3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3AAAB 3AA0B 2KXPA 5AFUL 3AA7A 3AAEA 2KZ7A 3LK42 3LK41 5AFUK 2KXPB 4AKRA 3AA7B 3AAEB 3LK3A 5ADXL 3AA6A 2KZ7B 3AA1A 1IZNA 3AA0A 4AKRB 3LK2A 5ADXK 3AAAA 3LK3B 3AA6B 3AA1B 1IZNB 3LK2B
chains in the Genus database with same CATH superfamily
4RJWA 3A5XA 3RKGA 5ABEA 1IJ6A 4YXDA 4DIDB 3PGSA 4PAGA 3ESLA 2JQYA 4O4HE 1WR6A 3P4QA 3RRWA 2SPCA 2D5UA 3I9YA 2LKGA 3A0BO 3QB5K 1SUMB 2QTKA 2N2MA 2ES0A 3SY9A 2BVMA 2UXCT 3SY7A 4I55E 4XNKA 2RP4A 1R8IA 1N34T 2X51A 4LF6T 5ABFB 2GE4A 4O4XA 4X62T 2YINA 2FJDA 2KLQA 2CE7A 1BR2A 1FIOA 4G75A 2KSRA 4DR6T 2DNXA 1LRZA 1GQEA 2DCFA 3LK3B 3IA3A 3CIRA 3I9WA 5LNKA 1BH3A 3OJAA 1BR4A 4FESA 3N5LA 3WU2O 4F4BA 3UU2A 4HWFA 5AQVB 3FHNA 4FRTA 4Q25A 2CXFA 3LG7A 3AEEA 4X20E 3VE1A 2YDSA 2XM1A 5LGTB 2F1VA 1GFMA 4JYAT 3RYCE 4ZZCA 3MACA 4DO0A 4QX7B 4UXNB 4O3WA 3PU8A 2C5IT 3MA9A 4JI6T 2Y7SA 4PK4A 5C2TA 3PV0F 1JNRA 4YHHT 1SHZC 3CVRA 1HNWT 1XMQT 3N2GE 4O2AE 3ZMSB 1MMDA 1IBLT 3UUXB 4M1PA 2Y2XA 2YNKA 3RQUA 2XAHB 3VY9X 5CA1E 3CMLA 2WBLA 5AQUB 2R4LA 1XDOA 5LG4A 2ODUA 4GKKT 4DUYT 5AQGB 1MM4A 2LKHA 2X9HA 2OLTA 2MYSA 2WCAA 2V8SV 5G39A 3MXZA 2KXPA 3LDQB 3O1IA 4PR7A 2CBJA 1KNZA 3JTYA 4HEAA 3RI5A 4PJ0O 4JI5T 4TWHA 1UUSA 3VU7H 1QUUA 4CI3B 4DR5T 5L4EA 4TV9E 2KC0A 4F6RC 2I59A 4JBWF 3ZKRA 3UQ4A 4UF0A 1J5ET 3NZQA 4QHOA 1SE7A 3VRBA 1YD8G 2L9QA 3J9X1 4GK5E 2A2FX 2J4GA 5G38A 3RH3A 4BA9A 2PJQA 1GFQA 4AQGA 2Q9QC 3CX7B 3DTOA 2L8KA 1E2AA 2Y48B 4O4JE 3N2OA 1VCSA 2WY2A 5FKYA 4DR3T 2XY8B 1HFAA 3BQLA 3ZYKA 3RF1A 4ZS3A 2WZHA 2J62A 4HWIB 3D0TA 3T24A 3AEDA 3UQ7A 3EMNX 1W9RA 2WSSV 2V7IA 2YU2A 3C4XA 3ZJ2A 2XPKA 4PFOA 2NW7A 4LF8T 2YN6A 1HCIA 2F1CX 2WU2A 3HOEA 3RKOA 4GHBA 4JI0T 1BR0A 2M07A 4ASKA 4CN4A 2KXPB 4IE6A 3I1AA 2Q9QA 3FZHB 2BVLA 3PDYA 4UVBB 3LBXA 5F3JA 3ETUA 5LB7B 1MIWA 4O4LE 5L3GB 3MZKB 1UGOA 3ZT5A 3KV9A 1G73A 3B5MA 5JDPA 3SYSA 1WYCA 2XAQB 4O3YA 5AFUL 2NOXA 5L3FB 3R84B 4CN6A 3OPCA 3PUAA 4EEDA 4X1IE 5L47A 3RC8A 1M7KA 3UPGA 2E5LT 4UF0B 1IZNA 4D64A 4P09A 1XZYA 1Z8UA 4ZI2C 4A97A 4ANJA 3UUBA 3LJCA 3C4WA 3UU8A 4HWDA 2G0UA 3UTKA 1YS5A 1J1JA 2R8AA 3O9XA 5J2UE 3DJBA 2IUBA 1L0VA 5LHGB 4ZI3D 3RHWA 3I0QA 1WFDA 3RIUA 5CJ5A 2WQYA 5LHIB 3C50A 1ZHYA 3U78A 5ADXK 3L3PA 5HXEA 3RPUA 2KMFA 1FEWA 4ILUA 5PRNA 4IL6O 2OMFA 2GK9A 1WLXA 4PFPA 2ODJA 4HFDA 4IDOA 3NRYA 4P1NA 5JDFA 4ZOLE 3TLSA 3RYIE 2E5VA 2W4XA 4PW8A 2A72A 2V26A 2CA5A 1G8XA 5FVNA 5HXHA 2Y6XA 1IBMT 4FOZA 4F8HA 2P9BA 2IC9A 2B76A 2BDEA 4HE8A 2QGSA 4ZEYA 2ZMAA 3VZUX 3M65A 5ABHA 5E0OA 4IDNA 2BS2A 2W00A 2X27X 4C4VA 4YT0A 3RYHE 5L3CB 4DV2T 3NKZA 7PRNA 5KAIO 5AQRB 4COFA 4XBFB 1Q9FA 3POUA 5FYMA 1QLBA 3PUSA 4UIGA 3WAJA 4LF9T 1IZNB 3N9LA 5AQNB 4LF5T 4TWFA 2WB5A 4DV3T 3GN5A 2MAWA 3HKDE 4GCQA 4TX5A 2XE2A 3C4ZA 3C51A 4B3RT 5FP3A 2O4VA 2D2SA 2VB6A 2XQ5A 5LBQB 4EOZB 4K0KT 3WAKA 1MMNA 3UULA 3HI2A 2WU5A 1HNZT 4QX8B 2XASB 2EHOD 4GF4A 4N75A 3N9QA 3NVOA 3VR8A 3U3IA 3FXEB 4IT4A 2C0SA 4FRXA 4U3CA 3Q9DA 5GONE 5JRCB 2ACXA 2DWGA 1EZ3A 4TUYE 4DV4T 4LMLA 3G06A 3C5OA 3PU3A 3AVRA 4GYSA 4TNWA 3PUZF 4IDZA 2CWOA 4K3CA 4DV5T 3CQGB 1YQ4A 4DR1T 4BUMX 3QUJA 3ZMZB 3PUQA 2HHHT 4JEHB 2HH7A 4B61A 2BG9C 2UUAT 1XNRT 2VL0A 4IL4A 2JPFA 1T72A 3VRAA 1N32T 2YPVA 3GN5B 2XJ7A 1HG2A 3RIFA 2MTQA 2Y8DA 1E1HB 2J1DG 1S5LO 5JH7E 5AQSB 4JI1T 4JUYA 5LJNA 5JDMA 4RLBA 1OXZA 2KNDA 5HCMA 1YKHB 4FZLA 5E79O 3B13A 4MHCA 2VKJA 3ZCIA 4HKAA 4LSFA 4X1KE 3NWIA 3HKCE 1HR0T 1QSDA 5C8YE 4YHJA 2BZBA 2CLYC 1ZP0A 5AQMB 2KWHA 2BS3A 2LOPA 2E8IA 5DQVA 2R88A 5JR9B 1MNDA 3Q5EA 1HTJF 5LBMA 1N33T 5GTHO 2N2LA 5CA0E 5FNVE 1OSMA 3EVYA 4QKNA 2UU9T 3ONLC 3ANWA 1UK5A 3RX6A 4KHZF 2JQKA 3C64A 4CI1B 3SWHA 4BJNA 2KZ7A 1U5PA 4FSOA 4B3MT 3VZTX 2M6IA 3SYBA 2B1EA 3KV4A 3WI5A 4AIUA 2CPTA 3ONJA 4PJLA 5FXWA 5AQFB 2XTLA 4E7ZA 5H6RB 4C91A 5LYJE 1QJPA 3T8OA 2WWUA 1D1AA 3ZSSA 3UFEA 2CM0A 3PTRB 2CEAA 6PRNA 3N9OA 1BXWA 4LF4T 3ZT7A 5DL7A 3K3QC 4WBOA 4HFIA 4G63A 3LK2A 3RC3A 3K1SA 3V5SA 2DI4A 2JMHA 1HX1B 3DZMA 4HTEA 2W62A 4HFBA 5DJQC 5JQGE 3PQUA 5HCJA 2F1TA 5EK3A 3QOFA 2ODVA 1NEKA 3OKQA 2BS4A 3K3OA 2RPAA 3T0SA 2V7KA 4C69X 5L2LA 1US7B 4BAYB 2X67A 3K3NA 4JLEA 4FSPA 5IYUA 4DUZT 3W15B 2NW9A 5EE2A 4X5TA 3POXA 4UVAB 2K3WA 4DMVA 5JDLA 1T16A 5IUXA 5J0ZA 1KK7A 2NW8A 3PUYF 2IWVA 2WMNA 3HKEE 4U9CA 4OYJA 3H3AA 2C5KT 1QJ9A 1KF6A 2DLRA 3ANWB 3ZYMA 2WJQA 2LRLA 3K19A 3AAEA 2LOSA 4N58A 2XG6A 4EEBA 2WDRA 4U72A 3EDUA 1D1BA 2UUCT 4Z3TA 3M3ZB 3WI4A 4H9OC 2RA1A 3VKGA 5B66O 4B6XA 3SS1A 1UX4A 4GOUA 3HKBE 2YDRA 4LSHA 4AI6A 3RRCA 4QXHB 3FBLA 2XQAA 2WZIA 1WRDA 4ADZA 2FJAA 2AXDS 5TAOA 4UB8O 2N2NA 2VK9A 2XQ4A 5HXCA 1LVFA 1Z0PA 4NPPA 4U2ZA 3VY8X 3GWHA 4ZI3C 1KFYA 3PE0A 4C90A 5L3DB 3FB2A 3LK2B 4JCHA 5IWAT 3EDVA 2PTFA 4ISSA 4EB6E 1NENA 2LT3A 2X9WA 1VCTA 4X65T 4WBNE 3F2EA 1MM5A 2Y0KA 1HS7A 2X0HA 4K3BA 3AECA 1HXXA 5KDMC 4JI8T 5JTGA 5TISO 3KZIO 1OPFA 3LK41 4CXYA 3HA4A 3PUGA 2NTYA 4L0RA 5T5FA 4ISTA 5AQLB 4EYUA 8PRNA 5LMNT 5JVDE 5CFBA 4B3ST 4E1SA 3AE5A 4QH5A 5AQTB 2D9DA 4E7SA 3BQKA 4A56A 1HXTA 4P0BA 2NWBA 4YY3T 2JIWA 4CXXA 3O0EA 5HWYA 2WAUA 1MMAA 4AKIA 3AAEB 3UU3A 4GCSA 5JDHA 4MLKA 3PORA 3QRAA 2V5DA 2VKDA 4YTMA 5LJMA 5HWXA 3IEEA 3JC6D 2IWWA 5AQHB 1B7TA 3RLFF 4PJMA 4JI3T 4UEMA 4PK5A 1S94A 2V7JA 1D1CA 5CB4E 4HGAA 1KNPA 3L09A 3AVSA 3WI3A 4ZS2A 4JI7T 2FGRA 2H88A 3C98B 3BS0A 4QQ1A 4WZXA 1ZHCA 3ZC0A 4YSXA 