TE 2F1TA 5HAXA 2KDYA 5LGNB 2ODUA 1G8XA 4MHCA 4O3XB 2XAHB 2LOPA 5L3BB 3HW9A 5JVDE 1G90A 4ZI2C 1BXWA 4OYKA 4PUXA 2Q9QD 4H9RC 2JJ9A 1QUUA 5EZYE 3SWHA 1VRBA 4DBQA 2F1VA 2V1DB 3O1IA 2ODVA 2XAFB 5CA1E 4AUIA 3RRCA 3O0EA 3ESLA 4ZI3C 1WRDA 5KX5E 5HYAA 4JFBA 5GONE 3U78A 2LSIA 2UXNB 1VOMA 3ZYMA 5LJMA 3N9PA 2FGQX 1SA0E 2MOZA 3KV9A 2PJQA 3GN5A 5L3EB 2K5BB 2CMRA 5LNKA 4XAXB 3PQSA 5H6QB 3VU7H 1YW0A 4X1KE 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 1;  2KXP A;  3LK2 B;  1IZN B;  3AA0 B;  3LK3 B;  2KZ7 A;  3AA6 A;  3AA1 B;  3AAE A;  1IZN A;  5AFU L;  3AA0 A;  3AA7 A;  2KZ7 B;  3AA6 B;  5ADX L;  3AA1 A;  3AAE B;  3AA7 B;  4AKR B;  5AFU K;  3AAA A;  3LK4 2;  2KXP B;  3LK2 A;  4AKR A;  5ADX K;  3AAA B;  3LK3 A; 
#chains in the Genus database with same CATH topology
 3UU8 A;  4EEB A;  2CA5 A;  4ZXL A;  5LYJ E;  4U7Y A;  1N34 T;  1Z0P A;  4HWF A;  5L3F B;  1ZP0 A;  3RX6 A;  4NXM T;  4JI5 T;  2CHN A;  2L8K A;  2CXL A;  4H9P C;  4JEU B;  4Q25 A;  3ZYK A;  1QSD A;  3HL6 A;  4K0U A;  1SUM B;  5CB4 E;  2Y2X A;  5AFU L;  2N2L A;  4IE6 A;  5JRE A;  3NVO A;  4PJL A;  2J1D G;  3AE7 A;  3RI5 A;  4UF0 B;  2LRL A;  1D1C A;  4O3Y A;  1WR0 A;  3N9L A;  4H63 V;  4UV8 B;  1S5L O;  2J47 A;  4JI8 T;  5LG4 A;  4J2C A;  5L3C B;  4HTE A;  1ORM A;  2IDO B;  3E0Z A;  4O49 A;  2E9X B;  3VRB A;  2KSR A;  1FMW A;  3ONL C;  3KVA A;  5AQN B;  1YKE B;  1MM4 A;  4AKI A;  3VKG A;  3A2S X;  1IBM T;  3PJA A;  4YTM A;  2MYS A;  3MJX A;  5JDP A;  4HFI A;  4DMV A;  2DWK A;  2XQ9 A;  4Z8X A;  2MPK A;  4JI1 T;  1MIW A;  3FHN A;  2N9D A;  2K48 A;  4BUM X;  4PW8 A;  5ETW A;  3NJT A;  1JNR A;  4EAH A;  2Y6X A;  1W0A A;  3K3N A;  4B3T T;  2V26 A;  4ZI3 D;  4P0B A;  3H3M A;  4DV5 T;  1XMQ T;  3AEG A;  3F2E A;  3VRA A;  4WBN E;  4KBM B;  4FMS A;  3CX8 B;  2YEV C;  2R8A A;  3RQW A;  3FZH B;  1HG5 A;  1GFM A;  4UEL A;  3JAF A;  4K3B A;  5DAB A;  2V5D A;  3EDU A;  2LT3 A;  3VY9 X;  2BKP A;  5LBQ B;  4EYY R;  4EB6 E;  2R4L A;  4HFC A;  5JRC A;  5ADX K;  5HXC A;  2LSG A;  3OPC A;  2LRK A;  3SFE A;  5J1G A;  2XE5 A;  4GKK T;  3NZP A;  5TIS O;  4E1T A;  3AA6 B;  4AYN A;  1HR0 T;  4HWC A;  4EED A;  7PRN A;  2M06 A;  4PJJ A;  3HA4 A;  3D0T A;  3RC3 A;  4AQG A;  1D1A A;  3PUA A;  1KK7 A;  5L47 A;  2X66 A;  1OWA A;  4N59 A;  3AA0 B;  5LGT B;  4TUY E;  3T1H T;  1QJ9 A;  4ILC A;  3AA6 A;  3RH3 A;  3UU5 A;  3JAE A;  1L0V A;  2VUR A;  3OYX A;  2DCF A;  3Q5W A;  2E2A A;  2WZI A;  2KWI B;  2K4T A;  4EV6 A;  2ES0 A;  2UXX B;  4N58 A;  3F57 A;  4P0A A;  5GTH O;  3TLW A;  4XNK A;  4IT4 A;  1HS7 A;  3UUX B;  5FL0 A;  2ZM0 A;  1M62 A;  2YN6 A;  3PUV F;  4H9N C;  4OK0 A;  4AQF C;  3DWO X;  3AA1 A;  4A97 A;  3C51 A;  5L2L A;  3RYI E;  2LLY A;  3BS0 A;  4IRE A;  3OTO T;  2XG6 A;  3L09 A;  4YJ3 E;  5J0Z A;  4O4I E;  1LKX A;  3AE6 A;  2AXD S;  2CEA A;  3LK3 B;  2WJR A;  1N33 T;  3WI5 A;  1X9B A;  2WU5 A;  2K0L A;  2L3L A;  3PGR A;  2UUA T;  3N2G E;  3SY9 A;  4Z91 A;  2V7K A;  3P4Q A;  3JCU O;  5B5E O;  4DR7 T;  1PHO A;  2VVS A;  3PUW F;  4FOZ A;  4AYI D;  2QVA A;  2WY2 A;  3QRA A;  3BQI A;  3ZMV B;  3ETU A;  2Y48 B;  2XAS B;  1XNR T;  5AQU B;  4OHF A;  1E1H B;  2GE4 A;  3CQX C;  