3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3AAEB 3AAEA 1IZNB 1IZNA 5AFUL 3AA0B 3AA0A 2KXPB 2KXPA 2KZ7B 2KZ7A 3LK42 5AFUK 4AKRB 4AKRA 5ADXL 3AA7B 3AA7A 3LK41 3AAAB 3AA1B 3AA1A 3AAAA 3LK3B 3LK3A 3AA6B 3AA6A 5ADXK 3LK2B 3LK2A
chains in the Genus database with same CATH superfamily
4AQYT 4UV9B 5L3FB 5EK2A 3E22E 3PU3A 3VR9A 8PRNA 1BH3A 1MNEA 1E1HB 2KSRA 4YJ2E 4TNWA 1THQA 3FB2A 4FRXA 3AA0B 3HA4A 2IIUA 4JI1T 4GCPA 2XQ5A 5L4EA 4B3ST 2KLQA 2QTKA 2AXDS 2HN1A 1WCRA 2RA1A 4UELA 4XNLA 4F6RC 1UX4A 5LBMA 4EYUA 1IZNA 1LKXA 2LOPA 4BJNA 4I43B 1VRBA 3RYCE 3AVSA 5JRCA 1ZEEA 2Y2XA 5M4YA 3UTKA 3IA3A 2JRKA 5HCMA 2MNHA 5F8PA 1NAFA 4AYNA 2IMLA 4K3CA 4O2BE 4GKJT 2WQYA 4EEBA 3FHNA 4O4LE 1YQ3A 4CN1A 3RRWA 4CI2B 5AQNB 1HS7A 5AQHB 3UQ7A 5HAXA 2WMNA 3ZC0A 2VKJA 3PV0F 2XQ4A 5FMNA 4AKHA 3OTOT 3Q5XA 2XE5A 1MM4A 3POQA 1SE7A 3SY9A 3LDQB 5GV0A 3C50A 2XQ8A 5L47A 4O4IE 1XNRT 1IJ6A 2UXDT 2W61A 3KVBA 1SUMB 1CHUA 4GF4A 2P9BA 2C5KT 4L9IA 4TNVA 2XQ7A 3AE5A 3KBUA 2WVPA 3ZMTB 5L4HA 3AE7A 5DJQC 5AQUB 1GFNA 4QH5A 3PUWF 3I9YA 2D9DA 2UXCT 4UR9A 3MJXA 4HTEA 3T8OA 5FL0A 2ZM0A 3BS0A 3POUA 4M1PA 2WDQA 2YKSA 4HWFA 3LSVA 2LOSA 3UU3A 2XM1A 1L0VA 4XNKA 4TN7B 2BZBA 4WBOA 4AKGA 3HL6A 5HCJA 3CX8B 5FL1A 3RQUA 3KV5A 3RPUA 3IHRA 5HXHA 4OYJA 4DUZT 2WSSV 3A0BO 3DP7A 4GYSA 4MFRA 2N2LA 4IT4A 2WAUA 1Y01A 3LFMA 2VURA 1ZHCA 3B13A 3QC9A 3HKDE 4YFSA 2CBJA 4JFBA 3VZTX 5AQOB 3AA0A 3DA4A 5ABEA 2PORA 2Y0HA 3RH3A 5KAIO 1VCSA 3LK42 3CIRA 3DWNA 2R8AA 4PK6A 4TZ4C 5AQGB 4Z3TA 5JDMA 5AQKB 2LSGA 3LK2B 1OXZA 4U3CA 1YQ4A 3AVRA 2I0MA 2XZEA 2YINA 1HCIA 4KRAA 4O3ZA 1ZHXA 4AFKA 5ABFB 2IC9A 4DMVA 2XQYA 4U2YA 3A2SX 4LSHA 4QKNA 1IBMT 2FJBA 3N9MA 4ZI3C 5KAFO 4PJNA 4O2AE 1UGOA 4HEAA 2N2MA 1XMQT 2VK9A 2EHOD 3AE8A 4X20E 4AYDC 1BR0A 3ZYKA 2JQKA 2WJRA 3HKBE 5AQMB 3JC6C 4DR6T 1YS5A 4FJOA 5JVDE 3Q2MA 1HNXT 2UXBT 1U5PA 2L3LA 1R8IA 2XM2A 4DR7T 4E7ZA 1HXXA 2E8IA 1ZHTA 4HFIA 5T5FA 2QGSA 4V1Av 4X5TA 4DV2T 1XDPA 2WWUA 2C5IT 3ZN0B 5FXWA 4GCQA 1LVKA 4XZCA 3ZPOA 5DL6A 2IWWA 3NJTA 3FZMB 1KNZA 3AE6A 4K0KT 3BRZA 4LFAT 3WU2O 3HOEA 3SWHA 5AFUL 2IWVA 4O4UA 4ISTA 3VE2A 4NXNT 4IL4A 2X0LB 5LA6E 3GN5B 3VZUX 4AUIA 1FJGT 3T1HT 3Q5EA 4IDNA 2ZMAA 1YKHB 4IDZA 3RKGA 5EK4A 3P4PA 4JI2T 4AKLA 5IYUA 4D65A 2MAWA 2WY2A 2K48A 3ESLA 2W62A 4CN4A 4CXWA 2XE2A 4O8SA 4LSEA 4YHJA 3DA3A 4ANJA 3P50A 1GQEA 3G06A 4G2AA 2HPJA 2W2UA 5AQFB 3ZKRA 2FJDA 4A98A 2B76A 3NVOA 4QWNB 3ZT7A 3AEAA 4YLHA 2XG6A 2E2AA 5LOVE 3JCUO 4UXNB 3HOLA 2UXNB 2E5VA 3VR8A 5HEJA 5JREA 4ZS2A 1H7CA 3R6NA 1E7PA 3L09A 2VL0A 3N9NA 3OYXA 1OEDB 1HG5A 2J1DG 5JR9B 4UVAB 1NWMX 4X64T 4JI8T 4U74A 4KHPT 4N78D 1ZHYA 2RP4A 6PRNA 4DV5T 3BRYA 4N75A 2LT3A 3SZVA 1G90A 4IL9A 1US7B 1B7TA 3DWOX 3UULA 3LK2A 3UU5A 1CUNA 2CM0A 3IBPA 3WI5A 4B61A 4KR8A 5ABFA 2KMFA 1D0YA 2ZM8A 5AQVB 4UB8O 4CN6A 5B5EO 2CHOA 2R88A 2IC6A 3VZWX 4TV8E 2JQ9A 2NWBA 2V26A 2WDRA 2FBWA 3ONJA 2XUEA 5B66O 3JAFA 2C0SA 4F8HA 5EE2A 4JBWF 4LF8T 1WFDA 4U72A 5KDMC 5L3GB 4HFBA 4XBFB 3VKHA 3AAAB 1ZP0A 4HWCA 1P4TA 4HE8A 4KX6A 4TWHA 1BR4A 2HPLA 4O4XA 5LBQB 3CQXC 1HTJF 2X67A 5ADXL 5LG4A 4IE6A 2FGRA 3LK3B 3PUGA 2X66A 3K8PC 4MHCA 2R4NA 4X1YE 4A5XA 5LG3A 4YTNA 2DL1A 2UU9T 5LHGB 3MACA 4EIWA 1HG2A 4LF9T 4U2ZA 3GN5A 4LSFA 4DBRA 2XE1A 5HXEA 3TKLB 3WAJA 2XQ9A 4PJJA 4N74A 4DR5T 1ZKEA 2WWVA 3D0TA 2W80C 4YTPA 1IAPA 3T20A 4U7YA 5J0ZA 3PORA 4FQEA 2X68A 2XTRA 5CA1E 3T0SA 3RLFF 3E0ZA 2J4GA 5HWYA 4DNDA 4TWDA 2LSIA 5HEGA 3WI3A 4NIQA 2LFUA 2I59A 3C5OA 4QH4A 4PR7A 1D1BA 2K3WA 4EB6E 3ABVA 2LM9A 2CLYB 4D5UA 2CHNA 4AKIA 3TLWA 2CCQA 3CK6A 3GMIA 1N33T 3DZMA 3PGUA 3JCFA 2IHR1 3KINB 5H6RB 4HWIB 5GTIO 3VY8X 4FT6A 