4AKRA 3POQA 1ZV4X 1W0BA 1OWAA 2R4NA 3RYFE 1ZOYA 3DA4A 4QXBB 1GFNA 3AEBA 5F5WA 4IGUA 2IIUA 2VASA 3SFDA 3ONXA 2UXXB 2EHOC 4HFVA 1OEDC 4KR4A 2VKHA 5AQJB 3VHLA 2VL8A 2YOEA 5FXVA 3KDSE 4FT6A 2KT9A 2X9YA 2XZEA 4CXWA 4AFKA 4HN9A 3P4WA 4GIWA 5LA6E 3AAAA 4HWCA 4KP3C 2FUPA 4CI2B 2MPKA 4GK0E 2LJLA 3AB3B 2V6YA 4DVDA 1M62A 4FI5A 2VKOA 5GTIO 4WW0A 3A8YC 3E0ZA 2JMKA 4U7IA 2BG9E 2FJEA 3P8CD 5L4HA 3BRYA 4CN1A 4U74A 4NUUA 2LHFA 1IAPA 4H63V 2A3DA 3UU5A 3AA0A 1UX5A 3KVDD 2Q9QB 5JDGA 3P7IA 3LBXB 3MJXA 4Z90A 4A98A 1MIVA 4EZ4A 5LCYA 1YKEB 4FQEA 4U33A 4PJJA 2D0TA 2W67A 2CRBA 4YTNA 2E9XD 3O1JA 2EHOA 3N9PA 1ORMA 3ZT6A 4TNVA 3ZN1B 2ZM6T 1YW0A 1OEDA 3UU4A 2W63A 3FZKB 4AQFC 1WYBA 3AE9A 3QNUA 1T98A 3BQIA 1X79A 3AE7A 1ZHTA 2XTQA 1GFOA 3VKHA 2MNHA 2XQYA 2X9XA 4L5GA 2YU1A 4AYNA 4ILAA 5H2FO 4TWDA 5DL5A 2X0YA 3QRCA 3NSGA 4N74A 4AKRB 2XQ9A 3NBXX 5ABGA 2M67A 1FJGT 4YSYA 4O3ZA 4L9IA 4H9QC 1MIYA 5FY7A 3PJAJ 3ZMUB 3AE8A 3PUXF 4QWNB 1P4TA 3DWNA 4AKLA 3OTOT 4JV5T 2LSJA 3CWZB 4DBQA 5JDNA 4QXCB 4ILCA 3DWOX 4X64T 3IF8B 2FJBA 3AAAB 2LSKA 3I0OA 5FVKA 5HEUA 2LFUA 4KRAA 2V6YB 3JAFA 2DWKA 3AA6A 3Q2MA 3ZN0B 3QK6A 5LXTE 3V8UA 1I6ZA 1XNQT 2KWIB 1W0AA 5C3JA 3T1YT 3PUWF 5JREA 1PHOA 2NR4A 4LFCT 2XSAA 4AZLA 3RQWA 4C4VB 3ZYLA 5GV0A 4D5UA 4XZCA 4EXTA 1HG5A 4JFBA 2VWAA 5DQWA 4O8SA 4JI4T 4LMJA 4MFRA 2WS3A 2M06A 5J2TE 4CZZB 4IL9A 1MPFA 5A1LA 1VRBA 4IREA 4YSZA 3CQCB 2XQ6A 2W2UA 2YEVC 3TLVA 3Q5WA 4QH1A 1ZEEA 4I50E 4G2AA 3A7MA 1NAFA 5FL1A 3K8PC 2LSGA 2VURA 4EZHA 2IW5B 2CCQA 4CQIA 4FZMA 3SFEA 1NWMX 4MALA 4WYVA 2IDOB 5KAFO 4FZNA 3LK42 3RBHA 2XAJB 4DBRA 4HWHA 3AE4A 4IIJE 2KDYA 1H7CA 1Q9GA 5CGMA 3NRXA 2MBGA 5DL8A 4O2BE 1UURA 5EK4A 2HPLA 1THQA 5FMNA 3O1HA 5HEOA 2NTXA 5KXJA 2LSIA 3AEFA 4BJMA 5LMUT 5G3AA 2XAGB 1ZHXA 2V7LA 2WMOA 2IAKA 4IE7A 1XMOT 1D0YA 2BG9A 3EHZA 3E08A 4J2CA 4H9SE 5LGNB 3MK7C 4O4IE 3AA6B 2WWVA 5JDQA 4XAXB 3HW9A 4IE4A 5HEHA 4OHFA 2K24A 5DABA 4I43B 5L3EB 2XHEB 5D5DA 1T8BA 3VE2A 1CUNA 3OYZA 2W61A 3OYXA 3JAEA 3P50A 3KVAA 4DV1T 1E54A 2CHNA 4A5XA 5FY1A 4ZHQE 4PJNA 4KHPT 3UUNA 4LMKA 3Q5DA 4OX9T 1E7PA 5AQKB 3GMIA 3MKDA 4XNLA 1N36T 4U2YA 5FXZA 3ZMVB 4UVCB 1HX8A 5HXSA 4G76A 3AEAA 3ZLIA 4AYID 2K9AA 5LHHB 4AKMA 2XAFB 2WM9A 4YFSA 2XMXA 3N9MA 4X66T 1W09A 2V7MA 4KR8A 2I6HA 2XQ7A 2E2AA 3ZMTB 3QC9A 3KINB 1KEYA 4IE0A 5AQPB 2JQHA 5LGUB 4KMCA 3KV6A 4ZXLA 2OV9A 3GP6A 4UR9A 1ZKEA 1LVKA 3HL6A 3AE3A 3T20A 2IC6A 3RIAA 3T1HT 2J4UP 4U7YA 2W81C 2BG9B 5FY0A 4AXPA 4DR7T 1MNEA 4JI2T 3A0HO 2WP9A 3FYXA 4LF7T 1DU2A 1FMWA 1D0ZA 5M4YA 3L39A 3O4XE 4EYYR 2K4TA 4IDQA 2ZLDA 2A9UA 3SZVA 3S4UA 5EZYE 1CHUA 2HPJA 3JC6C 3SOLA 2KZ7B 3BRZA 3KBUA 3AE6A 3H37A 4OK0A 2LHRA 2PG8A 2YDQA 3B57A 3V5UA 2LM2A 5KX5E 2ZFGA 4O4UA 3KFWX 3DP7A 3R6NA 4PK6A 2L3LA 1OEDE 2K0LA 2ZM0A 2CLYB 4UELA 4O49A 2ACZA 3CX6B 4AKGA 4D65A 4DV6T 2YK0A 4IE5A 4ILBA 2WDVA 2XQ8A 3CX8B 5G26A 4U31A 2N9DA 3ZPOA 3RGLA 2W0GA 5AQQB 5F8PA 4H9NC 2CXLA 4Z91A 3ZCJA 3A2SX 4E1TA 4KUMB 2R4PA 3KV5A 4AQYT 3TZGA 2H7VC 2V5CA 4EIWA 1WCRA 4DR4T 3PRNA 2MOZA 1Y01A 2CBIA 2ZM2A 2KINB 4RL9A 4EAHA 3BK9A 5AFUK 4FUVA 1SA0E 4ZI7E 1YXRA 3ETVA 3CKDA 2BBHA 1QJ8A 3TLWA 2JQ9A 3PF1A 2W80C 2BKNA 4HFEA 5ETWA 2BKPA 2PRNA 4V1Av 2X68A 2Z6EA 2LSYA 3AA7A 1MMGA 1LKXA 1AJ3A 3VR9A 2LRKA 2WVPA 3P4PA 3N2KE 2LEHA 2E9XC 1BR1A 3RIUC 3FZMB 2CWYA 3CK6A 3FBZA 4AYDC 3EABA 5BR8T 4ZZBA 3GA8A 2VVSA 4RLCA 4K0UA 3N9NA 2X9KA 3JCUO 2XM2A 4DNDA 3AA1A 1FMVA 2V6XA 5L3BB 5B5EO 2QYWA 2OA5A 4CTDA 2XSBA 2JQQA 4GKJT 3LSVA 3L8RA 4C00A 1VOMA 3ZSTA 3HOLA 4UV9B 2VVNA 4AYEC 1YQ3A 2FGQX 4KBMB 3QB5A 1KNRA 1BT9A 3KVBA 4YJ3E 5AQIB 3PQSA 2PORA 3DA3A 2UXBT 2DL1A 2R6GF 4AUIA 4DMWA 2E9XA 4AYMC 3FZLB 5HYAA 2CXDA 3ZJ1A 2UUBT 3UT5E 4DR2T 4O3XB 2H3RA 1XWMA 5EK2A 3VZWX 4RJXA 2LE8A 3Q5XA 5HAXA 2Q9QD 4LFBT 1X9BA 3AE1A 2CMRA 4IDPA 3NJTA 1PRNA 4N78D 2XTRA 5IYZE 3J7Yq 4NXMT 4GYRA 4H9PC 2X0LB 1WR0A 3PGRA 2X66A 3P4SA 3AA7B 3AE2A 4AISA 2DHRA 2WDQA 3X1DA 2QVAA 4NUVA 2XE3A 2AE9A 3G7GA 4EV6A 2F4VT 2UXNB 3ZC1A 5HEJA 4FMSA 3UFGA 2AXTO 2IMLA 4NXNT 4PNIA 3KBTA 3PURA 5JRCA 4LFAT 1HNXT 3OVUA 4H63H 2Y0LA 3TLUA 5ADXL 3SZDA 2V1DB 1GFPA 2VQET 3AA1B 1U4QA 4H9RC 4MBQA 4P0AA 3AXJA 3NZPA 5LG3A 5FL0A 2R4OA 1ZHWA 2H89A 2VQFT 2NP9A 2LHNA 4Z8XA 5JR9C 2JMMA 2HN2A 1V9DA 4I0UA 2ERVA 3ABVA 4HFHA 3HWBA 4LSEA 1O3XA 3UUMA 4UB6O 1J5WA 3SRZA 2K48A 3F57A 2D0UA 2LLYA 4KX6A 4N59A 3PUVF 1H6S1 4QH4A 3UAQA 3PJAA 4ZI2D 1JNZA 2JJ9A 2JRKA 3FXDB 4X1YE 1I94T 2E9XB 5AQOB 2Y0HA 4IHJE 2PBIA 3F31A 1G90A 3JCFA 2H7OA 3CQXC 2J47A 3TLTA 5FXXA 3H3MA 3AEGA 3EI0A 3EAMA 2HN1A 1T1LA 2CHOA 1D0XA 2ZLYA 4OFZA 4GCPA 3LFMA 4AQFA 3FZFB 4LSIA 2XE1A 3ZEFB 4B3TT 4WNKA 4DV7T 2I0MA 1Y64B 2FBWA 2IHR1 2J1NA 5DL6A 3TKLB 2WJRA 5J1GA 1UCUA 2K5BB 5JR9A 3P4RA 5ABFA 4TV8E 2ZM8A 1IJ5A 3E22E 3CPZA 4TN7B 4YJ2E 4EGWA 4ERRA 3AA0B 4YLHA 3IBPA 2BBJA 1HF8A 5HXRA 2W66A 5LP6E 5H6QB 2C5JA 3LK3A 5LOVE 2MHLA 4UV8B 2PFVA 2QRXA 4FJOA 2EHOB 4PUXA 1S35A 4AKHA 4NIQA 5IHYA 1OEDB 3OBVE 2XQ3A 1IBKT 4I4TE 5BMVE 1ZHZA 3AXJB 3AAIA 3HR0A 2QA7A 1T7SA 4TZ4C 3UU6A 2N1GA 3JADA 2BKOA 1XDPA 2LM9A 4YTPA 2R89A 5HEGA 3PGUA 4HFCA 3IHRA 2XUEA 5KMGP 4JEUB 2M6BA 1HXUA 2UXDT 2YKSA 4DV0T 2XE5A 3EUHA 4KI0F 4OYKA 5FVLA
chains in the Genus database with same CATH topology