2YU2 A;  1E54 A;  4PJ0 O;  3C98 B;  2H89 A;  2JMH A;  2JPF A;  2IWW A;  2VL0 A;  4CZZ B;  3ZT6 A;  1YD8 G;  4X64 T;  2LHR A;  3GA8 A;  5LBM A;  3SRZ A;  3WU2 O;  2NTX A;  4HKA A;  3N9N A;  1KFY A;  4ZEY A;  2K24 A;  5G39 A;  4MAL A;  4LFA T;  4K3C A;  2Y8D A;  2IHR 1;  1HXX A;  1FEW A;  4LSH A;  3R6N A;  4K0K T;  2WWU A;  4GOU A;  4UB6 O;  1W0B A;  3PU8 A;  2Q9Q C;  2R4P A;  3W15 B;  4GYS A;  3Q5X A;  2SPC A;  2WMO A;  2C5K T;  2A9U A;  5LJN A;  2LJL A;  2ZLY A;  3CX6 B;  1NEN A;  2IC9 A;  4HE8 A;  3J7Y q;  4GIW A;  1UCU A;  4RLB A;  4FUV A;  4DR6 T;  3PUR A;  4V1A v;  3EAB A;  1MIY A;  5HEG A;  3BQL A;  5FMN A;  2VVN A;  1IZN A;  3L8R A;  2CLY B;  2BDE A;  3ZT5 A;  3KV4 A;  1WFD A;  3A5X A;  4CN4 A;  1Y64 B;  4CXY A;  4IE4 A;  3A8Y C;  2PG8 A;  3DA4 A;  4PR7 A;  1GFO A;  1YQ4 A;  3RC8 A;  1GFN A;  2H7O A;  3WI4 A;  3TLS A;  2KMF A;  2E8I A;  2WM9 A;  3EVY A;  3FBL A;  4B3S T;  1FMV A;  1IJ5 A;  3V5S A;  1Q9G A;  2XUE A;  3PUZ F;  4O3X B;  5IUX A;  2XAH B;  2LOP A;  2WDQ A;  3IA3 A;  4OYK A;  2Q9Q D;  5EZY E;  4YSY A;  3O0E A;  4ZI3 C;  4JFB A;  3U78 A;  1E2A A;  1J5W A;  5HEU A;  3ZYM A;  2MOZ A;  5LNK A;  3PQS A;  5H6Q B;  5G3A A;  3X1D A;  1YW0 A;  3K1S A;  3ZJ2 A;  4CQI A;  2WWV A;  3EHZ A;  2LKG A;  1LVF A;  1U5P A;  2Q9Q A;  2I59 A;  1T1L A;  2V7L A;  4U3C A;  2XAJ B;  4PJM A;  4ERR A;  4DV0 T;  1HX1 B;  2W0G A;  3IHR A;  2NP9 A;  1Y01 A;  3VY8 X;  3LJC A;  2YDR A;  4UVA B;  5AQO B;  5M4Y A;  3KBT A;  3AEA A;  3OBV E;  3JC6 C;  4KI0 F;  2V7J A;  3ZSS A;  4GHB A;  2Z6E A;  4KR4 A;  1S94 A;  4NUV A;  1US7 B;  3K8P C;  2N2N A;  3SZD A;  4PK5 A;  1XWM A;  5IWA T;  3ZMT B;  4TWD A;  4AYM C;  2XQ7 A;  1MMA A;  1OED B;  3ANW A;  2HN2 A;  3TKL B;  3HR0 A;  3HKB E;  3ZMU B;  5FVL A;  1JNZ A;  3MK7 C;  1R8I A;  5DL6 A;  3A0H O;  2JMM A;  3UUN A;  3AA7 A;  1G73 A;  3LBX A;  4PAG A;  2X0Y A;  5AQV B;  5AQR B;  2CXD A;  4FQE A;  5HCJ A;  3ZCJ A;  4U31 A;  1B7T A;  5F8P A;  2YPV A;  4TNV A;  2CE7 A;  2IAK A;  3AE9 A;  4RJX A;  1XNQ T;  5LHH B;  5CGM A;  2DI4 A;  1T7S A;  2CLY C;  3Q5E A;  3KZI O;  4N78 D;  4IE7 A;  2BG9 B;  2RA1 A;  2XHE B;  4DND A;  5JTG A;  1OPF A;  4X66 T;  4JUY A;  3P4S A;  1QJP A;  2ZMA A;  2XE2 A;  3AXJ A;  3AEB A;  4BAY B;  2RPA A;  3AE1 A;  2KND A;  3AAI A;  4C00 A;  4QX7 B;  5KXJ A;  3ZCI A;  4AKR A;  3JTY A;  3OJA A;  4E1S A;  2MTQ A;  2Y0L A;  4EXT A;  4HWH A;  2VL8 A;  4I4T E;  1BH3 A;  4H9S E;  3AAE A;  3ONJ A;  2IC6 A;  2XQ8 A;  5AQT B;  3RLF F;  3RKG A;  4CI1 B;  4ZZB A;  3MZK B;  3LSV A;  5AFU K;  2VK9 A;  3UU6 A;  3QB5 A;  2V5C A;  4QH4 A;  4EZ4 A;  3BK9 A;  2YK0 A;  4IL6 O;  4UB8 O;  3ZN0 B;  3C50 A;  3FYX A;  4ILU A;  2YOE A;  4PJN A;  5ABF B;  2UUC T;  3AA0 A;  2POR A;  2XQA A;  2BG9 C;  3HOL A;  2J4G A;  5HXS A;  4X20 E;  2R89 A;  2NW9 A;  4AYE C;  4B61 A;  3SY7 A;  4C90 A;  5F5W A;  2I0M A;  2VKJ A;  1I6Z A;  5GV0 A;  3I9Y A;  4O3Z A;  5L4H A;  2YDQ A;  4HWD A;  2LSJ A;  4LF9 T;  3UFE A;  2XQ5 A;  5EK4 A;  4DV2 T;  2BKN A;  3AVS A;  3PV0 F;  4YY3 T;  2G0U A;  4ZOL E;  4IIJ E;  4KUM B;  2F1C X;  3E22 E;  4AKG A;  3MAC A;  2QGS A;  3UFG A;  4DV6 T;  4GCQ A;  4UR9 A;  1SE7 