3ZYLA 4C90A 1OEDA 4UF0B 5JQGE 3PUYF 5FKYA 5JR9A 4DR3T 1LRZA 4PJMA 4HFHA 3UU6A 3TLUA 4K3BA 2YN6A 2Y0KA 4UB6O 4KR4A 2K5BB 3FZHB 2XTLA 1S5LO 4U9CA 3QB5K 5L3CB 1T1LA 4P0AA 4QHOA 2GE4A 3K19A 2WZIA 3CKDA 3AE4A 5AQSB 5CB4E 4FUVA 5JDFA 2X27X 1W09A 1UCUA 2CEAA 4AIUA 2BKNA 2LRLA 4Q25A 3PGRA 3FYXA 4QH1A 3NWIA 2CPTA 2X9YA 4CZZB 3OBVE 4QQ1A 4X62T 3JAEA 2JPFA 1OSMA 1XMOT 2CXFA 2VWAA 4ISSA 4PNIA 2XAJB 2NR4A 1E54A 3PJAA 4WNKA 2ACXA 4FRTA 4CTDA 5G39A 3ZSSA 3AAAA 3P4RA 3KBTA 2YPVA 2QVAA 4JI5T 3ZEFB 3O0EA 4C4VB 4DV4T 5CJ5A 4IE5A 2H7OA 4UVCB 4RJWA 2KZ7B 4N59A 2SPCA 1WYCA 4F4BA 3OPCA 5FY7A 3LK3A 4GYRA 4FMSA 4YSYA 3CPZA 4OHFA 4BAYB 2VKOA 1N36T 2KNDA 2KT9A 3ZT6A 2Q9QB 3QK6A 2MBGA 3RIUA 4O4HE 4IDQA 4LFBT 3PUAA 2Q9QD 1T7SA 4GK5E 2VVNA 4AKMA 2MOZA 3RIAA 4FI5A 1IBKT 5DQWA 3AA6B 4GCSA 1NENA 1BT9A 3BQLA 1MIWA 4EGWA 3AAEB 4EAHA 3PF1A 2H3RA 3KFWX 3L39A 2R89A 1YD8G 4JI6T 1FMVA 2B1EA 1HX1B 1O3XA 4ZS3A 1D0ZA 1NEKA 2F1CX 2FUPA 5D5DA 2V7LA 3M65A 5LHHB 4LMLA 4J2CA 1HF8A 2V7IA 3E08A 1WYBA 5FXZA 3SOLA 4I55E 3EDUA 5JDPA 4Z8XA 3EUHA 5F5WA 5JH7E 4AQGA 2V7MA 3PTRB 4RLBA 3HR0A 1BR1A 4YHHT 4QX7B 3T24A 2LEHA 3KDSE 2BG9E 4ZOLE 4B3MT 4UF0A 4FESA 3AECA 5LXTE 2NW9A 3RC3A 3ANWB 4CI1B 2H7VC 3I0OA 4AKRB 3N9QA 4ILCA 4RJXA 4BJMA 5PRNA 2H88A 4L5GA 1ZHZA 4FSPA 3OJAA 5AQQB 1Z8UA 4JYAT 3FBZA 1W0AA 5FY0A 3AXJB 3DTOA 1HFAA 4TWFA 2WS3A 4XAXB 4X65T 2CMRA 1MNDA 2FJEA 3PUXF 4LF5T 3AEBA 3HW9A 4H9OC 1T16A 4FZMA 1OEDC 4JEHB 3MK7C 2EHOB 5JR9C 3AE9A 2KWHA 1SHZC 4OX9T 5TAOA 3NBXX 4ZZCA 1GFQA 3J9X1 3OYZA 4PW8A 2V5CA 2X0HA 2LHNA 5C3JA 2PG8A 2A2FX 4LF7T 2XAFB 3U3IA 3HKCE 4ZI7E 1XDOA 4C4VA 2WBLA 1E2AA 4MBQA 1HXTA 2F1VA 2XE3A 4IHJE 2X9KA 4IE4A 1JNZA 2KZ7A 2LHRA 2K0LA 3EI0A 4JUYA 4U31A 2E5LT 1W0BA 3AEFA 4PFOA 4LFCT 1QJ9A 3UU2A 2V6XA 4ADZA 1KEYA 5HYAA 1GFPA 3FZFB 1MMDA 2XQ3A 5E0OA 3C98B 3AA7B 4FSOA 5LMNT 2LJLA 3CQCB 3ETVA 3PQSA 4N58A 3AA6A 3CVRA 1WRDA 4A97A 3SFDA 4FZNA 4DR4T 3AAEA 3PRNA 2E9XB 5JDHA 2E9XD 4DV1T 2K9AA 4C69X 2W67A 3RIFA 3PUVF 4B6XA 4FZLA 5G3AA 4L0RA 4DV6T 4JI0T 3OVUA 2L8KA 1QUUA 1MMAA 4KUMB 1M62A 5LCYA 2W00A 4ERRA 5FVLA 4H63H 3WAKA 3RIUC 1UX5A 4KI0F 2F1TA 2UUBT 1MMNA 2XAQB 2HH7A 3UU4A 4YTMA 3VE1A 4PK5A 3U78A 5AFUK 2Y7SA 4BA9A 3UAQA 2DHRA 4QXHB 3FZLB 3UQ4A 4H63V 5J2TE 2MHLA 3O1JA 4GOUA 5HXRA 5JDGA 4ZI2D 3ANWA 3PUQA 3PU8A 4AKRA 2Y6XA 3LG7A 4IIJE 3UUBA 2CLYC 4WBNE 2W0GA 4DIDB 1H6S1 2UUAT 2Z6EA 3FZKB 3AXJA 1KF6A 1MMGA 4BUMX 3VU7H 5JDNA 5HEOA 4UIGA 3SS1A 5DL7A 3GWHA 4EYYR 3AAIA 5IHYA 1ZV4X 5GONE 3G7GA 3JC6D 2BVMA 2EHOA 5LGNB 1D1CA 3UPGA 5HXSA 5L3EB 1HNWT 2V6YB 3MA9A 3H3AA 4AQFA 1BXWA 3T1YT 2WJQA 3BQKA 2HHHT 4JCHA 4ZZBA 2NTYA 3J7Yq 2BVLA 1Q9FA 3RX6A 2WM9A 3KV6A 5ABGA 2JJ9A 3TLVA 2YOEA 3QOFA 3PDYA 1QJPA 2JMKA 2C5JA 3EHZA 3QB5A 1QJ8A 4TUYE 2N9DA 5HEUA 5HEHA 4PJ0O 5L2LA 2YDRA 4AI6A 2J4UP 1WLXA 2UUCT 2KC0A 2FJAA 3KVAA 5L3BB 5LGTB 3ZMSB 2WCAA 2IDOB 2NW8A 3B57A 3P8CD 3ZYMA 3PQUA 2D5UA 3C4ZA 2WDVA 3UU8A 2Y8DA 3AA7A 4IL6O 5BMVE 4DVDA 3NRXA 1X79A 4O49A 3ZLIA 3F57A 3ONLC 4HGAA 4IGUA 2M67A 2NOXA 4COFA 3NKZA 2E9XA 2XPKA 1BR2A 2ODVA 3Q5WA 4JI7T 3Q9DA 4AXPA 3RGLA 3N2GE 3RRCA 4HWHA 3NZPA 2W66A 2R4PA 3RKOA 1YXRA 3UT5E 5IYZE 3RBHA 3N2KE 2YEVC 4H9RC 1VCTA 3R84B 5ADXK 4JEUB 2N2NA 4I50E 3SFEA 3ZMZB 2DI4A 4PAGA 4UV8B 2ZFGA 2IW5B 5TISO 5FP3A 3AE1A 3RYHE 3AA1B 3HI2A 2O4VA 1Z0PA 3B5MA 3RI5A 1ZHWA 1D1AA 2OMFA 2JQHA 4KHZF 1HXUA 2M6IA 1I94T 4LSIA 4AZLA 1GFOA 5BR8T 2WU5A 3ZJ1A 5JDQA 1KNRA 2CA5A 2F4VT 4OK0A 4UEMA 3SRZA 3IF8B 2KINB 2WU2A 3ZCJA 3VY9X 2DWGA 2Y48B 3V5SA 3PE0A 2L9QA 5AQJB 3LJCA 3EAMA 3RQWA 3CX7B 2NTXA 4YT0A 1N32T 1Q9GA 3UFGA 2I6HA 3VRBA 5H6QB 