4RJWA 2VKDA 3A5XA 5LJMA 1IJ6A 5HWXA 3O4XE 3IEEA 4EYYR 3JC6D 4PAGA 2K4TA 3ESLA 3GN5A 4O4HE 2ZLDA 1WR6A 3SZVA 1B7TA 3HKDE 3S4UA 5EZYE 3RRWA 2SPCA 2D5UA 4PJMA 3I9YA 2HPJA 4GCQA 4AFKA 3JC6C 3SOLA 2KZ7B 4UEMA 4TX5A 2QTKA 4PK5A 1S94A 2V7JA 3KBUA 1D1CA 2ES0A 5CB4E 3C4ZA 3C51A 3H37A 2XE2A 4HGAA 4OK0A 3SY9A 3L09A 2BVMA 3AVSA 3WI3A 4ZS2A 5FP3A 2LHRA 2PG8A 2FGRA 2O4VA 2D2SA 3SY7A 2VB6A 3B57A 4I55E 3V5UA 4XNKA 2RP4A 3C98B 2X51A 2GE4A 4O4XA 5LBQB 4EOZB 2YINA 5KX5E 2ZFGA 4QQ1A 2KLQA 2N2MA 1ZHCA 3ZC0A 4O4UA 2CE7A 3WAKA 3KFWX 3DP7A 3R6NA 4AKRA 4PK6A 1MMNA 1BR2A 1FIOA 3POQA 1ZV4X 2L3LA 3UULA 2K0LA 3HI2A 1OWAA 2ZM0A 4G75A 4QX8B 3RYFE 2DNXA 1LRZA 2CLYB 3DA4A 4UELA 4O49A 2XASB 2DCFA 3CX6B 4QXBB 2EHOD 4AKGA 1GFNA 4GF4A 3N9QA 3LK3B 4D65A 2YK0A 4IE5A 3I9WA 4IGUA 5LNKA 2VASA 3CX8B 5G26A 3U3IA 3FXEB 2N9DA 3ZPOA 1BH3A 3ONXA 2UXXB 2EHOC 2W0GA 3OJAA 4HFVA 2C0SA 1BR4A 4FESA 4KR4A 3N5LA 2VKHA 4H9NC 5F8PA 2CXLA 3VHLA 4FRXA 4F4BA 3ZCJA 3UU2A 2VL8A 3FHNA 3A2SX 5FXVA 3KDSE 4FT6A 4KUMB 4FRTA 4E1TA 2KT9A 2X9YA 4CXWA 3Q9DA 2CXFA 3KV5A 5GONE 3TZGA 2H7VC 4HN9A 4GIWA 2ACXA 5LA6E 2DWGA 3LG7A 4EIWA 5JRCB 3AAAA 3PRNA 4KP3C 2MOZA 4CI2B 4GK0E 2ZM2A 1EZ3A 4X20E 3VE1A 2KINB 2LJLA 4TUYE 3AB3B 4RL9A 4DVDA 4FI5A 4EAHA 2VKOA 4WW0A 3C5OA 3E0ZA 3PU3A 2JMKA 3BK9A 3AVRA 5AFUK 3P8CD 5LGTB 2F1VA 1SA0E 4FUVA 4GYSA 1GFMA 4U74A 4NUUA 4ZI7E 3ETVA 4IDZA 3RYCE 2CWOA 3CKDA 2LHFA 3MACA 4DO0A 1IAPA 4H63V 4QX7B 1QJ8A 2A3DA 3CQGB 3AA0A 1UX5A 4BUMX 3KVDD 3QUJA 3ZMZB 2Q9QB 3PUQA 4UXNB 2W80C 5JDGA 4O3WA 3P7IA 4JEHB 3PU8A 5ETWA 3LBXB 3MJXA 2HH7A 2PRNA 2C5IT 3MA9A 4B61A 4V1Av 2X68A 2Y7SA 1MIVA 2Z6EA 4EZ4A 2LSYA 4PK4A 3AA7A 5LCYA 1YKEB 1SHZC 3CVRA 1MMGA 1LKXA 2JPFA 4PJJA 1AJ3A 2D0TA 3N2GE 2E9XD 2YPVA 3O1JA 4O2AE 2EHOA 3N9PA 3ZMSB 1ORMA 1MMDA 3ZN1B 3GN5B 1HG2A 1YW0A 3N2KE 3UUXB 2W63A 4M1PA 4AQFC 2Y2XA 2LEHA 1WYBA 2MTQA 2E9XC 1BR1A 2Y8DA 1T98A 1E1HB 2J1DG 3BQIA 2YNKA 1X79A 2CWYA 5JH7E 2XAHB 1ZHTA 3FBZA 4JUYA 2XTQA 5LJNA 1GFOA 3VY9X 4AYDC 5CA1E 3VKHA 5JDMA 4RLBA 1OXZA 2MNHA 3GA8A 2KNDA 1YKHB 2X9XA 2XQYA 3CMLA 4FZLA 4RLCA 2WBLA 4L5GA 2YU1A 3B13A 4K0UA 4AYNA 4MHCA 3N9NA 2VKJA 5LG4A 2ODUA 3ZCIA 4DNDA 5DL5A 3AA1A 3QRCA 3NSGA 4HKAA 4LSFA 4X1KE 1MM4A 4AKRB 1FMVA 3HKCE 1QSDA 5C8YE 4YHJA 2X9HA 5L3BB 2MYSA 3NBXX 2BZBA 2CLYC 2KWHA 2LOPA 2OA5A 3MXZA 2KXPA 2E8IA 2JQQA 5DQVA 3O1IA 2M67A 5JR9B 1MNDA 1VOMA 1KNZA 1HTJF 5LBMA 4O3ZA 4L9IA 4H9QC 3JTYA 2N2LA 5CA0E 1MIYA 4HEAA 5FNVE 1OSMA 5FY7A 3ZMUB 4QWNB 1P4TA 3EVYA 3HOLA 4QKNA 3ANWA 4UV9B 3RX6A 4AKLA 4AYEC 2FGQX 4KBMB 2LSJA 3CWZB 4DBQA 3VU7H 5JDNA 1QUUA 4QXCB 4CI3B 1BT9A 3KVBA 4YJ3E 3C64A 3IF8B 4CI1B 3PQSA 3AAAB 3SWHA 4TV9E 2PORA 3DA3A 2KC0A 4AUIA 4F6RC 2I59A 4BJNA 2LSKA 2E9XA 3I0OA 4DMWA 4AYMC 2KZ7A 1U5PA 4UF0A 5HYAA 4FSOA 2CXDA 3VZTX 3ZJ1A 2LFUA 4KRAA 3SYBA 3UT5E 2B1EA 2H3RA 3NZQA 4QHOA 4O3XB 5EK2A 3VZWX 4RJXA 2LE8A 3KV4A 2DWKA 3WI5A 3Q5XA 3AA6A 3Q2MA 3ZN0B 3QK6A 4PJLA 5HAXA 5FXWA 5LXTE 2Q9QD 1YD8G 3V8UA 2CMRA 2L9QA 3J9X1 4GK5E 2A2FX 2XTLA 4E7ZA 1PRNA 3RH3A 4BA9A 5H6RB 2KWIB 2PJQA 4N78D 4C91A 1GFQA 4AQGA 5IYZE 2Q9QC 5LYJE 3J7Yq 3CX7B 1QJPA 2XTRA 5JREA 3DTOA 2L8KA 1PHOA 3T8OA 2WWUA 4GYRA 4H9PC 2X0LB 1D1AA 4AZLA 2Y48B 4O4JE 3UFEA 1IZNB 3ZYLA 2CM0A 2X66A 3N2OA 2CEAA 3PTRB 5GV0A 4D5UA 6PRNA 3N9OA 1BXWA 3AA7B 4XZCA 5DL7A 3K3QC 2DHRA 4EXTA 1HG5A 4WBOA 4JFBA 2VWAA 5DQWA 4G63A 3LK2A 3RC3A 1HFAA 4NUVA 4O8SA 3BQLA 3ZYKA 2XE3A 3V5SA 4MFRA 2DI4A 2JMHA 4ZS3A 2M06A 5J2TE 4CZZB 4HTEA 2W62A 3G7GA 2UXNB 3ZC1A 5DJQC 3D0TA 5JQGE 3T24A 1MPFA 3PQUA 4FMSA 4PNIA 3EMNX 2F1TA 5EK3A 3KBTA 2ODVA 3PURA 5A1LA 1VRBA 5JRCA 5M4YA 2WSSV 3CQCB 2YEVC 3K3OA 3OKQA 2V7IA 4H63H 3T0SA 2YU2A 2V7KA 3C4XA 3Q5WA 3ZJ2A 5ADXL 4PFOA 2Y0LA 2NW7A 5L2LA 4C69X 1ZEEA 4I50E 3SZDA 4G2AA 1US7B 2V1DB 1GFPA 1HCIA 1NAFA 3K8PC 2LSGA 4BAYB 4EZHA 2X67A 2IW5B 3K3NA 2CCQA 1U4QA 3AA1B 4H9RC 4JLEA 4MBQA 4CQIA 4P0AA 4FSPA 4FZMA 5IYUA 3HOEA 3RKOA 1NWMX 4GHBA 3W15B 3NZPA 4MALA 2NW9A 5EE2A 1BR0A 2M07A 4ASKA 3POXA 4UVAB 4FZNA 3LK42 3RBHA 2XAJB 4DMVA 1ZHWA 2KXPB 4DBRA 5JDLA 4IE6A 3I1AA 2Q9QA 2NP9A 2BVLA 2LHNA 4Z8XA 5JR9C 1KK7A 4IIJE 3PDYA 2KDYA 1H7CA 2NW8A 3LBXA 4UVBB 5F3JA 3ETUA 1Q9GA 2JMMA 2WMNA 3NRXA 3HKEE 2MBGA 5DL8A 1V9DA 4U9CA 1MIWA 4O2BE 4OYJA 3H3AA 4O4LE 2ERVA 2C5KT 5L3GB 5EK4A 1QJ9A 2HPLA 2DLRA 3MZKB 3HWBA 3KV9A 4LSEA 3ANWB 1G73A 1THQA 5FMNA 1O3XA 3O1HA 3ZYMA 3SYSA 1WYCA 2XAQB 3UUMA 5JDPA 4O3YA 3SRZA 2K48A 2NTXA 3F57A 5AFUL 2LSIA 4BJMA 2D0UA 2NOXA 4N59A 5L3FB 3R84B 3AAEA 3K19A 1H6S1 2LOSA 4N58A 2XAGB 1ZHXA 2V7LA 2WMOA 3PUAA 2IAKA 2XG6A 4IE7A 3UAQA 4X1IE 4ZI2D 4U72A 3EDUA 2JJ9A 2JRKA 3RC8A 3UPGA 1D0YA 1D1BA 3FXDB 4X1YE 2E9XB 2Y0HA 4Z3TA 4IHJE 4UF0B 2PBIA 3F31A 1G90A 3WI4A 2H7OA 4H9OC 3CQXC 3E08A 1IZNA 4D64A 4J2CA 4H9SE 4P09A 2RA1A 5FXXA 5LGNB 4ZI2C 3VKGA 3MK7C 4O4IE 4ANJA 4B6XA 3SS1A 1UX4A 4GOUA 3HKBE 3AA6B 3C4WA 3LJCA 1YS5A 2G0UA 3UTKA 4AI6A 3RRCA 4LSHA 4QXHB 1D0XA 5JDQA 2ZLYA 3FBLA 3O9XA 4OFZA 4XAXB 1WRDA 4IE4A 3LFMA 4ADZA 3HW9A 5TAOA 4GCPA 4AQFA 4OHFA 5J2UE 2K24A 3DJBA 5DABA 2N2NA 5LHGB 2XE1A 4LSIA 4ZI3D 2VK9A 3I0QA 3ZEFB 4WNKA 4I43B 5HXCA 1Y64B 5LHIB 1LVFA 1Z0PA 3C50A 2J1NA 5DL6A 3VY8X 1ZHYA 5L3EB 3U78A 5ADXK 3GWHA 4ZI3C 3L3PA 2XHEB 3TKLB 3PE0A 5HXEA 4C90A 5D5DA 5L3DB 3RPUA 2KMFA 1FEWA 3VE2A 1CUNA 1UCUA 2K5BB 3OYZA 4ILUA 3FB2A 2W61A 4TV8E 5J1GA 2ZM8A 1IJ5A 5JR9A 3E22E 3CPZA 4TN7B 3OYXA 4YJ2E 3LK2B 4ERRA 