A;  2W67 A;  5FXV A;  2FJA A;  2XSB A;  5FVN A;  2XAQ B;  3FBZ A;  4HFE A;  5DL7 A;  1YS5 A;  4AXP A;  2LFU A;  1MMG A;  3KDS E;  4O4L E;  3Q5D A;  3AAE B;  3UQ4 A;  4EGW A;  2BG9 A;  2M6I A;  4UF0 A;  2XJ7 A;  1HNW T;  3UUB A;  4AFK A;  2P9B A;  5HEH A;  4BJM A;  2X51 A;  2MAW A;  3PUX F;  4DV7 T;  4KRA A;  2K3W A;  3CIR A;  2JQQ A;  4EYU A;  5CJ5 A;  3I0O A;  2K9A A;  3CQC B;  4F6R C;  2QA7 A;  4GK0 E;  1BR0 A;  4B3M T;  3Q9D A;  2JQY A;  3RIU C;  2ACX A;  3LBX B;  2D9D A;  3A0B O;  2EHO D;  1VCS A;  5LCY A;  3OYZ A;  1THQ A;  5HEJ A;  2V7M A;  2WAU A;  4EOZ B;  2HH7 A;  4LSI A;  5JDF A;  1ZHC A;  2BVL A;  4HFV A;  1ZHY A;  3F31 A;  5IYZ E;  4D65 A;  2LE8 A;  4ADZ A;  5LHG B;  3N5L A;  2NTY A;  3VZU X;  1XDP A;  2V7I A;  1EZ3 A;  4QQ1 A;  1M7K A;  2BG9 E;  4FT6 A;  3JCF A;  4XNL A;  5T5F A;  2PTF A;  2VWA A;  1YKH B;  5L3D B;  3DJB A;  3AB3 B;  3C5O A;  4FES A;  3KIN B;  3M65 A;  4ZS2 A;  4E7Z A;  5C2T A;  4AZL A;  5LG3 A;  1BR1 A;  4DMW A;  1D0X A;  4IE5 A;  3PGU A;  4DR3 T;  3CVR A;  3G06 A;  4C4V B;  3I1A A;  1HTJ F;  4RJW A;  3HKD E;  5H2F O;  3LK2 A;  1ZHX A;  2OMF A;  2CWY A;  2ZM8 A;  4EIW A;  2Q9Q B;  2CRB A;  2MHL A;  4I50 E;  2VKH A;  1I94 T;  3IBP A;  2X9Y A;  3QK6 A;  4AQY T;  3UTK A;  4P1N A;  3RIU A;  4AQF A;  1UK5 A;  4HFH A;  2A72 A;  4LF5 T;  2BS4 A;  3HKE E;  3HI2 A;  4HGA A;  2D5U A;  2V6Y B;  3TLT A;  3ZC1 A;  3EAM A;  3Q2M A;  4DUY T;  3C4Z A;  3C4W A;  3KBU A;  4YJ2 E;  2DNX A;  5JRC B;  4JI2 T;  3POR A;  2V6Y A;  2F1T A;  2KDY A;  5LGN B;  1G8X A;  4TWF A;  2BS3 A;  1BXW A;  4U2Z A;  4PUX A;  5AQJ B;  3SWH A;  1QLB A;  3O1I A;  5CA1 E;  3RRC A;  5KX5 E;  2WDR A;  2W66 A;  5L3E B;  3KV9 A;  2PJQ A;  3GN5 A;  4X1K E;  3DTO A;  5AQM B;  2W61 A;  3O1H A;  3AED A;  4KHZ F;  4FRX A;  4O4U A;  3RIA A;  3RYC E;  5HEO A;  5JQG E;  3P4P A;  2KIN B;  3N2O A;  3MKD A;  2J62 A;  4PK6 A;  5E0O A;  4YHJ A;  1CHU A;  2ZM2 A;  4X1Y E;  4QXH B;  2PRN A;  4O2A E;  3EUH A;  4NUU A;  4QXB B;  2PFV A;  4TV8 E;  1LRZ A;  4QHO A;  2O4V A;  2NW8 A;  2E9X D;  4Z90 A;  4YT0 A;  2VKO A;  2X9X A;  2YU1 A;  3R84 B;  3DP7 A;  4O8S A;  1E7P A;  1KNR A;  2W4X A;  3ZN1 B;  5H6R B;  3AAA B;  4H9O C;  3TLU A;  4FSP A;  3PQU A;  2V8S V;  1HXT A;  3VR8 A;  4O4X A;  4NIQ A;  3KFW X;  3E08 A;  2WU2 A;  4U72 A;  4ZZC A;  4IDZ A;  2WBL A;  5ADX L;  2N2M A;  2Y0H A;  1OSM A;  4QH1 A;  2XSA A;  1W09 A;  4H63 H;  3P50 A;  2UXB T;  2BKO A;  1T8B A;  3UT5 E;  3DZM A;  4IGU A;  4L5G A;  3UAQ A;  5C3J A;  2E5V A;  3QC9 A;  4LFC T;  2L9Q A;  2H3R A;  1BT9 A;  3LK4 1;  2C5I T;  3AEC A;  5JDM A;  2W63 A;  4G76 A;  4NXN T;  3AE8 A;  2W00 A;  3MXZ A;  3GN5 B;  3TLV A;  3FXE B;  3HWB A;  4QWN B;  5EK2 A;  4CTD A;  5DQW A;  4CI3 B;  3G7G A;  2CWO A;  1NAF A;  3DWN A;  3SS1 A;  3PUG A;  1KNZ A;  5AQQ B;  3PJA J;  5FNV E;  4IST A;  5HCM A;  2EHO A;  5DL8 A;  1HNZ T;  2W2U A;  4TN7 B;  5FY1 A;  3UQ7 A;  4ILA A;  4AKR B;  5JR9 B;  2XQ3 A;  5ABG A;  3QOF A;  2XTR A;  1VCT A;  3ZEF B;  4UV9 B;  5FY0 A;  2NW7 A;  2EHO B;  2UU9 T;  1IZN B;  4O4J E;  3N2K E;  3B57 A;  3GMI A;  2Y7S A;  2WMN A;  5JR9 A;  4DV4 T;  2FBW A;  3AAA A;  2FUP