3CQGB 2GK9A 5J1GA 4FOZA 3EMNX 1M7KA 4CXYA 3UUXB 5H2FO 2V6YA 4OFZA 3N9PA 2LKGA 3KV9A 2PRNA 4DV0T 1QLBA 3ETUA 2PFVA 5ABHA 4YJ3E 2BG9B 2M6BA 3O4XE 4YXDA 2R4LA 3ONXA 2V7JA 2N1GA 4AYID 3UFEA 5LJMA 2VASA 4EZ4A 3SYSA 4H9QC 3UUMA 1EZ3A 2XSAA 4O3WA 4GKKT 2CXDA 5FVKA 4B3RT 4C91A 3W15B 2JIWA 2V8SV 2EHOC 1HNZT 4YSZA 2CXLA 3PURA 2LM2A 4LMKA 5F3JA 1DU2A 2QA7A 4I0UA 4O3XB 3KVDD 5LYJE 3KZIO 4AQFC 3RYFE 3IEEA 3K3NA 3I1AA 1T72A 4WZXA 2X9WA 2H89A 2KXPB 3FBLA 1G8XA 2XAGB 1QSDA 2YDSA 2PJQA 3HWBA 3RF1A 4TV9E 5G26A 1VOMA 2A9UA 3X1DA 3ZN1B 2A72A 4IREA 3I9WA 4ZHQE 4LF6T 2VQFT 2CBIA 1KK7A 2DLRA 4O4JE 2UXXB 5IWAT 4CXXA 2CWYA 3AE3A 2VL8A 3FXDB 1V9DA 2CRBA 2J1NA 1S94A 5LP6E 2V1DB 2IAKA 1KFYA 1G73A 2XASB 2BS3A 3EVYA 2X0YA 2JQYA 4DV7T 2NW7A 4C00A 4H9PC 5DQVA 1MM5A 3H37A 3AA1A 2E9XC 1J1JA 1PHOA 1WR0A 2DWKA 3ZJ2A 5DL8A 3JTYA 2VB6A 3ZCIA 3F2EA 2OA5A 2LSKA 3SYBA 3K3QC 2LLYA 4UVBB 3SY7A 1T8BA 3A5XA 3UUNA 2VKDA 1MIYA 4ASKA 1YKEB 3N2OA 3AEGA 2YNKA 3C4XA 2XTQA 3FXEB 3ZT5A 5FY1A 3P4WA 5CFBA 5KX5E 1J5ET 1WR6A 2LSJA 4GK0E 3ZSTA 2D0TA 3AB3B 2ERVA 1UK5A 1PRNA 3NRYA 2YK0A 3P4SA 4DR2T 3H3MA 3RYIE 2DNXA 2BS4A 2A3DA 5LB7B 3P7IA 1FEWA 4ZI2C 5CA0E 5J2UE 2R6GF 2D0UA 2LE8A 1AJ3A 2X51A 4X1IE 5EK3A 2BS2A 3ZMUB 4CI3B 2LKHA 2ZM6T 3I0QA 1UUSA 2LSYA 5C2TA 4Z91A 2JMMA 2BDEA 2BG9A 1S35A 4H9NC 4G75A 1W9RA 4JI4T 2ZLDA 3ZC1A 2XQ6A 3TZGA 4CQIA 4DMWA 5CGMA 5LMUT 3PUSA 3MKDA 1OWAA 4U33A 4IE0A 2K4TA 1MPFA 2G0UA 2W81C 5FXVA 3TLTA 4EEDA 2BBHA 2XQAA 2AXTO 3C64A 4ILBA 3LBXB 1Y64B 4QXCB 1XZYA 4TX5A 5EZYE 2XJ7A 4P0BA 4A56A 3V5UA 1FMWA 2KXPA 4NUUA 2V7KA 3C4WA 3EABA 4HFDA 2Q9QA 3GP6A 4G76A 3WI4A 4PJLA 4YSXA 4HFVA 5LNKA 1JNRA 2KDYA 4DV3T 1GFMA 3AEEA 3N9OA 5LGUB 3F31A 4OYKA 3RC8A 4NXMT 2OV9A 3BK9A 3C51A 4X1KE 3A0HO 4P09A 2JQQA 4ILUA 2BKOA 1UURA 4HWDA 4ZXLA 4IDPA 5FYMA 4EOZB 4X66T 4E1SA 4KP3C 3A7MA 1IJ5A 2LRKA 2PTFA 3QUJA 2WMOA 2WP9A 4K0UA 4IDOA 4ZEYA 3NSGA 2ACZA 2HN2A 2ZLYA 4WW0A 3GA8A 4JI3T 5FXXA 2W63A 3POXA 2RPAA 5G38A 4H9SE 5A1LA 3L3PA 1XNQT 2XAHB 2AE9A 4GHBA 3QRAA 4HFCA 5E79O 3O9XA 2QRXA 2ES0A 4G63A 4HKAA 3Q5DA 2ODUA 2Y0LA 3L8RA 5AQLB 4EXTA 4AYEC 5IUXA 2KWIB 3K1SA 2D2SA 2LHFA 3VRAA 3K3OA 4QX8B 3LK41 4HFEA 5DL5A 3DJBA 5JTGA 1HX8A 1YW0A 2ZM2A 5KMGP 5GTHO 1ORMA 4ZI3D 5DABA 2YU1A 2M07A 4NUVA 4PUXA 4DBQA 3VHLA 2WB5A 3TLSA 5FNVE 3ZMVB 4I4TE 4QXBB 4Z90A 5LHIB 4LF4T 2XSBA 1LVFA 5AQIB 2X9HA 2YDQA 1I6ZA 5AQTB 5KXJA 3CWZB 3AE2A 1IZNB 3PUZF 1N34T 2CWOA 2MPKA 3VKGA 1T98A 5C8YE 2OLTA 5JRCB 2R4OA 2FGQX 4B3TT 3V8UA 4MLKA 1HR0T 4PK4A 4DR1T 4D64A 3RHWA 2DCFA 3BQIA 1J5WA 5AQRB 3N5LA 2NP9A 1IBLT 4E7SA 2ODJA 3QNUA 4DUYT 2VQET 2XMXA 4P1NA 1MIVA 1FIOA 5L3DB 3N9LA 2W4XA 2WZHA 2M06A 1U4QA 4KMCA 2VVSA 5LJNA 2PBIA 3LBXA 2CE7A 4LMJA 2BBJA 2IUBA 2BG9C 2J62A 4EZHA 4PFPA 4WYVA 3PGSA 1X9BA 2X9XA 4MALA 3JADA 3PJAJ 4U7IA 2MYSA 2QYWA 3O1IA 4RLCA 3P4QA 5HXCA 3OKQA 4AISA 1XWMA 1KNPA 3CX6B 3SZDA 4JLEA 3AEDA 3CMLA 2XHEB 3NZQA 4JV5T 4RL9A 5ETWA 3S4UA 1OEDE 1D0XA 5AQPB 2XY8B 2MTQA 4IE7A 2V5DA 4HN9A 4O3YA 2JMHA 7PRNA 3EDVA 4AYMC 3KV4A 3M3ZB 4KBMB 2J47A 3MXZA 2Q9QC 4NPPA 1OPFA 4YY3T 4DO0A 4E1TA 2YU2A 4ILAA 1SA0E 3A8YC 3QRCA 2K24A 5JDLA 4GIWA 4EV6A 3O1HA 3HKEE 2BKPA 2VKHA 3MZKB 5HWXA 5FVNA 1ZOYA
chains in the Genus database with same CATH topology