2OMFA 4JCHA 2GK9A 3AA0B 1WLXA 4PFPA 3EDVA 2ODJA 4ISSA 3KVAA 4YLHA 4EB6E 1E54A 3IBPA 2LT3A 2X9WA 1HF8A 5HXRA 5FY1A 3NRYA 5LP6E 5JDFA 4ZOLE 5H6QB 2C5JA 4ZHQE 4PJNA 3RYIE 4WBNE 3F2EA 3LK3A 3UUNA 5LOVE 4PW8A 2A72A 2V26A 1MM5A 2MHLA 2CA5A 3GMIA 3MKDA 4UV8B 4XNLA 1G8XA 2Y0KA 5FVNA 1HS7A 2PFVA 4FJOA 2EHOB 4PUXA 1S35A 5FXZA 3ZMVB 4UVCB 1HXXA 4AKHA 1HX8A 5KDMC 5HXHA 5IHYA 3OBVE 5HXSA 4G76A 3ZLIA 2Y6XA 4FOZA 4AYID 2K9AA 2P9BA 5LHHB 4AKMA 2IC9A 1OPFA 3LK41 2XAFB 3HA4A 2WM9A 4I4TE 4YFSA 3N9MA 3PUGA 5BMVE 4CXYA 1ZHZA 2BDEA 2XMXA 3AAIA 3HR0A 4HE8A 2QA7A 2NTYA 2QGSA 2V7MA 4L0RA 4KR8A 5T5FA 2ZMAA 3VZUX 3M65A 4TZ4C 4ISTA 4EYUA 3ZMTB 3QC9A 8PRNA 5E0OA 5JVDE 4E1SA 2N1GA 3KINB 5PRNA 2W00A 4E7SA 3BQKA 4IE0A 4A56A 2X27X 1HXTA 4P0BA 2NWBA 2LM9A 3RYHE 5L3CB 5LGUB 4KMCA 3KV6A 4CXXA 3GP6A 3O0EA 3IHRA 5HWYA 2WAUA 1MMAA 7PRNA 1ZKEA 1LVKA 3HL6A 4AKIA 2XUEA 5KMGP 2IC6A 3AAEB 4JEUB 3T20A 4XBFB 5JDHA 4GCSA 2J4UP 1Q9FA 4MLKA 1HXUA 2W81C 3POUA 5FY0A 4AXPA 1MNEA 5FYMA 3FYXA 2XE5A 3PORA 3QRAA 3PUSA 3EUHA 4UIGA 4OYKA 3WAJA 1FMWA 1D0ZA 3N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA B;  3AA0 B;  2KXP A;  5AFU L;  3AA7 A;  3AAE A;  2KZ7 A;  3LK4 2;  3LK4 1;  5AFU K;  2KXP B;  4AKR A;  3AA7 B;  3AAE B;  3LK3 A;  5ADX L;  3AA6 A;  2KZ7 B;  3AA1 A;  1IZN A;  3AA0 A;  4AKR B;  3LK2 A;  5ADX K;  3AAA A;  3LK3 B;  3AA6 B;  3AA1 B;  1IZN B;  3LK2 B; 
#chains in the Genus database with same CATH topology
 4RJW A;  3A5X A;  3RKG A;  5ABE A;  1IJ6 A;  4YXD A;  4DID B;  3PGS A;  4PAG A;  3ESL A;  2JQY A;  4O4H E;  1WR6 A;  3P4Q A;  3RRW A;  2SPC A;  2D5U A;  3I9Y A;  2LKG A;  3A0B O;  3QB5 K;  1SUM B;  2QTK A;  2N2M A;  2ES0 A;  3SY9 A;  2BVM A;  2UXC T;  3SY7 A;  4I55 E;  4XNK A;  2RP4 A;  1R8I A;  1N34 T;  2X51 A;  4LF6 T;  5ABF B;  2GE4 A;  4O4X A;  4X62 T;  2YIN A;  2FJD A;  2KLQ A;  2CE7 A;  1BR2 A;  1FIO A;  4G75 A;  2KSR A;  4DR6 T;  2DNX A;  1LRZ A;  1GQE A;  2DCF A;  3LK3 B;  3IA3 A;  3CIR A;  3I9W A;  5LNK A;  1BH3 A;  3OJA A;  1BR4 A;  4FES A;  3N5L A;  3WU2 O;  4F4B A;  3UU2 A;  4HWF A;  5AQV B;  3FHN A;  4FRT A;  4Q25 A;  2CXF A;  3LG7 A;  3AEE A;  4X20 E;  3VE1 A;  2YDS A;  2XM1 A;  5LGT B;  2F1V A;  1GFM A;  4JYA T;  3RYC E;  4ZZC A;  3MAC A;  4DO0 A;  4QX7 B;  4UXN B;  4O3W A;  3PU8 A;  2C5I T;  3MA9 A;  4JI6 T;  2Y7S A;  4PK4 A;  5C2T A;  3PV0 F;  1JNR A;  4YHH T;  1SHZ C;  3CVR A;  1HNW T;  1XMQ T;  3N2G E;  4O2A E;  3ZMS B;  1MMD A;  1IBL T;  3UUX B;  4M1P A;  2Y2X A;  2YNK A;  3RQU A;  2XAH B;  3VY9 X;  5CA1 E;  3CML A;  2WBL A;  5AQU B;  2R4L A;  1XDO A;  5LG4 A;  2ODU A;  4GKK T;  4DUY T;  5AQG B;  1MM4 A;  2LKH A;  2X9H A;  2OLT A;  2MYS A;  2WCA A;  2V8S V;  5G39 A;  3MXZ A;  2KXP A;  3LDQ B;  3O1I A;  4PR7 A;  2CBJ A;  1KNZ A;  3JTY A;  4HEA A;  3RI5 A;  4PJ0 O;  4JI5 T;  4TWH A;  1UUS A;  3VU7 H;  1QUU A;  4CI3 B;  4DR5 T;  5L4E A;  4TV9 E;  2KC0 A;  4F6R C;  2I59 A;  4JBW F;  3ZKR A;  3UQ4 A;  4UF0 A;  1J5E T;  3NZQ A;  4QHO A;  1SE7 A;  3VRB A;  1YD8 G;  2L9Q A;  3J9X 1;  4GK5 E;  2A2F X;  2J4G A;  5G38 A;  3RH3 A;  4BA9 A;  2PJQ A;  1GFQ A;  4AQG A;  2Q9Q C;  3CX7 B;  3DTO A;  2L8K A;  1E2A A;  2Y48 B;  4O4J E;  3N2O A;  1VCS A;  2WY2 A;  5FKY A;  4DR3 T;  2XY8 B;  1HFA A;  3BQL A;  3ZYK A;  3RF1 A;  4ZS3 A;  2WZH A;  2J62 A;  4HWI B;  3D0T A;  3T24 A;  3AED A;  3UQ7 A;  3EMN X;  1W9R A;  2WSS V;  2V7I A;  2YU2 A;  3C4X A;  3ZJ2 A;  2XPK A;  4PFO A;  2NW7 A;  4LF8 T;  2YN6 A;  1HCI A;  2F1C X;  2WU2 A;  3HOE A;  3RKO A;  4GHB A;  4JI0 T;  1BR0 A;  2M07 A;  4ASK A;  4CN4 A;  2KXP B;  4IE6 A;  3I1A A;  2Q9Q A;  3FZH B;  2BVL A;  3PDY A;  4UVB B;  3LBX A;  5F3J A;  3ETU A;  5LB7 B;  1MIW A;  4O4L E;  5L3G B;  3MZK B;  1UGO A;  3ZT5 A;  3KV9 A;  1G73 A;  3B5M A;  5JDP A;  3SYS A;  1WYC A;  2XAQ B;  4O3Y A;  5AFU L;  2NOX A;  5L3F B;  3R84 B;  4CN6 A;  3OPC A;  3PUA A;  4EED A;  4X1I E;  5L47 A;  3RC8 A;  1M7K A;  3UPG A;  2E5L T;  4UF0 B;  1IZN A;  4D64 A;  4P09 A;  1XZY A;  1Z8U A;  4ZI2 C;  4A97 A;  4ANJ A;  3UUB A;  3LJC A;  3C4W A;  3UU8 A;  4HWD A;  2G0U A;  3UTK A;  1YS5 A;  1J1J A;  2R8A A;  3O9X A;  5J2U E;  3DJB A;  2IUB A;  1L0V A;  5LHG B;  4ZI3 D;  3RHW A;  3I0Q A;  1WFD A;  3RIU A;  5CJ5 A;  2WQY A;  5LHI B;  3C50 A;  1ZHY A;  3U78 A;  5ADX K;  3L3P A;  5HXE A;  3RPU A;  2KMF A;  1FEW A;  4ILU A;  5PRN A;  4IL6 O;  2OMF A;  2GK9 A;  1WLX A;  4PFP A;  2ODJ A;  4HFD A;  4IDO A;  3NRY A;  4P1N A;  5JDF A;  4ZOL E;  3TLS A;  3RYI E;  2E5V A;  2W4X A;  4PW8 A;  2A72 A;  2V26 A;  2CA5 A;  1G8X A;  5FVN A;  5HXH A;  2Y6X A;  1IBM T;  4FOZ A;  4F8H A;  2P9B A;  2IC9 A;  2B76 A;  2BDE A;  4HE8 A;  2QGS A;  4ZEY A;  2ZMA A;  3VZU X;  3M65 A;  5ABH A;  5E0O A;  4IDN A;  2BS2 A;  2W00 A;  2X27 X;  4C4V A;  4YT0 A;  3RYH E;  5L3C B;  4DV2 T;  3NKZ A;  7PRN A;  5KAI O;  5AQR B;  4COF A;  4XBF B;  1Q9F A;  3POU A;  5FYM A;  1QLB A;  3PUS A;  4UIG A;  3WAJ A;  4LF9 T;  1IZN B;  3N9L A;  5AQN B;  4LF5 T;  4TWF A;  2WB5 A;  4DV3 T;  3GN5 A;  2MAW A;  3HKD E;  4GCQ A;  4TX5 A;  2XE2 A;  3C4Z A;  3C51 A;  4B3R T;  5FP3 A;  2O4V A;  2D2S A;  2VB6 A;  2XQ5 A;  5LBQ B;  4EOZ B;  4K0K T;  3WAK A;  1MMN A;  3UUL A;  3HI2 A;  2WU5 A;  1HNZ T;  4QX8 