A;  4DV1 T;  1GFP A;  5LXT E;  4YXD A;  5FP3 A;  4GYR A;  3RGL A;  5IYU A;  2YNK A;  4DBR A;  3UPG A;  4DR4 T;  3VR9 A;  4PFO A;  1XDO A;  3U3I A;  1ZV4 X;  4MLK A;  1MM5 A;  1T16 A;  3NSG A;  3ZST A;  1V9D A;  5AQS B;  2N1G A;  2XPK A;  3GP6 A;  1KEY A;  2XTQ A;  3CQG B;  4YSX A;  1WYB A;  2F4V T;  1GFQ A;  1MMN A;  5FVK A;  4H9Q C;  4ZHQ E;  1T72 A;  4HFB A;  2JIW A;  2JQK A;  2KZ7 A;  3UUM A;  3NZQ A;  5CFB A;  1WCR A;  3T8O A;  1ZHT A;  2LOS A;  4AI6 A;  1ZEE A;  4FZN A;  1WLX A;  3OVU A;  5EK3 A;  4YHH T;  5KAF O;  3N9O A;  3ZLI A;  2E5L T;  2UXD T;  4DV3 T;  4FSO A;  1FJG T;  2D0U A;  4O4H E;  5ABF A;  3POX A;  4IE0 A;  5D5D A;  1H6S 1;  3T0S A;  5JDH A;  4UVB B;  4UXN B;  5AQP B;  2WCA A;  3LG7 A;  3SYB A;  3OKQ A;  2C5J A;  4YLH A;  5EE2 A;  2FJB A;  5G26 A;  5LHI B;  3N9M A;  5BR8 T;  1UUS A;  3ZJ1 A;  4PNI A;  3AEF A;  4IHJ E;  3TZG A;  2W62 A;  3VE1 A;  1KF6 A;  4E7S A;  5AQF B;  4F8H A;  1WYC A;  1FIO A;  3CML A;  1MMD A;  1NWM X;  2KWH A;  2WB5 A;  4GCS A;  1OED A;  3ANW B;  4HWI B;  2UUB T;  4FZL A;  4ASK A;  4LF6 T;  3AE4 A;  4DR1 T;  4JI3 T;  1OXZ A;  4FZM A;  2WP9 A;  3FB2 A;  6PRN A;  2KZ7 B;  4LF7 T;  2J1N A;  3RKO A;  1NEK A;  3K19 A;  1HCI A;  4I55 E;  3CKD A;  3P8C D;  3PUY F;  2A2F X;  4X65 T;  3PTR B;  4JI7 T;  2BVM A;  1Q9F A;  5A1L A;  4DUZ T;  2X9K A;  2X9H A;  4Z3T A;  3KV6 A;  3ZPO A;  4U74 A;  3MA9 A;  5PRN A;  3AE5 A;  1U4Q A;  5KDM C;  5JH7 E;  3KV5 A;  3LK4 2;  2B1E A;  5FXW A;  1ZOY A;  5HXE A;  2R88 A;  3UU4 A;  5DL5 A;  2LM2 A;  3QRC A;  4LSE A;  2ZLD A;  5JDN A;  1BR2 A;  4YFS A;  1XMO T;  3M3Z B;  2DHR A;  2LHN A;  1CUN A;  3AA1 B;  3RBH A;  4X1I E;  3ZMZ B;  4L9I A;  2X68 A;  3VE2 A;  5DJQ C;  3IEE A;  2CBI A;  4U9C A;  3P4R A;  2CPT A;  2NOX A;  3JC6 D;  3PE0 A;  4D64 A;  1D0Y A;  3J9X 1;  2XTL A;  2NWB A;  5L4E A;  1Z8U A;  5LMU T;  4WZX A;  4DR5 T;  2PBI A;  4ZS3 A;  2HPJ A;  4F4B A;  4QXC B;  3K3O A;  3QB5 K;  2EHO C;  3HOE A;  5JDL A;  4YTN A;  5LGU B;  3V8U A;  5FKY A;  5L3B B;  5AQI B;  5E79 O;  4A98 A;  2XM1 A;  1VRB A;  4DBQ A;  2V1D B;  2ODV A;  5ABH A;  3ESL A;  1W9R A;  2WS3 A;  1WRD A;  5HYA A;  2LSI A;  2UXN B;  1IBL T;  2FGQ X;  3N9P A;  4C4V A;  4LMK A;  2K5B B;  4XAX B;  4X5T A;  4H9R C;  2UXC T;  2W80 C;  3ZMS B;  3RYH E;  2X67 A;  5L3G B;  5FL1 A;  2QYW A;  4JI4 T;  4LF8 T;  4YSZ A;  5HXH A;  3I0Q A;  4I0U A;  4OYJ A;  4IL9 A;  3SOL A;  3VZW X;  4BJN A;  5IHY A;  2OV9 A;  5DQV A;  4UEM A;  3EDV A;  2IW5 B;  4O2B E;  2RP4 A;  2CBJ A;  3POQ A;  3B5M A;  3BRY A;  1HXU A;  1BR4 A;  1HG2 A;  5TAO A;  1IJ6 A;  2DLR A;  4MFR A;  5LOV E;  1MNE A;  4KHP T;  3A7M A;  4UIG A;  1YXR A;  5HWY A;  4IL4 A;  3ZC0 A;  2XY8 B;  2WZH A;  2JMK A;  2AXT O;  4EZH A;  2XE3 A;  4L0R A;  5FY7 A;  1PRN A;  3I9W A;  4JV5 T;  2VAS A;  3O4X E;  4MBQ A;  1QJ8 A;  3FXD B;  3CX7 B;  1HF8 A;  5HXR A;  4GCP A;  3NRX A;  4HFD A;  5G38 A;  5ABE A;  3AE2 A;  4AIS A;  2QTK A;  4A56 A;  1D1B A;  4LSF A;  5F3J A;  2I6H A;  2DL1 A;  2KXP B;  5CA0 E;  1XZY A;  3ZYL A;  2WSS V;  2X0H A;  3H37 A;  1X79 A;  4A5X A;  2KT9 A;  3RYF E;  2XAG B;  2WJQ A;  5LP6 E;  2V6X A;  3BRZ A;  3CK6 A;  