2WBLA 1CUNA 2CM0A 4MBQA 3IBPA 1HXTA 2F1VA 2XE3A 3WI5A 4B61A 3I9WA 4IHJE 4ZHQE 4KR8A 4UV9B 5L3FB 4IE4A 2KMFA 3E22E 5EK2A 2KZ7A 1KK7A 1D0YA 2DLRA 4O4JE 2UXXB 2LHRA 2ZM8A 3PU3A 2K0LA 4JUYA 8PRNA 4CXXA 2CWYA 1BH3A 1MNEA 1E1HB 2IC6A 4YJ2E 4PFOA 2VL8A 1THQA 1QJ9A 3FXDB 3UU2A 3VZWX 4TV8E 3FB2A 4FRXA 2NWBA 1V9DA 2V26A 4ADZA 5HYAA 2J1NA 1GFPA 3AA0B 1MMDA 3HA4A 1S94A 5LP6E 2V1DB 2XUEA 2IAKA 1G73A 2XASB 3C98B 5E0OA 4GCPA 2C0SA 3EVYA 5EE2A 3AA7B 2NW7A 4U72A 4FSOA 2LJLA 5KDMC 5L3GB 4XBFB 4H9PC 5DQVA 3VKHA 2KLQA 3AAAB 3CQCB 3H37A 2E9XC 1MM5A 2QTKA 3AA1A 3ETVA 3PQSA 2RA1A 4N58A 1PHOA 2DWKA 3CVRA 4UELA 1WRDA 3ZJ2A 1P4TA 3AA6A 4F6RC 4XNLA 4HE8A 5DL8A 1UX4A 3JTYA 2VB6A 3ZCIA 4FZNA 3F2EA 3AAEA 3PRNA 2E9XB 2OA5A 5LBMA 4EYUA 1IZNA 1LKXA 5JDHA 2LOPA 1BR4A 2E9XD 2HPLA 2LSKA 3SYBA 3K3QC 4O4XA 4UVBB 4BJNA 3SY7A 4I43B 3CQXC 1VRBA 5LBQB 3RYCE 3AVSA 3A5XA 3UUNA 2VKDA 1HTJF 2K9AA 4C69X 5JRCA 1ZEEA 2X67A 1MIYA 5ADXL 4B6XA 5LG4A 2Y2XA 4IE6A 4FZLA 4ASKA 2FGRA 1YKEB 5M4YA 4L0RA 3N2OA 3UTKA 2YNKA 3C4XA 2XTQA 3LK3B 2L8KA 3FXEB 1QUUA 2JRKA 1MMAA 4KUMB 2MNHA 5FY1A 3PUGA 5LCYA 2X66A 5F8PA 2W00A 1NAFA 3K8PC 4MHCA 5KX5E 4AYNA 4ERRA 4H63H 4X1YE 3WAKA 1UX5A 1WR6A 2LSJA 4GK0E 2F1TA 5LHGB 3MACA 4EIWA 1HG2A 4O2BE 2D0TA 1MMNA 2XAQB 3AB3B 2HH7A 2ERVA 3GN5A 1PRNA 3VE1A 4LSFA 4PK5A 3NRYA 3PORA 2YK0A 3U78A 5AFUK 4DBRA 2XE1A 5HXEA 2Y7SA 4BA9A 3UAQA 3RYIE 2DNXA 2A3DA 2DHRA 4QXHB 3TKLB 3P7IA 3WAJA 4PJJA 1FEWA 4ZI2C 5CA0E 3FHNA 5J2UE 4O4LE 1ZKEA 3D0TA 2W80C 3RRWA 4CI2B 1HS7A 2D0UA 2LE8A 4H63V 1IAPA 3T20A 5J2TE 1AJ3A 2MHLA 2X51A 5HAXA 2WMNA 3O1JA 4X1IE 2VKJA 5EK3A 4GOUA 3ZC0A 2X68A 5HXRA 5JDGA 4ZI2D 5FMNA 4AKHA 2XTRA 3ZMUB 4CI3B 5CA1E 3Q5XA 2XE5A 3I0QA 3ANWA 1MM4A 2LSYA 3PUQA 3T0SA 2JMMA 3POQA 2BDEA 3PU8A 3E0ZA 4AKRA 5HWYA 4DNDA 1S35A 4H9NC 2Y6XA 3LG7A 3SY9A 4IIJE 4G75A 2LSIA 2CLYC 3WI3A 5GV0A 3C50A 4WBNE 2W0GA 4O4IE 2LFUA 2I59A 2ZLDA 3ZC1A 1H6S1 3C5OA 1D1BA 1IJ6A 2Z6EA 4CQIA 4EB6E 4DMWA 3TZGA 2LM9A 2CLYB 3PUSA 4D5UA 1MMGA 2W61A 4AKIA 3KVBA 3MKDA 1OWAA 2CCQA 3VU7H 4BUMX 3GMIA 5JDNA 4IE0A 4GF4A 2P9BA 2C5KT 4UIGA 3SS1A 4L9IA 3GWHA 4EYYR 5DL7A 2K4TA 3AAIA 1MPFA 5IHYA 2G0UA 3KBUA 2W81C 3KINB 1ZV4X 5FXVA 5H6RB 3ZMTB 3VY8X 5GONE 3G7GA 4FT6A 3JC6D 5DJQC 2BVMA 2EHOA 1GFNA 5LGNB 1D1CA 3UPGA 5HXSA 5L3EB 3ZYLA 3C64A 3LBXB 1Y64B 4C90A 4QXCB 4UF0B 3I9YA 5JQGE 4TX5A 3MA9A 3H3AA 5EZYE 5JR9A 4P0BA 4A56A 4AQFA 1BXWA 3V5UA 1LRZA 1FMWA 3MJXA 2KXPA 3BQKA 4HTEA 4JCHA 4NUUA 2V7KA 4PJMA 3C4WA 3T8OA 2ZM0A 2NTYA 3J7Yq 2Q9QA 3GP6A 4G76A 3WI4A 2BVLA 3POUA 4M1PA 4PJLA 1Q9FA 3RX6A 4HFVA 5LNKA 2WM9A 2KDYA 2Y0KA 3KV6A 2LOSA 4KR4A 2JJ9A 1GFMA 3N9OA 2K5BB 5LGUB 3PDYA 2XTLA 4U9CA 3F31A 1QJPA 2JMKA 4XNKA 4TN7B 2BZBA 4WBOA 2C5JA 1QJ8A 5L3CB 4OYKA 4TUYE 3HL6A 2N9DA 4AKGA 3CX8B 3RC8A 4P0AA 4QHOA 2GE4A 3KV5A 3BK9A 3RPUA 3C51A 3K19A 3IHRA 4X1KE 5HXHA 5L2LA 3CKDA 4AI6A 4OYJA 5CB4E 4FUVA 2J4UP 2WSSV 4P09A 5JDFA 2JQQA 4ILUA 3DP7A 1WLXA 4GYSA 2X27X 4MFRA 2KC0A 2N2LA 1UCUA 2CEAA 2WAUA 3KVAA 5L3BB 3LFMA 5FYMA 4EOZB 5LGTB 3ZMSB 4E1SA 4KP3C 1ZHCA 3FYXA 1IJ5A 3B13A 3QC9A 3HKDE 2NW8A 4YFSA 3B57A 2X9YA 3P8CD 4CZZB 3OBVE 4QQ1A 3QUJA 3ZYMA 3PQUA 2WMOA 4JFBA 2JPFA 1OSMA 4K0UA 3VZTX 2D5UA 3AA0A 3DA4A 2PORA 3NSGA 2CXFA 2Y0HA 2VWAA 3C4ZA 4ISSA 3RH3A 4PNIA 2ZLYA 3LK42 2XAJB 3GA8A 4WW0A 5FXXA 2W63A 1E54A 3POXA 4PK6A 2Y8DA 3AA7A 4H9SE 4WNKA 5A1LA 5BMVE 4DVDA 2ACXA 3L3PA 3NRXA 4TZ4C 4FRTA 2XAHB 1X79A 3AAAA 4O49A 4Z3TA 3KBTA 3ZLIA 4GHBA 2YPVA 3F57A 3QRAA 5JDMA 4HGAA 4IGUA 2M67A 3ZEFB 2LSGA 3O0EA 3LK2B 2NOXA 3O9XA 1OXZA 2ES0A 4G63A 4HKAA 2E9XA 3AVRA 2ODUA 2Y0LA 1BR2A 1HCIA 2ODVA 2YINA 4KRAA 3Q5WA 4O3ZA 3Q9DA 4IE5A 2H7OA 4UVCB 4EXTA 1ZHXA 4AFKA 4AYEC 4RJWA 2IC9A 4AXPA 2KZ7B 3N2GE 2KWIB 4DMVA 2XQYA 2D2SA 3RRCA 2LHFA 3NZPA 4N59A 3RKOA 3A2SX 3K3OA 2SPCA 4QX8B 4QKNA 3UT5E 4LSHA 3LK41 3N9MA 1WYCA 3N2KE 5IYZE 3RBHA 4F4BA 2YEVC 4ZI3C 5DL5A 4H9RC 4PJNA 3DJBA 4O2AE 4HEAA 5FY7A 3R84B 2N2MA 3LK3A 1HX8A 2VK9A 