B;  2XAS B;  2EHO D;  4GF4 A;  4N75 A;  3N9Q A;  3NVO A;  3VR8 A;  3U3I A;  3FXE B;  4IT4 A;  2C0S A;  4FRX A;  4U3C A;  3Q9D A;  5GON E;  5JRC B;  2ACX A;  2DWG A;  1EZ3 A;  4TUY E;  4DV4 T;  4LML A;  3G06 A;  3C5O A;  3PU3 A;  3AVR A;  4GYS A;  4TNW A;  3PUZ F;  4IDZ A;  2CWO A;  4K3C A;  4DV5 T;  3CQG B;  1YQ4 A;  4DR1 T;  4BUM X;  3QUJ A;  3ZMZ B;  3PUQ A;  2HHH T;  4JEH B;  2HH7 A;  4B61 A;  2BG9 C;  2UUA T;  1XNR T;  2VL0 A;  4IL4 A;  2JPF A;  1T72 A;  3VRA A;  1N32 T;  2YPV A;  3GN5 B;  2XJ7 A;  1HG2 A;  3RIF A;  2MTQ A;  2Y8D A;  1E1H B;  2J1D G;  1S5L O;  5JH7 E;  5AQS B;  4JI1 T;  4JUY A;  5LJN A;  5JDM A;  4RLB A;  1OXZ A;  2KND A;  5HCM A;  1YKH B;  4FZL A;  5E79 O;  3B13 A;  4MHC A;  2VKJ A;  3ZCI A;  4HKA A;  4LSF A;  4X1K E;  3NWI A;  3HKC E;  1HR0 T;  1QSD A;  5C8Y E;  4YHJ A;  2BZB A;  2CLY C;  1ZP0 A;  5AQM B;  2KWH A;  2BS3 A;  2LOP A;  2E8I A;  5DQV A;  2R88 A;  5JR9 B;  1MND A;  3Q5E A;  1HTJ F;  5LBM A;  1N33 T;  5GTH O;  2N2L A;  5CA0 E;  5FNV E;  1OSM A;  3EVY A;  4QKN A;  2UU9 T;  3ONL C;  3ANW A;  1UK5 A;  3RX6 A;  4KHZ F;  2JQK A;  3C64 A;  4CI1 B;  3SWH A;  4BJN A;  2KZ7 A;  1U5P A;  4FSO A;  4B3M T;  3VZT X;  2M6I A;  3SYB A;  2B1E A;  3KV4 A;  3WI5 A;  4AIU A;  2CPT A;  3ONJ A;  4PJL A;  5FXW A;  5AQF B;  2XTL A;  4E7Z A;  5H6R B;  4C91 A;  5LYJ E;  1QJP A;  3T8O A;  2WWU A;  1D1A A;  3ZSS A;  3UFE A;  2CM0 A;  3PTR B;  2CEA A;  6PRN A;  3N9O A;  1BXW A;  4LF4 T;  3ZT7 A;  5DL7 A;  3K3Q C;  4WBO A;  4HFI A;  4G63 A;  3LK2 A;  3RC3 A;  3K1S A;  3V5S A;  2DI4 A;  2JMH A;  1HX1 B;  3DZM A;  4HTE A;  2W62 A;  4HFB A;  5DJQ C;  5JQG E;  3PQU A;  5HCJ A;  2F1T A;  5EK3 A;  3QOF A;  2ODV A;  1NEK A;  3OKQ A;  2BS4 A;  3K3O A;  2RPA A;  3T0S A;  2V7K A;  4C69 X;  5L2L A;  1US7 B;  4BAY B;  2X67 A;  3K3N A;  4JLE A;  4FSP A;  5IYU A;  4DUZ T;  3W15 B;  2NW9 A;  5EE2 A;  4X5T A;  3POX A;  4UVA B;  2K3W A;  4DMV A;  5JDL A;  1T16 A;  5IUX A;  5J0Z A;  1KK7 A;  2NW8 A;  3PUY F;  2IWV A;  2WMN A;  3HKE E;  4U9C A;  4OYJ A;  3H3A A;  2C5K T;  1QJ9 A;  1KF6 A;  2DLR A;  3ANW B;  3ZYM A;  2WJQ A;  2LRL A;  3K19 A;  3AAE A;  2LOS A;  4N58 A;  2XG6 A;  4EEB A;  2WDR A;  4U72 A;  3EDU A;  1D1B A;  2UUC T;  4Z3T A;  3M3Z B;  3WI4 A;  4H9O C;  2RA1 A;  3VKG A;  5B66 O;  4B6X A;  3SS1 A;  1UX4 A;  4GOU A;  3HKB E;  2YDR A;  4LSH A;  4AI6 A;  3RRC A;  4QXH B;  3FBL A;  2XQA A;  2WZI A;  1WRD A;  4ADZ A;  2FJA A;  2AXD S;  5TAO A;  4UB8 O;  2N2N A;  2VK9 A;  2XQ4 A;  5HXC A;  1LVF A;  1Z0P A;  4NPP A;  4U2Z A;  3VY8 X;  3GWH A;  4ZI3 C;  1KFY A;  3PE0 A;  4C90 A;  5L3D B;  3FB2 A;  3LK2 B;  4JCH A;  5IWA T;  3EDV A;  2PTF A;  4ISS A;  4EB6 E;  1NEN A;  2LT3 A;  2X9W A;  1VCT A;  4X65 T;  4WBN E;  3F2E A;  1MM5 A;  2Y0K A;  1HS7 A;  2X0H A;  4K3B A;  3AEC A;  1HXX A;  5KDM C;  4JI8 T;  5JTG A;  5TIS O;  3KZI O;  1OPF A;  3LK4 1;  4CXY A;  3HA4 A;  3PUG A;  2NTY A;  4L0R A;  5T5F A;  4IST A;  5AQL B;  4EYU A;  8PRN A;  5LMN T;  5JVD E;  5CFB A;  4B3S T;  4E1S A;  3AE5 A;  4QH5 A;  5AQT B;  2D9D A;  4E7S A;  3BQK A;  4A56 A;  1HXT A;  4P0B A;  2NWB A;  4YY3 T;  2JIW A;  4CXX A;  3O0E A;  5HWY A;  2WAU A;  1MMA A;  4AKI A;  3AAE B;  3UU3 A;  4GCS A;  5JDH A;  4MLK A;  3POR A;  3QRA A;  2V5D A;  2VKD A;  4YTM A;  5LJM A;  5HWX A;  3IEE A;  3JC6 D;  2IWW A;  5AQH B;  1B7T A;  3RLF F;  4PJM A;  4JI3 T;  4UEM A;  4PK5 A;  1S94 A;  2V7J A;  1D1C A;  5CB4 E;  4HGA A;  1KNP A;  3L09 A;  3AVS A;  3WI3 A;  4ZS2 A;  4JI7 T;  2FGR A;  2H88 A;  3C98 B;  3BS0 A;  4QQ1 A;  4WZX A;  1ZHC A;  3ZC0 A;  4YSX A;  4AKR A;  3POQ A;  1ZV4 X;  1W0B A;  1OWA A;  2R4N A;  3RYF E;  1ZOY A;  3DA4 A;  4QXB B;  1GFN A;  3AEB A;  5F5W A;  4IGU A;  2IIU A;  2VAS A;  3SFD A;  3ONX A;  2UXX B;  2EHO C;  4HFV A;  1OED C;  4KR4 A;  2VKH A;  5AQJ B;  3VHL A;  2VL8 A;  2YOE A;  5FXV A;  3KDS E;  4FT6 A;  2KT9 A;  2X9Y A;  2XZE A;  4CXW A;  4AFK A;  4HN9 A;  3P4W A;  4GIW A;  5LA6 E;  3AAA A;  4HWC A;  4KP3 C;  2FUP A;  4CI2 B;  2MPK A;  4GK0 E;  2LJL A;  3AB3 B;  2V6Y A;  4DVD A;  1M62 A;  4FI5 A;  2VKO A;  5GTI O;  4WW0 A;  3A8Y C;  3E0Z A;  2JMK A;  4U7I A;  2BG9 E;  2FJE A;  3P8C D;  5L4H A;  3BRY A;  4CN1 A;  4U74 A;  4NUU A;  2LHF A;  1IAP A;  4H63 V;  2A3D A;  3UU5 A;  3AA0 A;  1UX5 A;  3KVD D;  2Q9Q B;  5JDG A;  3P7I A;  3LBX B;  3MJX A;  4Z90 A;  4A98 A;  1MIV A;  4EZ4 A;  5LCY A;  1YKE B;  4FQE A;  4U33 A;  4PJJ A;  2D0T A;  2W67 A;  2CRB A;  4YTN A;  2E9X D;  3O1J A;  2EHO A;  3N9P A;  1ORM A;  3ZT6 A;  4TNV A;  3ZN1 B;  2ZM6 T;  1YW0 A;  1OED A;  3UU4 A;  2W63 A;  3FZK B;  4AQF C;  1WYB A;  3AE9 A;  3QNU A;  1T98 A;  3BQI A;  1X79 A;  3AE7 A;  1ZHT A;  2XTQ A;  1GFO A;  3VKH A;  2MNH A;  2XQY A;  2X9X A;  4L5G A;  2YU1 A;  4AYN A;  4ILA A;  5H2F O;  4TWD A;  5DL5 A;  2X0Y A;  3QRC A;  3NSG A;  4N74 A;  4AKR B;  2XQ9 A;  3NBX X;  5ABG A;  2M67 A;  1FJG T;  4YSY A;  4O3Z A;  4L9I A;  4H9Q C;  1MIY A;  5FY7 A;  3PJA J;  3ZMU B;  3AE8 A;  3PUX F;  4QWN B;  1P4T A;  3DWN A;  4AKL A;  3OTO T;  4JV5 T;  2LSJ A;  3CWZ B;  4DBQ A;  5JDN A;  4QXC B;  4ILC A;  3DWO X;  4X64 T;  3IF8 B;  2FJB A;  3AAA B;  2LSK A;  3I0O A;  5FVK A;  5HEU A;  2LFU A;  