4NPP A;  1KNP A;  1D0Z A;  3BQK A;  1ZHW A;  2VB6 A;  2X27 X;  4AIU A;  2WDV A;  3VHL A;  2HN1 A;  1P4T A;  3SZV A;  4BA9 A;  4B6X A;  1LVK A;  2WVP A;  2CXF A;  1N36 T;  2XQ6 A;  2BBJ A;  4ILB A;  5FXX A;  4C69 X;  4LF4 T;  3RIF A;  4YTP A;  3PDY A;  3PUQ A;  5AQH B;  8PRN A;  1GQE A;  2IWV A;  3ZKR A;  2H88 A;  2D0T A;  3UUL A;  1ZKE A;  1MIV A;  2MNH A;  4IDN A;  5JDG A;  3WAK A;  5J2U E;  5HWX A;  5JR9 C;  3FZK B;  2FGR A;  4IDQ A;  3KVB A;  4B3R T;  4JI0 T;  4AKL A;  4KMC A;  3AEE A;  3FZL B;  5AQG B;  1IBK T;  2KC0 A;  2BS2 A;  4LML A;  5FXZ A;  2M07 A;  3PF1 A;  5C8Y E;  4COF A;  2XQY A;  4AKM A;  2GK9 A;  4GKJ T;  2XZE A;  1S35 A;  3RF1 A;  4LFB T;  4TZ4 C;  2ACZ A;  4O3W A;  2ZFG A;  2DWG A;  4XBF B;  2HPL A;  4TNW A;  2OLT A;  2XE1 A;  2LM9 A;  3PGS A;  2E9X A;  2KLQ A;  4KP3 C;  3SYS A;  2FJE A;  4XZC A;  2A3D A;  3P7I A;  1UX5 A;  3L39 A;  2OA5 A;  4FRT A;  3HKC E;  5B66 O;  1SHZ C;  3PU3 A;  4IDO A;  3T1Y T;  2VQF T;  3T24 A;  3KVD D;  3PRN A;  1OED E;  2BZB A;  4ZI7 E;  2YKS A;  4GK5 E;  4JCH A;  1N32 T;  2CM0 A;  5GTI O;  4ISS A;  4JI6 T;  2VKD A;  3N9Q A;  4G75 A;  3VKH A;  2M6B A;  3FZM B;  4WNK A;  4HEA A;  1HFA A;  2CHO A;  2YIN A;  4FJO A;  5AQK B;  4CXW A;  2AE9 A;  3GWH A;  3LDQ B;  5JDQ A;  4CI2 B;  4OFZ A;  3ZT7 A;  4GF4 A;  4RLC A;  2R4N A;  4CN6 A;  2CCQ A;  3ONX A;  4G2A A;  2QRX A;  4N75 A;  4I43 B;  2LHF A;  3L3P A;  3DA3 A;  4WW0 A;  4DO0 A;  3RHW A;  2J4U P;  1IAP A;  2LSY A;  4WYV A;  4HN9 A;  2C0S A;  1UGO A;  4QH5 A;  2WQY A;  3IF8 B;  4QKN A;  4ANJ A;  1AJ3 A;  3UU2 A;  3EMN X;  4U2Y A;  3O9X A;  2KXP A;  2M67 A;  5LMN T;  2ZM6 T;  3C4X A;  3CWZ B;  5LB7 B;  2R6G F;  4M1P A;  3V5U A;  2YDS A;  4UVC B;  1HNX T;  4QX8 B;  1T98 A;  3LFM A;  4PFP A;  3NBX X;  5LA6 E;  2VQE T;  3AXJ B;  3FZF B;  3POU A;  1DU2 A;  3ABV A;  2LKH A;  3QNU A;  4PK4 A;  1UX4 A;  4ZI2 D;  4DVD A;  4TV9 E;  4KR8 A;  3AE3 A;  4AYD C;  3O1J A;  2HHH T;  2H7V C;  4JEH B;  5AQL B;  3LK2 B;  2Y0K A;  1YQ3 A;  3ETV A;  2LSK A;  3VZT X;  4TX5 A;  2D2S A;  4WBO A;  1MPF A;  4CN1 A;  2X0L B;  4C91 A;  4DR2 T;  3WAJ A;  2IML A;  4N74 A;  1HX8 A;  2LEH A;  2MBG A;  2XM2 A;  3RQU A;  3C64 A;  4D5U A;  5BMV E;  1H7C A;  3K3Q C;  2FJD A;  2XQ4 A;  4CXX A;  4JYA T;  4U7I A;  2R4O A;  5KMG P;  3S4U A;  1WR6 A;  3CPZ A;  4G63 A;  3EI0 A;  3RPU A;  3AA7 B;  2ODJ A;  4OX9 T;  3B13 A;  4JLE A;  2ERV A;  1O3X A;  2JQ9 A;  3T20 A;  3LK3 A;  1MND A;  3NRY A;  4U33 A;  5FYM A;  2W81 C;  3UU3 A;  2E9X C;  2JRK A;  4AKH A;  1ZHZ A;  3QUJ A;  2IUB A;  2X9W A;  3WI3 A;  1J5E T;  4FI5 A;  3SFD A;  3AVR A;  4LMJ A;  3PUS A;  4P09 A;  2XMX A;  2IIU A;  4RL9 A;  2BBH A;  4JBW F;  3RRW A;  4DID B;  5KAI O;  2JQH A;  3H3A A;  5J2T E;  4IDP A;  5HAX A;  2ODU A;  2B76 A;  4MHC A;  3HW9 A;  5JVD E;  4TWH A;  1G90 A;  4ZI2 C;  1J1J A;  1OED C;  3NKZ A;  2JJ9 A;  1QUU A;  3JAD A;  2F1V A;  2XAF B;  4AUI A;  3NWI A;  5GON E;  1UUR A;  1VOM A;  3P4W A;  5LJM A;  4KX6 A;  1SA0 E;  2NR4 A;  2CMR A;  3VU7 H;  4X62 T; 
#chains in the Genus database with same CATH homology