2EHOD 5ADXK 1YW0A 4JEUB 4GYRA 2ZM2A 4FMSA 5KMGP 2N2NA 4X20E 3CPZA 4AYDC 4I50E 4OHFA 4BAYB 1ORMA 4ZI3D 5DABA 2YU1A 1BR0A 3ZYKA 2VKOA 3ZMZB 2M07A 4NUVA 4PUXA 4DBQA 2DI4A 3HKBE 2KNDA 3VHLA 2KT9A 3JC6C 5FNVE 2Q9QB 3ZMVB 3QK6A 2MBGA 4I4TE 4PAGA 4QXBB 1YS5A 4O4HE 4FJOA 4UV8B 3PUAA 2Q9QD 5JVDE 3Q2MA 2ZFGA 5LHIB 2IW5B 1LVFA 5FP3A 4GK5E 4AKMA 2MOZA 2X9HA 3RYHE 3AA1B 3HI2A 2O4VA 4FI5A 1Z0PA 1U5PA 2L3LA 3AA6B 5DQWA 4GCSA 1BT9A 4E7ZA 1HXXA 2E8IA 3BQLA 1ZHWA 1MIWA 1D1AA 1ZHTA 3CWZB 2QGSA 3AAEB 2OMFA 5T5FA 4EAHA 1IZNB 2H3RA 3KFWX 4V1Av 1HXUA 2CWOA 4LSIA 1GFOA 4AZLA 3ZJ1A 3VKGA 1T98A 5C8YE 2WWUA 5JDQA 2C5IT 5JRCB 1YD8G 3ZN0B 2CA5A 5FXWA 1LVKA 4XZCA 3ZPOA 4GCQA 5DL6A 1FMVA 2B1EA 1O3XA 4OK0A 4ZS3A 1D0ZA 2FGQX 4UEMA 3SRZA 3IF8B 2KINB 3V8UA 4MLKA 4PK4A 3ZCJA 1KNZA 3VY9X 2DWGA 2Y48B 3V5SA 5D5DA 4D64A 2V7LA 3M65A 2L9QA 3PE0A 5LHHB 2DCFA 4J2CA 3LJCA 3HOEA 1HF8A 2V7IA 3SWHA 3E08A 1WYBA 3CX7B 5FXZA 3BQIA 3SOLA 4I55E 3EDUA 5AFUL 3N5LA 2NP9A 4ISTA 2NTXA 4O4UA 3VE2A 4E7SA 5JDPA 2X0LB 5LA6E 4Z8XA 3EUHA 3GN5B 5JH7E 1Q9GA 2ODJA 4AQGA 3VZUX 4AUIA 2XMXA 2V7MA 2ZMAA 3PTRB 1YKHB 1MIVA 4IDZA 5H6QB 3HR0A 4RLBA 1BR1A 3CQGB 2GK9A 5EK4A 1FIOA 4QX7B 5J1GA 4FOZA 3T24A 3EMNX 4ZI7E 2LEHA 5L3DB 3N9LA 2M06A 4AKLA 1U4QA 3KDSE 4CXYA 4D65A 5IYUA 4KMCA 5LJNA 3UUXB 4ZOLE 2PBIA 3LBXA 2CE7A 4UF0A 4FESA 2K48A 4OFZA 3ESLA 2W62A 3N9PA 5LXTE 3KV9A 2NW9A 4CXWA 4PFPA 4EZHA 3RC3A 2PRNA 3ANWB 2XE2A 4O8SA 3ETUA 4LSEA 2PFVA 4YJ3E 4CI1B 2H7VC 2X9XA 3I0OA 4MALA 4YHJA 4AKRB 3N9QA 4ANJA 3DA3A 3O4XE 4RJXA 4BJMA 3ONXA 2V7JA 5PRNA 2N1GA 2MYSA 4AYID 4G2AA 3UFEA 4L5GA 3O1IA 2HPJA 2VASA 5LJMA 4RLCA 1ZHZA 5HXCA 4FSPA 4EZ4A 3SYSA 3OKQA 4H9QC 3UUMA 3OJAA 3FBZA 3CX6B 5FY0A 3SZDA 4JLEA 1EZ3A 4QWNB 4O3WA 3DTOA 1HFAA 2CXDA 3CMLA 4YLHA 4C91A 2XHEB 2XG6A 5LOVE 3NZQA 4XAXB 4RL9A 4UXNB 5ETWA 3W15B 2CMRA 2UXNB 3S4UA 3HOLA 2EHOC 1D0XA 1MNDA 2CXLA 2MTQA 3PURA 4H9OC 4IE7A 5JREA 4ZS2A 3HW9A 4HN9A 1H7CA 4O3YA 2JMHA 3R6NA 5F3JA 4FZMA 4JEHB 7PRNA 3MK7C 2QA7A 3EDVA 4AYMC 3KV4A 3L09A 2EHOB 5JR9C 3KVDD 4O3XB 5LYJE 4AQFC 3N9NA 4KBMB 2KWHA 3OYXA 1SHZC 3MXZA 3RYFE 1HG5A 3IEEA 2J1DG 5JR9B 2Q9QC 3K3NA 3I1AA 4UVAB 2X9WA 1NWMX 2KXPB 1OPFA 4U74A 3FBLA 1G8XA 4N78D 1ZHYA 2XAGB 5TAOA 4DO0A 3NBXX 1QSDA 2YU2A 2PJQA 1GFQA 3J9X1 3HWBA 5G26A 4TV9E 2RP4A 4E1TA 1VOMA 1SA0E 3QRCA 6PRNA 2K24A 2LT3A 5JDLA 3SZVA 3OYZA 4PW8A 4GIWA 2LHNA 1G90A 3O1HA 3HKEE 2PG8A 2A2FX 1US7B 2XAFB 3U3IA 3ZN1B 2VKHA 2A72A 1B7TA 3MZKB 5HWXA 3HKCE 5FVNA 3UULA 3LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE B;  3AAE A;  1IZN B;  1IZN A;  5AFU L;  3AA0 B;  3AA0 A;  2KXP B;  2KXP A;  2KZ7 B;  2KZ7 A;  3LK4 2;  5AFU K;  4AKR B;  4AKR A;  5ADX L;  3AA7 B;  3AA7 A;  3LK4 1;  3AAA B;  3AA1 B;  3AA1 A;  3AAA A;  3LK3 B;  3LK3 A;  3AA6 B;  3AA6 A;  5ADX K;  3LK2 B;  3LK2 A; 
#chains in the Genus database with same CATH topology
 4AQY T;  4UV9 B;  5L3F B;  5EK2 A;  3E22 E;  3PU3 A;  3VR9 A;  8PRN A;  1BH3 A;  1MNE A;  1E1H B;  2KSR A;  4YJ2 E;  4TNW A;  1THQ A;  3FB2 A;  4FRX A;  3AA0 B;  3HA4 A;  2IIU A;  4JI1 T;  4GCP A;  2XQ5 A;  5L4E A;  4B3S T;  2KLQ A;  2QTK A;  2AXD S;  2HN1 A;  1WCR A;  2RA1 A;  4UEL A;  4XNL A;  4F6R C;  1UX4 A;  5LBM A;  4EYU A;  1IZN A;  1LKX A;  2LOP A;  4BJN A;  4I43 B;  1VRB A;  3RYC E;  3AVS A;  5JRC A;  1ZEE A;  2Y2X A;  5M4Y A;  3UTK A;  3IA3 A;  2JRK A;  5HCM A;  2MNH A;  5F8P A;  1NAF A;  4AYN A;  2IML A;  4K3C A;  4O2B E;  4GKJ T;  2WQY A;  4EEB A;  3FHN A;  4O4L E;  1YQ3 A;  4CN1 A;  3RRW A;  4CI2 B;  5AQN B;  1HS7 A;  5AQH B;  3UQ7 A;  5HAX A;  2WMN A;  3ZC0 