4KRA A;  2V6Y B;  3JAF A;  2DWK A;  3AA6 A;  3Q2M A;  3ZN0 B;  3QK6 A;  5LXT E;  3V8U A;  1I6Z A;  1XNQ T;  2KWI B;  1W0A A;  5C3J A;  3T1Y T;  3PUW F;  5JRE A;  1PHO A;  2NR4 A;  4LFC T;  2XSA A;  4AZL A;  3RQW A;  4C4V B;  3ZYL A;  5GV0 A;  4D5U A;  4XZC A;  4EXT A;  1HG5 A;  4JFB A;  2VWA A;  5DQW A;  4O8S A;  4JI4 T;  4LMJ A;  4MFR A;  2WS3 A;  2M06 A;  5J2T E;  4CZZ B;  4IL9 A;  1MPF A;  5A1L A;  1VRB A;  4IRE A;  4YSZ A;  3CQC B;  2XQ6 A;  2W2U A;  2YEV C;  3TLV A;  3Q5W A;  4QH1 A;  1ZEE A;  4I50 E;  4G2A A;  3A7M A;  1NAF A;  5FL1 A;  3K8P C;  2LSG A;  2VUR A;  4EZH A;  2IW5 B;  2CCQ A;  4CQI A;  4FZM A;  3SFE A;  1NWM X;  4MAL A;  4WYV A;  2IDO B;  5KAF O;  4FZN A;  3LK4 2;  3RBH A;  2XAJ B;  4DBR A;  4HWH A;  3AE4 A;  4IIJ E;  2KDY A;  1H7C A;  1Q9G A;  5CGM A;  3NRX A;  2MBG A;  5DL8 A;  4O2B E;  1UUR A;  5EK4 A;  2HPL A;  1THQ A;  5FMN A;  3O1H A;  5HEO A;  2NTX A;  5KXJ A;  2LSI A;  3AEF A;  4BJM A;  5LMU T;  5G3A A;  2XAG B;  1ZHX A;  2V7L A;  2WMO A;  2IAK A;  4IE7 A;  1XMO T;  1D0Y A;  2BG9 A;  3EHZ A;  3E08 A;  4J2C A;  4H9S E;  5LGN B;  3MK7 C;  4O4I E;  3AA6 B;  2WWV A;  5JDQ A;  4XAX B;  3HW9 A;  4IE4 A;  5HEH A;  4OHF A;  2K24 A;  5DAB A;  4I43 B;  5L3E B;  2XHE B;  5D5D A;  1T8B A;  3VE2 A;  1CUN A;  3OYZ A;  2W61 A;  3OYX A;  3JAE A;  3P50 A;  3KVA A;  4DV1 T;  1E54 A;  2CHN A;  4A5X A;  5FY1 A;  4ZHQ E;  4PJN A;  4KHP T;  3UUN A;  4LMK A;  3Q5D A;  4OX9 T;  1E7P A;  5AQK B;  3GMI A;  3MKD A;  4XNL A;  1N36 T;  4U2Y A;  5FXZ A;  3ZMV B;  4UVC B;  1HX8 A;  5HXS A;  4G76 A;  3AEA A;  3ZLI A;  4AYI D;  2K9A A;  5LHH B;  4AKM A;  2XAF B;  2WM9 A;  4YFS A;  2XMX A;  3N9M A;  4X66 T;  1W09 A;  2V7M A;  4KR8 A;  2I6H A;  2XQ7 A;  2E2A A;  3ZMT B;  3QC9 A;  3KIN B;  1KEY A;  4IE0 A;  5AQP B;  2JQH A;  5LGU B;  4KMC A;  3KV6 A;  4ZXL A;  2OV9 A;  3GP6 A;  4UR9 A;  1ZKE A;  1LVK A;  3HL6 A;  3AE3 A;  3T20 A;  2IC6 A;  3RIA A;  3T1H T;  2J4U P;  4U7Y A;  2W81 C;  2BG9 B;  5FY0 A;  4AXP A;  4DR7 T;  1MNE A;  4JI2 T;  3A0H O;  2WP9 A;  3FYX A;  4LF7 T;  1DU2 A;  1FMW A;  1D0Z A;  5M4Y A;  3L39 A;  3O4X E;  4EYY R;  2K4T A;  4IDQ A;  2ZLD A;  2A9U A;  3SZV A;  3S4U A;  5EZY E;  1CHU A;  2HPJ A;  3JC6 C;  3SOL A;  2KZ7 B;  3BRZ A;  3KBU A;  3AE6 A;  3H37 A;  4OK0 A;  2LHR A;  2PG8 A;  2YDQ A;  3B57 A;  3V5U A;  2LM2 A;  5KX5 E;  2ZFG A;  4O4U A;  3KFW X;  3DP7 A;  3R6N A;  4PK6 A;  2L3L A;  1OED E;  2K0L A;  2ZM0 A;  2CLY B;  4UEL A;  4O49 A;  2ACZ A;  3CX6 B;  4AKG A;  4D65 A;  4DV6 T;  2YK0 A;  4IE5 A;  4ILB A;  2WDV A;  2XQ8 A;  3CX8 B;  5G26 A;  4U31 A;  2N9D A;  3ZPO A;  3RGL A;  2W0G A;  5AQQ B;  5F8P A;  4H9N C;  2CXL A;  4Z91 A;  3ZCJ A;  3A2S X;  4E1T A;  4KUM B;  2R4P A;  3KV5 A;  4AQY T;  3TZG A;  2H7V C;  2V5C A;  4EIW A;  1WCR A;  4DR4 T;  3PRN A;  2MOZ A;  1Y01 A;  2CBI A;  2ZM2 A;  2KIN B;  4RL9 A;  4EAH A;  3BK9 A;  5AFU K;  4FUV A;  1SA0 E;  4ZI7 E;  1YXR A;  3ETV A;  3CKD A;  2BBH A;  1QJ8 A;  3TLW A;  2JQ9 A;  3PF1 A;  2W80 C;  2BKN A;  4HFE A;  5ETW A;  2BKP A;  2PRN A;  4V1A v;  2X68 A;  2Z6E A;  2LSY A;  3AA7 A;  1MMG A;  1LKX A;  1AJ3 A;  3VR9 A;  2LRK A;  2WVP A;  3P4P A;  3N2K E;  2LEH A;  2E9X C;  1BR1 A;  3RIU C;  3FZM B;  2CWY A;  3CK6 A;  3FBZ A;  4AYD C;  3EAB A;  5BR8 T;  4ZZB A;  3GA8 A;  2VVS A;  4RLC A;  4K0U A;  3N9N A;  2X9K A;  3JCU O;  2XM2 A;  4DND A;  3AA1 A;  1FMV A;  2V6X A;  5L3B B;  5B5E O;  2QYW A;  2OA5 A;  4CTD A;  2XSB A;  2JQQ A;  4GKJ T;  3LSV A;  3L8R A;  4C00 A;  1VOM A;  3ZST A;  3HOL A;  4UV9 B;  2VVN A;  4AYE C;  1YQ3 A;  2FGQ X;  4KBM B;  3QB5 A;  1KNR A;  1BT9 A;  3KVB A;  4YJ3 E;  5AQI B;  3PQS A;  2POR A;  3DA3 A;  2UXB T;  2DL1 A;  2R6G F;  4AUI A;  4DMW A;  2E9X A;  4AYM C;  3FZL B;  5HYA A;  2CXD A;  3ZJ1 A;  2UUB T;  3UT5 E;  4DR2 T;  4O3X B;  2H3R A;  1XWM A;  5EK2 A;  3VZW X;  4RJX A;  2LE8 A;  3Q5X A;  5HAX A;  2Q9Q D;  4LFB T;  1X9B A;  3AE1 A;  2CMR A;  4IDP A;  3NJT A;  1PRN A;  4N78 D;  2XTR A;  5IYZ E;  3J7Y q;  4NXM T;  4GYR A;  4H9P C;  2X0L B;  1WR0 A;  3PGR A;  2X66 A;  3P4S A;  3AA7 B;  3AE2 A;  4AIS A;  2DHR A;  2WDQ A;  3X1D A;  2QVA A;  4NUV A;  2XE3 A;  2AE9 A;  3G7G A;  4EV6 A;  2F4V T;  2UXN B;  3ZC1 A;  5HEJ A;  4FMS A;  3UFG A;  2AXT O;  2IML A;  4NXN T;  4PNI A;  3KBT A;  3PUR A;  5JRC A;  4LFA T;  1HNX T;  3OVU A;  4H63 H;  2Y0L A;  3TLU A;  5ADX L;  3SZD A;  2V1D B;  1GFP A;  2VQE T;  3AA1 B;  1U4Q A;  4H9R C;  4MBQ A;  4P0A A;  3AXJ A;  3NZP A;  5LG3 A;  5FL0 A;  2R4O A;  1ZHW A;  2H89 A;  2VQF T;  2NP9 A;  2LHN A;  4Z8X A;  5JR9 C;  2JMM A;  2HN2 A;  1V9D A;  4I0U A;  2ERV A;  3ABV A;  4HFH A;  3HWB A;  4LSE A;  1O3X A;  3UUM A;  4UB6 O;  1J5W A;  3SRZ A;  2K48 A;  3F57 A;  2D0U A;  2LLY A;  4KX6 A;  4N59 A;  3PUV F;  1H6S 1;  4QH4 A;  3UAQ A;  3PJA A;  4ZI2 D;  1JNZ A;  2JJ9 A;  2JRK A;  3FXD B;  4X1Y E;  1I94 T;  2E9X B;  5AQO B;  2Y0H A;  4IHJ E;  2PBI A;  3F31 A;  1G90 A;  3JCF A;  2H7O A;  3CQX C;  2J47 A;  3TLT A;  5FXX A;  3H3M A;  3AEG A;  3EI0 A;  3EAM A;  2HN1 A;  1T1L A;  2CHO A;  1D0X A;  2ZLY A;  4OFZ A;  4GCP A;  3LFM A;  4AQF A;  3FZF B;  4LSI A;  2XE1 A;  3ZEF B;  4B3T T;  4WNK A;  4DV7 T;  2I0M A;  1Y64 B;  2FBW A;  2IHR 1;  2J1N A;  5DL6 A;  3TKL B;  2WJR A;  5J1G A;  1UCU A;  2K5B B;  5JR9 A;  3P4R A;  5ABF A;  4TV8 E;  2ZM8 A;  1IJ5 A;  3E22 E;  3CPZ A;  4TN7 B;  4YJ2 E;  4EGW A;  4ERR A;  3AA0 B;  4YLH A;  3IBP A;  2BBJ A;  1HF8 A;  5HXR A;  2W66 A;  5LP6 E;  5H6Q B;  2C5J A;  3LK3 A;  5LOV E;  2MHL A;  4UV8 B;  2PFV A;  2QRX A;  4FJO A;  2EHO B;  4PUX A;  1S35 A;  4AKH A;  4NIQ A;  5IHY A;  1OED B;  3OBV E;  2XQ3 A;  1IBK T;  4I4T E;  5BMV E;  1ZHZ A;  3AXJ B;  3AAI A;  3HR0 A;  2QA7 A;  1T7S A;  4TZ4 C;  3UU6 A;  2N1G A;  3JAD A;  2BKO A;  1XDP A;  2LM9 A;  4YTP A;  2R89 A;  5HEG A;  3PGU A;  4HFC A;  3IHR A;  2XUE A;  5KMG P;  4JEU B;  2M6B A;  1HXU A;  2UXD T;  2YKS A;  4DV0 T;  2XE5 A;  3EUH A;  4KI0 F;  4OYK A;  5FVL A; 