 3ZJ2 A;  2W80 C;  3ZMS B;  4CQI A;  2W61 A;  3RYH E;  3O1H A;  2X67 A;  5L3G B;  1LVF A;  2CA5 A;  1U5P A;  4FRX A;  4O4U A;  3RYC E;  2Q9Q A;  5LYJ E;  2I59 A;  2V7L A;  3I0Q A;  2XAJ B;  5HXH A;  1Z0P A;  4PJM A;  5JQG E;  4ERR A;  4OYJ A;  5L3F B;  3SOL A;  2W0G A;  3IHR A;  4BJN A;  3VZW X;  2KIN B;  2NP9 A;  3N2O A;  5IHY A;  3MKD A;  4PK6 A;  5DQV A;  5E0O A;  4UEM A;  4YHJ A;  3RX6 A;  3EDV A;  3VY8 X;  3LJC A;  2IW5 B;  2ZM2 A;  4X1Y E;  4UVA B;  4QXH B;  5M4Y A;  4O2B E;  2RP4 A;  2L8K A;  2PRN A;  2CXL A;  4H9P C;  3EUH A;  4JEU B;  4O2A E;  3POQ A;  4NUU A;  3KBT A;  3OBV E;  4QXB B;  1QSD A;  3ZYK A;  1HXU A;  2PFV A;  4TV8 E;  1BR4 A;  3HL6 A;  1HG2 A;  4K0U A;  1LRZ A;  3JC6 C;  5TAO A;  2V7J A;  4QHO A;  5CB4 E;  2O4V A;  2NW8 A;  2Y2X A;  4GHB A;  2Z6E A;  1IJ6 A;  2DLR A;  2E9X D;  4KR4 A;  4MFR A;  1S94 A;  4NUV A;  1US7 B;  5AFU L;  2N2L A;  3K8P C;  2N2N A;  4IE6 A;  5JRE A;  2VKO A;  2X9X A;  3SZD A;  4PJL A;  4PK5 A;  2J1D G;  5LOV E;  4UF0 B;  2YU1 A;  1D1C A;  1MNE A;  3R84 B;  3ZMT B;  4O3Y A;  3DP7 A;  4O8S A;  4UIG A;  4AYM C;  3N9L A;  4H63 V;  4UV8 B;  5HWY A;  1MMA A;  3ZN1 B;  3ZC0 A;  3ANW A;  3TKL B;  5H6R B;  3AAA B;  3HR0 A;  5LG4 A;  2JMK A;  4H9O C;  4J2C A;  5L3C B;  4FSP A;  3HKB E;  3PQU A;  1HXT A;  4HTE A;  3ZMU B;  3MK7 C;  4O4X A;  3KFW X;  3E08 A;  4EZH A;  1ORM A;  2XE3 A;  3E0Z A;  4O49 A;  4U72 A;  5DL6 A;  4L0R A;  2JMM A;  5FY7 A;  3UUN A;  3AA7 A;  2E9X B;  1PRN A;  4IDZ A;  1G73 A;  3I9W A;  2WBL A;  5ADX L;  1FMW A;  2VAS A;  3LBX A;  3O4X E;  4MBQ A;  1QJ8 A;  3FXD B;  4PAG A;  3CX7 B;  2N2M A;  2Y0H A;  1HF8 A;  5HXR A;  1OSM A;  2CXD A;  4GCP A;  3KVA A;  3ZCJ A;  3NRX A;  1YKE B;  1MM4 A;  4AKI A;  3VKG A;  3A2S X;  1B7T A;  4H63 H;  5F8P A;  2YPV A;  2MYS A;  2CE7 A;  3MJX A;  5JDP A;  2IAK A;  3UT5 E;  4DMV A;  4RJX A;  2DWK A;  4Z8X A;  5LHH B;  1MIW A;  4IGU A;  4L5G A;  3UAQ A;  2DI4 A;  2CLY C;  3QC9 A;  2QTK A;  4A56 A;  3FHN A;  1D1B A;  4LSF A;  5F3J A;  2L9Q A;  2K48 A;  2KXP B;  2N9D A;  2H3R A;  4N78 D;  5CA0 E;  1BT9 A;  4IE7 A;  4BUM X;  4PW8 A;  3ZYL A;  5ETW A;  2WSS V;  3H37 A;  1X79 A;  2KT9 A;  3LK4 1;  4EAH A;  2C5I T;  2RA1 A;  2Y6X A;  2XHE B;  4DND A;  3RYF E;  1OPF A;  2XAG B;  3K3N A;  5JDM A;  4JUY A;  2V26 A;  2W63 A;  1QJP A;  4G76 A;  5LP6 E;  4ZI3 D;  2ZMA A;  4P0B A;  2XE2 A;  1D0Z A;  3BQK A;  1ZHW A;  2W00 A;  3MXZ A;  4BAY B;  2VB6 A;  3GN5 B;  2X27 X;  2KND A;  3F2E A;  3VHL A;  3AAI A;  3FXE B;  3HWB A;  1P4T A;  4QWN B;  4WBN E;  5EK2 A;  3SZV A;  4KBM B;  4BA9 A;  4QX7 B;  5DQW A;  3ZCI A;  4CI3 B;  4FMS A;  3JTY A;  3CX8 B;  2YEV C;  3G7G A;  4AKR A;  4B6X A;  3OJA A;  2CWO A;  1LVK A;  1NAF A;  2CXF A;  4E1S A;  2MTQ A;  1HG5 A;  3SS1 A;  3PUG A;  1KNZ A;  2Y0L A;  4EXT A;  5FXX A;  2VL8 A;  4I4T E;  5FNV E;  4IST A;  1BH3 A;  4C69 X;  1GFM A;  2EHO A;  3PDY A;  4H9S E;  3PUQ A;  4UEL A;  3AAE A;  5DAB A;  5DL8 A;  2IC6 A;  8PRN A;  4TN7 B;  4CI1 B;  3EDU A;  2LT3 A;  5FY1 A;  3VY9 X;  3MZK B;  2D0T A;  4AKR B;  5AFU K;  5LBQ B;  1ZKE A;  1MIV A;  2VK9 A;  3UUL A;  4EYY R;  2MNH A;  5JR9 B;  5JDG A;  3WAK A;  4EB6 E;  5J2U E;  5HWX A;  4EZ4 A;  5JR9 C;  5ADX K;  5JRC