A;  2VKJ A;  3PV0 F;  2XQ4 A;  5FMN A;  4AKH A;  3OTO T;  3Q5X A;  2XE5 A;  1MM4 A;  3POQ A;  1SE7 A;  3SY9 A;  3LDQ B;  5GV0 A;  3C50 A;  2XQ8 A;  5L47 A;  4O4I E;  1XNR T;  1IJ6 A;  2UXD T;  2W61 A;  3KVB A;  1SUM B;  1CHU A;  4GF4 A;  2P9B A;  2C5K T;  4L9I A;  4TNV A;  2XQ7 A;  3AE5 A;  3KBU A;  2WVP A;  3ZMT B;  5L4H A;  3AE7 A;  5DJQ C;  5AQU B;  1GFN A;  4QH5 A;  3PUW F;  3I9Y A;  2D9D A;  2UXC T;  4UR9 A;  3MJX A;  4HTE A;  3T8O A;  5FL0 A;  2ZM0 A;  3BS0 A;  3POU A;  4M1P A;  2WDQ A;  2YKS A;  4HWF A;  3LSV A;  2LOS A;  3UU3 A;  2XM1 A;  1L0V A;  4XNK A;  4TN7 B;  2BZB A;  4WBO A;  4AKG A;  3HL6 A;  5HCJ A;  3CX8 B;  5FL1 A;  3RQU A;  3KV5 A;  3RPU A;  3IHR A;  5HXH A;  4OYJ A;  4DUZ T;  2WSS V;  3A0B O;  3DP7 A;  4GYS A;  4MFR A;  2N2L A;  4IT4 A;  2WAU A;  1Y01 A;  3LFM A;  2VUR A;  1ZHC A;  3B13 A;  3QC9 A;  3HKD E;  4YFS A;  2CBJ A;  4JFB A;  3VZT X;  5AQO B;  3AA0 A;  3DA4 A;  5ABE A;  2POR A;  2Y0H A;  3RH3 A;  5KAI O;  1VCS A;  3LK4 2;  3CIR A;  3DWN A;  2R8A A;  4PK6 A;  4TZ4 C;  5AQG B;  4Z3T A;  5JDM A;  5AQK B;  2LSG A;  3LK2 B;  1OXZ A;  4U3C A;  1YQ4 A;  3AVR A;  2I0M A;  2XZE A;  2YIN A;  1HCI A;  4KRA A;  4O3Z A;  1ZHX A;  4AFK A;  5ABF B;  2IC9 A;  4DMV A;  2XQY A;  4U2Y A;  3A2S X;  4LSH A;  4QKN A;  1IBM T;  2FJB A;  3N9M A;  4ZI3 C;  5KAF O;  4PJN A;  4O2A E;  1UGO A;  4HEA A;  2N2M A;  1XMQ T;  2VK9 A;  2EHO D;  3AE8 A;  4X20 E;  4AYD C;  1BR0 A;  3ZYK A;  2JQK A;  2WJR A;  3HKB E;  5AQM B;  3JC6 C;  4DR6 T;  1YS5 A;  4FJO A;  5JVD E;  3Q2M A;  1HNX T;  2UXB T;  1U5P A;  2L3L A;  1R8I A;  2XM2 A;  4DR7 T;  4E7Z A;  1HXX A;  2E8I A;  1ZHT A;  4HFI A;  5T5F A;  2QGS A;  4V1A v;  4X5T A;  4DV2 T;  1XDP A;  2WWU A;  2C5I T;  3ZN0 B;  5FXW A;  4GCQ A;  1LVK A;  4XZC A;  3ZPO A;  5DL6 A;  2IWW A;  3NJT A;  3FZM B;  1KNZ A;  3AE6 A;  4K0K T;  3BRZ A;  4LFA T;  3WU2 O;  3HOE A;  3SWH A;  5AFU L;  2IWV A;  4O4U A;  4IST A;  3VE2 A;  4NXN T;  4IL4 A;  2X0L B;  5LA6 E;  3GN5 B;  3VZU X;  4AUI A;  1FJG T;  3T1H T;  3Q5E A;  4IDN A;  2ZMA A;  1YKH B;  4IDZ A;  3RKG A;  5EK4 A;  3P4P A;  4JI2 T;  4AKL A;  5IYU A;  4D65 A;  2MAW A;  2WY2 A;  2K48 A;  3ESL A;  2W62 A;  4CN4 A;  4CXW A;  2XE2 A;  4O8S A;  4LSE A;  4YHJ A;  3DA3 A;  4ANJ A;  3P50 A;  1GQE A;  3G06 A;  4G2A A;  2HPJ A;  2W2U A;  5AQF B;  3ZKR A;  2FJD A;  4A98 A;  2B76 A;  3NVO A;  4QWN B;  3ZT7 A;  3AEA A;  4YLH A;  2XG6 A;  2E2A A;  5LOV E;  3JCU O;  4UXN B;  3HOL A;  2UXN B;  2E5V A;  3VR8 A;  5HEJ A;  5JRE A;  4ZS2 A;  1H7C A;  3R6N A;  1E7P A;  3L09 A;  2VL0 A;  3N9N A;  3OYX A;  1OED B;  1HG5 A;  2J1D G;  5JR9 B;  4UVA B;  1NWM X;  4X64 T;  4JI8 T;  4U74 A;  4KHP T;  4N78 D;  1ZHY A;  2RP4 A;  6PRN A;  4DV5 T;  3BRY A;  4N75 A;  2LT3 A;  3SZV A;  1G90 A;  4IL9 A;  1US7 B;  1B7T A;  3DWO X;  3UUL A;  3LK2 A;  3UU5 A;  1CUN A;  2CM0 A;  3IBP A;  3WI5 A;  4B61 A;  4KR8 A;  5ABF A;  2KMF A;  1D0Y A;  2ZM8 A;  5AQV B;  4UB8 O;  4CN6 A;  5B5E O;  2CHO A;  2R88 A;  2IC6 A;  3VZW X;  4TV8 E;  2JQ9 A;  2NWB A;  2V26 A;  2WDR A;  2FBW A;  3ONJ A;  2XUE A;  5B66 O;  3JAF A;  2C0S A;  4F8H A;  5EE2 A;  4JBW F;  4LF8 T;  1WFD A;  4U72 A;  5KDM C;  5L3G B;  4HFB A;  4XBF B;  3VKH A;  3AAA B;  1ZP0 A;  4HWC A;  1P4T A;  4HE8 A;  4KX6 A;  4TWH A;  1BR4 A;  2HPL A;  4O4X A;  5LBQ B;  3CQX C;  1HTJ F;  2X67 A;  5ADX L;  5LG4 A;  4IE6 A;  2FGR A;  3LK3 B;  3PUG A;  2X66 A;  3K8P C;  4MHC A;  2R4N A;  4X1Y E;  4A5X A;  5LG3 A;  4YTN A;  2DL1 A;  2UU9 T;  5LHG B;  3MAC A;  4EIW A;  1HG2 A;  4LF9 