#chains in the Genus database with same CATH homology
 4RJW A;  2VKD A;  3A5X A;  5LJM A;  1IJ6 A;  5HWX A;  3O4X E;  3IEE A;  4EYY R;  3JC6 D;  4PAG A;  2K4T A;  3ESL A;  3GN5 A;  4O4H E;  2ZLD A;  1WR6 A;  3SZV A;  1B7T A;  3HKD E;  3S4U A;  5EZY E;  3RRW A;  2SPC A;  2D5U A;  4PJM A;  3I9Y A;  2HPJ A;  4GCQ A;  4AFK A;  3JC6 C;  3SOL A;  2KZ7 B;  4UEM A;  4TX5 A;  2QTK A;  4PK5 A;  1S94 A;  2V7J A;  3KBU A;  1D1C A;  2ES0 A;  5CB4 E;  3C4Z A;  3C51 A;  3H37 A;  2XE2 A;  4HGA A;  4OK0 A;  3SY9 A;  3L09 A;  2BVM A;  3AVS A;  3WI3 A;  4ZS2 A;  5FP3 A;  2LHR A;  2PG8 A;  2FGR A;  2O4V A;  2D2S A;  3SY7 A;  2VB6 A;  3B57 A;  4I55 E;  3V5U A;  4XNK A;  2RP4 A;  3C98 B;  2X51 A;  2GE4 A;  4O4X A;  5LBQ B;  4EOZ B;  2YIN A;  5KX5 E;  2ZFG A;  4QQ1 A;  2KLQ A;  2N2M A;  1ZHC A;  3ZC0 A;  4O4U A;  2CE7 A;  3WAK A;  3KFW X;  3DP7 A;  3R6N A;  4AKR A;  4PK6 A;  1MMN A;  1BR2 A;  1FIO A;  3POQ A;  1ZV4 X;  2L3L A;  3UUL A;  2K0L A;  3HI2 A;  1OWA A;  2ZM0 A;  4G75 A;  4QX8 B;  3RYF E;  2DNX A;  1LRZ A;  2CLY B;  3DA4 A;  4UEL A;  4O49 A;  2XAS B;  2DCF A;  3CX6 B;  4QXB B;  2EHO D;  4AKG A;  1GFN A;  4GF4 A;  3N9Q A;  3LK3 B;  4D65 A;  2YK0 A;  4IE5 A;  3I9W A;  4IGU A;  5LNK A;  2VAS A;  3CX8 B;  5G26 A;  3U3I A;  3FXE B;  2N9D A;  3ZPO A;  1BH3 A;  3ONX A;  2UXX B;  2EHO C;  2W0G A;  3OJA A;  4HFV A;  2C0S A;  1BR4 A;  4FES A;  4KR4 A;  3N5L A;  2VKH A;  4H9N C;  5F8P A;  2CXL A;  3VHL A;  4FRX A;  4F4B A;  3ZCJ A;  3UU2 A;  2VL8 A;  3FHN A;  3A2S X;  5FXV A;  3KDS E;  4FT6 A;  4KUM B;  4FRT A;  4E1T A;  2KT9 A;  2X9Y A;  4CXW A;  3Q9D A;  2CXF A;  3KV5 A;  5GON E;  3TZG A;  2H7V C;  4HN9 A;  4GIW A;  2ACX A;  5LA6 E;  2DWG A;  3LG7 A;  4EIW A;  5JRC B;  3AAA A;  3PRN A;  4KP3 C;  2MOZ A;  4CI2 B;  4GK0 E;  2ZM2 A;  1EZ3 A;  4X20 E;  3VE1 A;  2KIN B;  2LJL A;  4TUY E;  3AB3 B;  4RL9 A;  4DVD A;  4FI5 A;  4EAH A;  2VKO A;  4WW0 A;  3C5O A;  3E0Z A;  3PU3 A;  2JMK A;  3BK9 A;  3AVR A;  5AFU K;  3P8C D;  5LGT B;  2F1V A;  1SA0 E;  4FUV A;  4GYS A;  1GFM A;  4U74 A;  4NUU A;  4ZI7 E;  3ETV A;  4IDZ A;  3RYC E;  2CWO A;  3CKD A;  2LHF A;  3MAC A;  4DO0 A;  1IAP A;  4H63 V;  4QX7 B;  1QJ8 A;  2A3D A;  3CQG B;  3AA0 A;  1UX5 A;  4BUM X;  3KVD D;  3QUJ A;  3ZMZ B;  2Q9Q B;  3PUQ A;  4UXN B;  2W80 C;  5JDG A;  4O3W A;  3P7I A;  4JEH B;  3PU8 A;  5ETW A;  3LBX B;  3MJX A;  2HH7 A;  2PRN A;  2C5I T;  3MA9 A;  4B61 A;  4V1A v;  2X68 A;  2Y7S A;  1MIV A;  2Z6E A;  4EZ4 A;  2LSY A;  4PK4 A;  3AA7 A;  5LCY A;  1YKE B;  1SHZ C;  3CVR A;  1MMG A;  1LKX A;  2JPF A;  4PJJ A;  1AJ3 A;  2D0T A;  3N2G E;  2E9X D;  2YPV A;  3O1J A;  4O2A E;  2EHO A;  3N9P A;  3ZMS B;  1ORM A;  1MMD A;  3ZN1 B;  3GN5 B;  1HG2 A;  1YW0 A;  3N2K E;  3UUX B;  2W63 A;  4M1P A;  4AQF C;  2Y2X A;  2LEH A;  1WYB A;  2MTQ A;  2E9X C;  1BR1 A;  2Y8D A;  1T98 A;  1E1H B;  2J1D G;  3BQI A;  2YNK A;  1X79 A;  2CWY A;  5JH7 E;  2XAH B;  1ZHT A;  3FBZ A;  4JUY A;  2XTQ A;  5LJN A;  1GFO A;  3VY9 X;  4AYD C;  5CA1 E;  3VKH A;  5JDM A;  4RLB A;  1OXZ A;  2MNH A;  3GA8 A;  2KND A;  1YKH B;  2X9X A;  2XQY A;  3CML A;  4FZL A;  4RLC A;  2WBL A;  4L5G A;  2YU1 A;  3B13 A;  4K0U A;  4AYN A;  4MHC A;  3N9N A;  2VKJ A;  5LG4 A;  2ODU A;  3ZCI A;  4DND A;  5DL5 A;  3AA1 A;  3QRC A;  3NSG A;  4HKA A;  4LSF A;  4X1K E;  1MM4 A;  4AKR B;  1FMV A;  3HKC E;  1QSD A;  5C8Y E;  4YHJ A;  2X9H A;  5L3B B;  2MYS A;  3NBX X;  2BZB A;  2CLY C;  2KWH A;  2LOP A;  2OA5 A;  3MXZ A;  2KXP A;  2E8I A;  2JQQ A;  5DQV A;  3O1I A;  2M67 A;  5JR9 B;  1MND A;  1VOM A;  1KNZ A;  1HTJ F;  5LBM A;  4O3Z A;  4L9I A;  4H9Q C;  3JTY A;  2N2L A;  5CA0 E;  1MIY A;  4HEA A;  5FNV E;  1OSM A;  5FY7 A;  3ZMU B;  4QWN B;  1P4T A;  3EVY A;  3HOL A;  4QKN A;  3ANW A;  4UV9 B;  3RX6 A;  4AKL A;  4AYE C;  2FGQ X;  4KBM B;  2LSJ A;  3CWZ B;  4DBQ A;  3VU7 H;  5JDN A;  1QUU A;  4QXC B;  4CI3 B;  1BT9 A;  3KVB A;  4YJ3 E;  3C64 A;  3IF8 B;  4CI1 B;  3PQS A;  3AAA B;  3SWH A;  4TV9 E;  2POR A;  3DA3 A;  2KC0 A;  4AUI A;  4F6R C;  2I59 A;  4BJN A;  2LSK A;  2E9X A;  3I0O A;  4DMW A;  4AYM C;  2KZ7 A;  1U5P A;  4UF0 A;  5HYA A;  4FSO A;  2CXD A;  3VZT X;  3ZJ1 A;  2LFU A;  4KRA A;  3SYB A;  3UT5 E;  2B1E A;  2H3R A;  3NZQ A;  4QHO A;  4O3X B;  5EK2 A;  3VZW X;  4RJX A;  2LE8 A;  3KV4 A;  2DWK A;  3WI5 A;  3Q5X A;  3AA6 A;  3Q2M A;  3ZN0 B;  3QK6 A;  4PJL A;  5HAX A;  5FXW A;  5LXT E;  2Q9Q D;  1YD8 G;  3V8U