A;  2XTR A;  3BK9 A;  5HXC A;  3ZEF B;  2YK0 A;  4UV9 B;  5FY0 A;  2FGR A;  2LSG A;  2NW7 A;  2EHO B;  3ZN0 B;  3KVB A;  1IZN B;  3C50 A;  4O4J E;  3FYX A;  4ILU A;  3N2K E;  4PJN A;  4AKL A;  4KMC A;  3B57 A;  5J1G A;  2KC0 A;  2XE5 A;  3GMI A;  5FXZ A;  2M07 A;  3NZP A;  2Y7S A;  3AA0 A;  5C8Y E;  2POR A;  4E1T A;  3AA6 B;  2WMN A;  2XQY A;  5JR9 A;  3HOL A;  4AKM A;  2GK9 A;  4AYN A;  5HXS A;  4X20 E;  1S35 A;  2NW9 A;  2M06 A;  3AAA A;  7PRN A;  4AYE C;  4PJJ A;  3HA4 A;  4TZ4 C;  3SY7 A;  4C90 A;  4B61 A;  3D0T A;  3RC3 A;  4AQG A;  1D1A A;  2VKJ A;  5LXT E;  1GFP A;  4O3W A;  3PUA A;  2ZFG A;  5FP3 A;  1KK7 A;  2DWG A;  4GYR A;  5GV0 A;  3I9Y A;  4O3Z A;  2X66 A;  4XBF B;  2HPL A;  1OWA A;  2XE1 A;  5IYU A;  2LSJ A;  2LM9 A;  2YNK A;  4N59 A;  3AA0 B;  5LGT B;  3UFE A;  4TUY E;  2E9X A;  2KLQ A;  4DBR A;  4KP3 C;  1QJ9 A;  3AA6 A;  3SYS A;  3UPG A;  4PFO A;  5EK4 A;  4XZC A;  3RH3 A;  2A3D A;  3U3I A;  3AVS A;  1ZV4 X;  3P7I A;  1UX5 A;  4MLK A;  2OA5 A;  4FRT A;  3HKC E;  1MM5 A;  2G0U A;  4ZOL E;  3NSG A;  4IIJ E;  4KUM B;  1SHZ C;  3OYX A;  1V9D A;  2DCF A;  3PU3 A;  2N1G A;  3E22 E;  3Q5W A;  4AKG A;  3GP6 A;  3MAC A;  2XTQ A;  2QGS A;  3CQG B;  3LK3 A;  3T24 A;  2KWI B;  1HS7 A;  2K4T A;  3KVD D;  3PRN A;  4GCQ A;  1WYB A;  2BZB A;  5FXV A;  1GFQ A;  1MMN A;  2ES0 A;  2UXX B;  4ZI7 E;  5FVN A;  2XAQ B;  4GK5 E;  4N58 A;  3FBZ A;  4H9Q C;  3F57 A;  4ZHQ E;  4P0A A;  5DL7 A;  1YS5 A;  4JCH A;  4XNK A;  2KZ7 A;  3UUM A;  2CM0 A;  3NZQ A;  4AXP A;  3UUX B;  2ZM0 A;  1MMG A;  4H9N C;  4ISS A;  4OK0 A;  3T8O A;  3KDS E;  2LFU A;  2VKD A;  3N9Q A;  4O4L E;  4AQF C;  4G75 A;  3VKH A;  1ZHT A;  2LOS A;  4AI6 A;  3AA1 A;  1ZEE A;  4WNK A;  1WLX A;  3AAE B;  3C51 A;  4FZN A;  4HEA A;  5L2L A;  3RYI E;  4UF0 A;  5EK3 A;  1HFA A;  4AFK A;  2P9B A;  2XG6 A;  3L09 A;  4YJ3 E;  2YIN A;  4O4I E;  3N9O A;  4FJO A;  1LKX A;  3ZLI A;  4CXW A;  4BJM A;  3GWH A;  2CEA A;  2X51 A;  3LK3 B;  5JDQ A;  4CI2 B;  4OFZ A;  4GF4 A;  4KRA A;  4RLC A;  4FSO A;  2D0U A;  3WI5 A;  4O4H E;  3POX A;  2JQQ A;  4IE0 A;  5D5D A;  1H6S 1;  2K0L A;  3T0S A;  4EYU A;  5JDH A;  2CCQ A;  4UXN B;  2L3L A;  3I0O A;  4UVB B;  3ONX A;  3SY9 A;  2K9A A;  3CQC B;  3N2G E;  3LG7 A;  4G2A A;  4F6R C;  2QA7 A;  3SYB A;  3OKQ A;  2V7K A;  4GK0 E;  4I43 B;  1BR0 A;  2LHF A;  3L3P A;  2C5J A;  3DA3 A;  3Q9D A;  4YLH A;  4WW0 A;  4DO0 A;  5EE2 A;  2ACX A;  3LBX B;  5G26 A;  2J4U P;  1IAP A;  5LHI B;  2LSY A;  3N9M A;  2EHO D;  1PHO A;  5LCY A;  3OYZ A;  3ZJ1 A;  4HN9 A;  4FOZ A;  4PNI A;  1THQ A;  4AYI D;  4IHJ E;  2C0S A;  3TZG A;  2W62 A;  3VE1 A;  2V7M A;  2WAU A;  4E7S A;  4EOZ B;  3QRA A;  2HH7 A;  3BQI A;  3IF8 B;  4LSI A;  1WYC A;  3ZMV B;  3ETU A;  4QKN A;  2Y48 B;  5JDF A;  2XAS B;  1FIO A;  3CML A;  4ANJ A;  1MMD A;  1NWM X;  1ZHC A;  2KWH A;  2BVL A;  4HFV A;  1AJ3 A;  3UU2 A;  4GCS A;  1ZHY A;  3ANW B;  4OHF A;  3F31 A;  1E1H B;  2GE4 A;  3CQX C;  5IYZ E;  2YU2 A;  3EMN X;  1E54 A;  4D65 A;  2LE8 A;  4ADZ A;  3C98 B;  5LHG B;  2JMH A;  2JPF A;  3O9X A;  3N5L A;  4CZZ B;  4FZL A;  1YD8 G;  2NTY A;  2KXP A;  3VZU X;  2LHR A;  2M67 