T;  4U2Z A;  3GN5 A;  4LSF A;  4DBR A;  2XE1 A;  5HXE A;  3TKL B;  3WAJ A;  2XQ9 A;  4PJJ A;  4N74 A;  4DR5 T;  1ZKE A;  2WWV A;  3D0T A;  2W80 C;  4YTP A;  1IAP A;  3T20 A;  4U7Y A;  5J0Z A;  3POR A;  4FQE A;  2X68 A;  2XTR A;  5CA1 E;  3T0S A;  3RLF F;  3E0Z A;  2J4G A;  5HWY A;  4DND A;  4TWD A;  2LSI A;  5HEG A;  3WI3 A;  4NIQ A;  2LFU A;  2I59 A;  3C5O A;  4QH4 A;  4PR7 A;  1D1B A;  2K3W A;  4EB6 E;  3ABV A;  2LM9 A;  2CLY B;  4D5U A;  2CHN A;  4AKI A;  3TLW A;  2CCQ A;  3CK6 A;  3GMI A;  1N33 T;  3DZM A;  3PGU A;  3JCF A;  2IHR 1;  3KIN B;  5H6R B;  4HWI B;  5GTI O;  3VY8 X;  4FT6 A;  3ZYL A;  4C90 A;  1OED A;  4UF0 B;  5JQG E;  3PUY F;  5FKY A;  5JR9 A;  4DR3 T;  1LRZ A;  4PJM A;  4HFH A;  3UU6 A;  3TLU A;  4K3B A;  2YN6 A;  2Y0K A;  4UB6 O;  4KR4 A;  2K5B B;  3FZH B;  2XTL A;  1S5L O;  4U9C A;  3QB5 K;  5L3C B;  1T1L A;  4P0A A;  4QHO A;  2GE4 A;  3K19 A;  2WZI A;  3CKD A;  3AE4 A;  5AQS B;  5CB4 E;  4FUV A;  5JDF A;  2X27 X;  1W09 A;  1UCU A;  2CEA A;  4AIU A;  2BKN A;  2LRL A;  4Q25 A;  3PGR A;  3FYX A;  4QH1 A;  3NWI A;  2CPT A;  2X9Y A;  4CZZ B;  3OBV E;  4QQ1 A;  4X62 T;  3JAE A;  2JPF A;  1OSM A;  1XMO T;  2CXF A;  2VWA A;  4ISS A;  4PNI A;  2XAJ B;  2NR4 A;  1E54 A;  3PJA A;  4WNK A;  2ACX A;  4FRT A;  4CTD A;  5G39 A;  3ZSS A;  3AAA A;  3P4R A;  3KBT A;  2YPV A;  2QVA A;  4JI5 T;  3ZEF B;  3O0E A;  4C4V B;  4DV4 T;  5CJ5 A;  4IE5 A;  2H7O A;  4UVC B;  4RJW A;  2KZ7 B;  4N59 A;  2SPC A;  1WYC A;  4F4B A;  3OPC A;  5FY7 A;  3LK3 A;  4GYR A;  4FMS A;  4YSY A;  3CPZ A;  4OHF A;  4BAY B;  2VKO A;  1N36 T;  2KND A;  2KT9 A;  3ZT6 A;  2Q9Q B;  3QK6 A;  2MBG A;  3RIU A;  4O4H E;  4IDQ A;  4LFB T;  3PUA A;  2Q9Q D;  1T7S A;  4GK5 E;  2VVN A;  4AKM A;  2MOZ A;  3RIA A;  4FI5 A;  1IBK T;  5DQW A;  3AA6 B;  4GCS A;  1NEN A;  1BT9 A;  3BQL A;  1MIW A;  4EGW A;  3AAE B;  4EAH A;  3PF1 A;  2H3R A;  3KFW X;  3L39 A;  2R89 A;  1YD8 G;  4JI6 T;  1FMV A;  2B1E A;  1HX1 B;  1O3X A;  4ZS3 A;  1D0Z A;  1NEK A;  2F1C X;  2FUP A;  5D5D A;  2V7L A;  3M65 A;  5LHH B;  4LML A;  4J2C A;  1HF8 A;  2V7I A;  3E08 A;  1WYB A;  5FXZ A;  3SOL A;  4I55 E;  3EDU A;  5JDP A;  4Z8X A;  3EUH A;  5F5W A;  5JH7 E;  4AQG A;  2V7M A;  3PTR B;  4RLB A;  3HR0 A;  1BR1 A;  4YHH T;  4QX7 B;  3T24 A;  2LEH A;  3KDS E;  2BG9 E;  4ZOL E;  4B3M T;  4UF0 A;  4FES A;  3AEC A;  5LXT E;  2NW9 A;  3RC3 A;  3ANW B;  4CI1 B;  2H7V C;  3I0O A;  4AKR B;  3N9Q A;  4ILC A;  4RJX A;  4BJM A;  5PRN A;  2H88 A;  4L5G A;  1ZHZ A;  4FSP A;  3OJA A;  5AQQ B;  1Z8U A;  4JYA T;  3FBZ A;  1W0A A;  5FY0 A;  3AXJ B;  3DTO A;  1HFA A;  4TWF A;  2WS3 A;  4XAX B;  4X65 T;  2CMR A;  1MND A;  2FJE A;  3PUX F;  4LF5 T;  3AEB A;  3HW9 A;  4H9O C;  1T16 A;  4FZM A;  1OED C;  4JEH B;  3MK7 C;  2EHO B;  5JR9 C;  3AE9 A;  2KWH A;  1SHZ C;  4OX9 T;  5TAO A;  3NBX X;  4ZZC A;  1GFQ A;  3J9X 1;  3OYZ A;  4PW8 A;  2V5C A;  2X0H A;  2LHN A;  5C3J A;  2PG8 A;  2A2F X;  4LF7 T;  2XAF B;  3U3I A;  3HKC E;  4ZI7 E;  1XDO A;  4C4V A;  2WBL A;  1E2A A;  4MBQ A;  1HXT A;  2F1V A;  2XE3 A;  4IHJ E;  2X9K A;  4IE4 A;  1JNZ A;  2KZ7 A;  2LHR A;  2K0L A;  3EI0 A;  4JUY A;  4U31 A;  2E5L T;  1W0B A;  3AEF A;  4PFO A;  4LFC T;  1QJ9 A;  3UU2 A;  2V6X A;  4ADZ A;  1KEY A;  5HYA A;  1GFP A;  3FZF B;  1MMD A;  2XQ3 A;  5E0O A;  3C98 B;  3AA7 B;  4FSO A;  5LMN T;  2LJL A;  3CQC B;  3ETV A;  3PQS A;  4N58 A;  3AA6 A;  3CVR A;  1WRD A;  4A97 A;  3SFD A;  4FZN A;  4DR4 T;  3AAE A;  3PRN A;  2E9X B;  5JDH A;  2E9X D;  4DV1 T;  2K9A A;  4C69 X;  2W67 