A;  2CMR A;  2L9Q A;  3J9X 1;  4GK5 E;  2A2F X;  2XTL A;  4E7Z A;  1PRN A;  3RH3 A;  4BA9 A;  5H6R B;  2KWI B;  2PJQ A;  4N78 D;  4C91 A;  1GFQ A;  4AQG A;  5IYZ E;  2Q9Q C;  5LYJ E;  3J7Y q;  3CX7 B;  1QJP A;  2XTR A;  5JRE A;  3DTO A;  2L8K A;  1PHO A;  3T8O A;  2WWU A;  4GYR A;  4H9P C;  2X0L B;  1D1A A;  4AZL A;  2Y48 B;  4O4J E;  3UFE A;  1IZN B;  3ZYL A;  2CM0 A;  2X66 A;  3N2O A;  2CEA A;  3PTR B;  5GV0 A;  4D5U A;  6PRN A;  3N9O A;  1BXW A;  3AA7 B;  4XZC A;  5DL7 A;  3K3Q C;  2DHR A;  4EXT A;  1HG5 A;  4WBO A;  4JFB A;  2VWA A;  5DQW A;  4G63 A;  3LK2 A;  3RC3 A;  1HFA A;  4NUV A;  4O8S A;  3BQL A;  3ZYK A;  2XE3 A;  3V5S A;  4MFR A;  2DI4 A;  2JMH A;  4ZS3 A;  2M06 A;  5J2T E;  4CZZ B;  4HTE A;  2W62 A;  3G7G A;  2UXN B;  3ZC1 A;  5DJQ C;  3D0T A;  5JQG E;  3T24 A;  1MPF A;  3PQU A;  4FMS A;  4PNI A;  3EMN X;  2F1T A;  5EK3 A;  3KBT A;  2ODV A;  3PUR A;  5A1L A;  1VRB A;  5JRC A;  5M4Y A;  2WSS V;  3CQC B;  2YEV C;  3K3O A;  3OKQ A;  2V7I A;  4H63 H;  3T0S A;  2YU2 A;  2V7K A;  3C4X A;  3Q5W A;  3ZJ2 A;  5ADX L;  4PFO A;  2Y0L A;  2NW7 A;  5L2L A;  4C69 X;  1ZEE A;  4I50 E;  3SZD A;  4G2A A;  1US7 B;  2V1D B;  1GFP A;  1HCI A;  1NAF A;  3K8P C;  2LSG A;  4BAY B;  4EZH A;  2X67 A;  2IW5 B;  3K3N A;  2CCQ A;  1U4Q A;  3AA1 B;  4H9R C;  4JLE A;  4MBQ A;  4CQI A;  4P0A A;  4FSP A;  4FZM A;  5IYU A;  3HOE A;  3RKO A;  1NWM X;  4GHB A;  3W15 B;  3NZP A;  4MAL A;  2NW9 A;  5EE2 A;  1BR0 A;  2M07 A;  4ASK A;  3POX A;  4UVA B;  4FZN A;  3LK4 2;  3RBH A;  2XAJ B;  4DMV A;  1ZHW A;  2KXP B;  4DBR A;  5JDL A;  4IE6 A;  3I1A A;  2Q9Q A;  2NP9 A;  2BVL A;  2LHN A;  4Z8X A;  5JR9 C;  1KK7 A;  4IIJ E;  3PDY A;  2KDY A;  1H7C A;  2NW8 A;  3LBX A;  4UVB B;  5F3J A;  3ETU A;  1Q9G A;  2JMM A;  2WMN A;  3NRX A;  3HKE E;  2MBG A;  5DL8 A;  1V9D A;  4U9C A;  1MIW A;  4O2B E;  4OYJ A;  3H3A A;  4O4L E;  2ERV A;  2C5K T;  5L3G B;  5EK4 A;  1QJ9 A;  2HPL A;  2DLR A;  3MZK B;  3HWB A;  3KV9 A;  4LSE A;  3ANW B;  1G73 A;  1THQ A;  5FMN A;  1O3X A;  3O1H A;  3ZYM A;  3SYS A;  1WYC A;  2XAQ B;  3UUM A;  5JDP A;  4O3Y A;  3SRZ A;  2K48 A;  2NTX A;  3F57 A;  5AFU L;  2LSI A;  4BJM A;  2D0U A;  2NOX A;  4N59 A;  5L3F B;  3R84 B;  3AAE A;  3K19 A;  1H6S 1;  2LOS A;  4N58 A;  2XAG B;  1ZHX A;  2V7L A;  2WMO A;  3PUA A;  2IAK A;  2XG6 A;  4IE7 A;  3UAQ A;  4X1I E;  4ZI2 D;  4U72 A;  3EDU A;  2JJ9 A;  2JRK A;  3RC8 A;  3UPG A;  1D0Y A;  1D1B A;  3FXD B;  4X1Y E;  2E9X B;  2Y0H A;  4Z3T A;  4IHJ E;  4UF0 B;  2PBI A;  3F31 A;  1G90 A;  3WI4 A;  2H7O A;  4H9O C;  3CQX C;  3E08 A;  1IZN A;  4D64 A;  4J2C A;  4H9S E;  4P09 A;  2RA1 A;  5FXX A;  5LGN B;  4ZI2 C;  3VKG A;  3MK7 C;  4O4I E;  4ANJ A;  4B6X A;  3SS1 A;  1UX4 A;  4GOU A;  3HKB E;  3AA6 B;  3C4W A;  3LJC A;  1YS5 A;  2G0U A;  3UTK A;  4AI6 A;  3RRC A;  4LSH A;  4QXH B;  1D0X A;  5JDQ A;  2ZLY A;  3FBL A;  3O9X A;  4OFZ A;  4XAX B;  1WRD A;  4IE4 A;  3LFM A;  4ADZ A;  3HW9 A;  5TAO A;  4GCP A;  4AQF A;  4OHF A;  5J2U E;  2K24 A;  3DJB A;  5DAB A;  2N2N A;  5LHG B;  2XE1 A;  4LSI A;  4ZI3 D;  2VK9 A;  3I0Q A;  3ZEF B;  4WNK A;  4I43 B;  5HXC A;  1Y64 B;  5LHI B;  1LVF A;  1Z0P A;  3C50 A;  2J1N A;  5DL6 A;  3VY8 X;  1ZHY A;  5L3E B;  3U78 A;  5ADX K;  3GWH A;  4ZI3 C;  3L3P A;  2XHE B;  3TKL B;  3PE0 A;  5HXE A;  4C90 A;  5D5D A;  5L3D B;  3RPU A;  2KMF A;  1FEW A;  3VE2 A;  1CUN A;  1UCU A;  2K5B B;  3OYZ A;  4ILU A;  3FB2 A;  2W61 A;  4TV8 E;  5J1G A;  2ZM8 A;  1IJ5 A;  5JR9 A;  3E22 E;  3CPZ A;  4TN7 B;  3OYX A;  4YJ2 E;  3LK2 B;  4ERR A;  2OMF A;  4JCH A;  2GK9 A;  3AA0 B;  1WLX A;  4PFP A;  3EDV A;  2ODJ A;  4ISS A;  3KVA A;  4YLH A;  4EB6 E;  1E54 A;  3IBP A;  2LT3 A;  2X9W A;  1HF8 A;  5HXR A;  5FY1 A;  3NRY A;  5LP6 E;  5JDF A;  4ZOL E;  5H6Q B;  2C5J A;  4ZHQ E;  4PJN A;  3RYI E;  4WBN E;  3F2E A;  3LK3 A;  3UUN A;  5LOV E;  4PW8 A;  2A72 A;  2V26 A;  1MM5 A;  2MHL A;  2CA5 A;  3GMI A;  3MKD A;  4UV8 B;  4XNL A;  1G8X A;  2Y0K A;  5FVN A;  1HS7 A;  2PFV A;  4FJO A;  2EHO B;  4PUX A;  1S35 A;  5FXZ A;  3ZMV B;  4UVC B;  1HXX A;  4AKH A;  1HX8 A;  5KDM C;  5HXH A;  5IHY A;  3OBV E;  5HXS A;  4G76 A;  3ZLI A;  2Y6X A;  4FOZ A;  4AYI D;  2K9A A;  2P9B A;  5LHH B;  4AKM A;  2IC9 A;  1OPF A;  3LK4 1;  2XAF B;  3HA4 A;  2WM9 A;  4I4T E;  4YFS A;  3N9M A;  3PUG A;  5BMV E;  4CXY A;  1ZHZ A;  2BDE A;  2XMX A;  3AAI A;  3HR0 A;  4HE8 A;  2QA7 A;  2NTY A;  2QGS A;  2V7M A;  4L0R A;  4KR8 A;  5T5F A;  2ZMA A;  3VZU X;  3M65 A;  4TZ4 C;  4IST A;  4EYU A;  3ZMT B;  3QC9 A;  8PRN A;  5E0O A;  5JVD E;  4E1S A;  2N1G A;  3KIN B;  5PRN A;  2W00 A;  4E7S A;  3BQK A;  4IE0 A;  4A56 A;  2X27 X;  1HXT A;  4P0B A;  2NWB A;  2LM9 A;  3RYH E;  5L3C B;  5LGU B;  4KMC A;  3KV6 A;  4CXX A;  3GP6 A;  3O0E A;  3IHR A;  5HWY A;  2WAU A;  1MMA A;  7PRN A;  1ZKE A;  1LVK A;  3HL6 A;  4AKI A;  2XUE A;  5KMG P;  2IC6 A;  3AAE B;  4JEU B;  3T20 A;  4XBF B;  5JDH A;  4GCS A;  2J4U P;  1Q9F A;  4MLK A;  1HXU A;  2W81 C;  3POU A;  5FY0 A;  4AXP A;  1MNE A;  5FYM A;  3FYX A;  2XE5 A;  3POR A;  3QRA A;  3PUS A;  3EUH A;  4UIG A;  4OYK A;  3WAJ A;  1FMW A;  1D0Z A;  3N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...