A;  3GA8 A;  4ASK A;  5LBM A;  3C4X A;  2V7I A;  3SRZ A;  3CWZ B;  2NTX A;  3V5U A;  4M1P A;  1EZ3 A;  4HKA A;  1OXZ A;  3N9N A;  4QQ1 A;  4FZM A;  4FT6 A;  4XNL A;  4UVC B;  3FB2 A;  2K24 A;  6PRN A;  4MAL A;  5T5F A;  4QX8 B;  2KZ7 B;  1T98 A;  3LFM A;  4PFP A;  3RKO A;  2J1N A;  2VWA A;  1YKH B;  3NBX X;  2Y8D A;  5LA6 E;  5L3D B;  3K19 A;  3DJB A;  1HCI A;  3POU A;  3AB3 B;  4I55 E;  1FEW A;  1HXX A;  3R6N A;  3C5O A;  4FES A;  3CKD A;  2WWU A;  4GOU A;  4PK4 A;  4LSH A;  1UX4 A;  3KIN B;  3M65 A;  3P8C D;  4ZI2 D;  4DVD A;  4TV9 E;  3PU8 A;  2A2F X;  4ZS2 A;  3O1J A;  4E7Z A;  2H7V C;  4KR8 A;  2Q9Q C;  3PTR B;  4JEH B;  3LK2 B;  2BVM A;  3W15 B;  3ETV A;  2Y0K A;  1Q9F A;  4AZL A;  4GYS A;  3RBH A;  1BR1 A;  2LSK A;  3Q5X A;  5A1L A;  3VZT X;  2SPC A;  2X9H A;  4TX5 A;  4Z3T A;  3KV6 A;  4DMW A;  2D2S A;  1D0X A;  2WMO A;  4WBO A;  2X0L B;  1MPF A;  2C5K T;  4IE5 A;  4C91 A;  3CVR A;  4U74 A;  3MA9 A;  3ZPO A;  3WAJ A;  5LJN A;  5PRN A;  1U4Q A;  1HX8 A;  2LJL A;  2ZLY A;  3I1A A;  5KDM C;  2LEH A;  3CX6 B;  2MBG A;  1HTJ F;  2IC9 A;  5JH7 E;  3KV5 A;  3LK4 2;  4HE8 A;  3C64 A;  4RJW A;  3HKD E;  3J7Y q;  2B1E A;  5BMV E;  3LK2 A;  4D5U A;  1ZHX A;  5FXW A;  1H7C A;  4GIW A;  1UCU A;  5HXE A;  4RLB A;  3K3Q C;  2OMF A;  4FUV A;  5DL5 A;  2CWY A;  2ZM8 A;  3QRC A;  4LSE A;  2ZLD A;  4EIW A;  3PUR A;  2Q9Q B;  4V1A v;  5JDN A;  1BR2 A;  4YFS A;  1MIY A;  3BQL A;  2MHL A;  2DHR A;  3AA1 B;  1CUN A;  2LHN A;  4I50 E;  2VKH A;  4X1I E;  3IBP A;  5FMN A;  3ZMZ B;  4CXX A;  5KMG P;  1IZN A;  4L9I A;  3S4U A;  2X68 A;  1WR6 A;  2X9Y A;  3CPZ A;  3VE2 A;  2CLY B;  5DJQ C;  4G63 A;  3QK6 A;  3IEE A;  3UTK A;  3RPU A;  3AA7 B;  2BDE A;  2ODJ A;  3KV4 A;  4U9C A;  3A5X A;  4AQF A;  3B13 A;  4JLE A;  2ERV A;  2A72 A;  4AYD C;  1O3X A;  1Y64 B;  3T20 A;  4CXY A;  4IE4 A;  1MND A;  2NOX A;  3JC6 D;  2PG8 A;  3HI2 A;  3HKE E;  3NRY A;  2D5U A;  3PE0 A;  4HGA A;  3DA4 A;  1D0Y A;  5FYM A;  2W81 C;  2E9X C;  4D64 A;  3J9X 1;  2JRK A;  2XTL A;  4AKH A;  1ZHZ A;  3ZC1 A;  2NWB A;  1GFO A;  3QUJ A;  1GFN A;  3RC8 A;  2X9W A;  2H7O A;  3WI3 A;  4FI5 A;  3WI4 A;  2PBI A;  3AVR A;  2KMF A;  2E8I A;  2WM9 A;  3EVY A;  3FBL A;  3Q2M A;  4ZS3 A;  2HPJ A;  3PUS A;  1FMV A;  4P09 A;  3C4Z A;  2XMX A;  3C4W A;  3KBU A;  4QXC B;  4RL9 A;  4F4B A;  1IJ5 A;  3K3O A;  2DNX A;  4YJ2 E;  3V5S A;  5JRC B;  2EHO C;  3HOE A;  1Q9G A;  3RRW A;  5JDL A;  3POR A;  5LGU B;  2XUE A;  3H3A A;  3V8U A;  5J2T E;  2F1T A;  5HAX A;  2KDY A;  5LGN B;  2ODU A;  1G8X A;  4MHC A;  4O3X B;  2XAH B;  2LOP A;  5L3B B;  3HW9 A;  5JVD E;  1G90 A;  4ZI2 C;  1BXW A;  4OYK A;  4PUX A;  2Q9Q D;  4H9R C;  2JJ9 A;  1QUU A;  5EZY E;  3SWH A;  1VRB A;  4DBQ A;  2F1V A;  2V1D B;  3O1I A;  2ODV A;  2XAF B;  5CA1 E;  4AUI A;  3RRC A;  3O0E A;  3ESL A;  4ZI3 C;  1WRD A;  5KX5 E;  5HYA A;  4JFB A;  5GON E;  3U78 A;  2LSI A;  2UXN B;  1VOM A;  3ZYM A;  5LJM A;  3N9P A;  2FGQ X;  1SA0 E;  2MOZ A;  3KV9 A;  2PJQ A;  3GN5 A;  5L3E B;  2K5B B;  2CMR A;  5LNK A;  4XAX B;  3PQS A;  5H6Q B;  3VU7 H;  1YW0 A;  4X1K E;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...