A;  3RIF A;  3PUV F;  4B6X A;  4FZL A;  5G3A A;  4L0R A;  4DV6 T;  4JI0 T;  3OVU A;  2L8K A;  1QUU A;  1MMA A;  4KUM B;  1M62 A;  5LCY A;  2W00 A;  4ERR A;  5FVL A;  4H63 H;  3WAK A;  3RIU C;  1UX5 A;  4KI0 F;  2F1T A;  2UUB T;  1MMN A;  2XAQ B;  2HH7 A;  3UU4 A;  4YTM A;  3VE1 A;  4PK5 A;  3U78 A;  5AFU K;  2Y7S A;  4BA9 A;  3UAQ A;  2DHR A;  4QXH B;  3FZL B;  3UQ4 A;  4H63 V;  5J2T E;  2MHL A;  3O1J A;  4GOU A;  5HXR A;  5JDG A;  4ZI2 D;  3ANW A;  3PUQ A;  3PU8 A;  4AKR A;  2Y6X A;  3LG7 A;  4IIJ E;  3UUB A;  2CLY C;  4WBN E;  2W0G A;  4DID B;  1H6S 1;  2UUA T;  2Z6E A;  3FZK B;  3AXJ A;  1KF6 A;  1MMG A;  4BUM X;  3VU7 H;  5JDN A;  5HEO A;  4UIG A;  3SS1 A;  5DL7 A;  3GWH A;  4EYY R;  3AAI A;  5IHY A;  1ZV4 X;  5GON E;  3G7G A;  3JC6 D;  2BVM A;  2EHO A;  5LGN B;  1D1C A;  3UPG A;  5HXS A;  5L3E B;  1HNW T;  2V6Y B;  3MA9 A;  3H3A A;  4AQF A;  1BXW A;  3T1Y T;  2WJQ A;  3BQK A;  2HHH T;  4JCH A;  4ZZB A;  2NTY A;  3J7Y q;  2BVL A;  1Q9F A;  3RX6 A;  2WM9 A;  3KV6 A;  5ABG A;  2JJ9 A;  3TLV A;  2YOE A;  3QOF A;  3PDY A;  1QJP A;  2JMK A;  2C5J A;  3EHZ A;  3QB5 A;  1QJ8 A;  4TUY E;  2N9D A;  5HEU A;  5HEH A;  4PJ0 O;  5L2L A;  2YDR A;  4AI6 A;  2J4U P;  1WLX A;  2UUC T;  2KC0 A;  2FJA A;  3KVA A;  5L3B B;  5LGT B;  3ZMS B;  2WCA A;  2IDO B;  2NW8 A;  3B57 A;  3P8C D;  3ZYM A;  3PQU A;  2D5U A;  3C4Z A;  2WDV A;  3UU8 A;  2Y8D A;  3AA7 A;  4IL6 O;  5BMV E;  4DVD A;  3NRX A;  1X79 A;  4O49 A;  3ZLI A;  3F57 A;  3ONL C;  4HGA A;  4IGU A;  2M67 A;  2NOX A;  4COF A;  3NKZ A;  2E9X A;  2XPK A;  1BR2 A;  2ODV A;  3Q5W A;  4JI7 T;  3Q9D A;  4AXP A;  3RGL A;  3N2G E;  3RRC A;  4HWH A;  3NZP A;  2W66 A;  2R4P A;  3RKO A;  1YXR A;  3UT5 E;  5IYZ E;  3RBH A;  3N2K E;  2YEV C;  4H9R C;  1VCT A;  3R84 B;  5ADX K;  4JEU B;  2N2N A;  4I50 E;  3SFE A;  3ZMZ B;  2DI4 A;  4PAG A;  4UV8 B;  2ZFG A;  2IW5 B;  5TIS O;  5FP3 A;  3AE1 A;  3RYH E;  3AA1 B;  3HI2 A;  2O4V A;  1Z0P A;  3B5M A;  3RI5 A;  1ZHW A;  1D1A A;  2OMF A;  2JQH A;  4KHZ F;  1HXU A;  2M6I A;  1I94 T;  4LSI A;  4AZL A;  1GFO A;  5BR8 T;  2WU5 A;  3ZJ1 A;  5JDQ A;  1KNR A;  2CA5 A;  2F4V T;  4OK0 A;  4UEM A;  3SRZ A;  3IF8 B;  2KIN B;  2WU2 A;  3ZCJ A;  3VY9 X;  2DWG A;  2Y48 B;  3V5S A;  3PE0 A;  2L9Q A;  5AQJ B;  3LJC A;  3EAM A;  3RQW A;  3CX7 B;  2NTX A;  4YT0 A;  1N32 T;  1Q9G A;  3UFG A;  2I6H A;  3VRB A;  5H6Q B;  3CQG B;  2GK9 A;  5J1G A;  4FOZ A;  3EMN X;  1M7K A;  4CXY A;  3UUX B;  5H2F O;  2V6Y A;  4OFZ A;  3N9P A;  2LKG A;  3KV9 A;  2PRN A;  4DV0 T;  1QLB A;  3ETU A;  2PFV A;  5ABH A;  4YJ3 E;  2BG9 B;  2M6B A;  3O4X E;  4YXD A;  2R4L A;  3ONX A;  2V7J A;  2N1G A;  4AYI D;  3UFE A;  5LJM A;  2VAS A;  4EZ4 A;  3SYS A;  4H9Q C;  3UUM A;  1EZ3 A;  2XSA A;  4O3W A;  4GKK T;  2CXD A;  5FVK A;  4B3R T;  4C91 A;  3W15 B;  2JIW A;  2V8S V;  2EHO C;  1HNZ T;  4YSZ A;  2CXL A;  3PUR A;  2LM2 A;  4LMK A;  5F3J A;  1DU2 A;  2QA7 A;  4I0U A;  4O3X B;  3KVD D;  5LYJ E;  3KZI O;  4AQF C;  3RYF E;  3IEE A;  3K3N A;  3I1A A;  1T72 A;  4WZX A;  2X9W A;  2H89 A;  2KXP B;  3FBL A;  1G8X A;  2XAG B;  1QSD A;  2YDS A;  2PJQ A;  3HWB A;  3RF1 A;  4TV9 E;  5G26 A;  1VOM A;  2A9U A;  3X1D A;  3ZN1 B;  2A72 A;  4IRE A;  3I9W A;  4ZHQ E;  4LF6 T;  2VQF T;  2CBI A;  1KK7 A;  2DLR A;  4O4J E;  2UXX B;  5IWA T;  4CXX A;  2CWY A;  3AE3 A;  2VL8 A;  3FXD B;  1V9D A;  2CRB A;  2J1N A;  1S94 A;  5LP6 E;  2V1D B;  2IAK A;  1KFY A;  1G73 A;  2XAS B;  2BS3 A;  3EVY A;  2X0Y A;  2JQY A;  4DV7 T;  2NW7 A;  4C00 A;  4H9P C;  5DQV A;  1MM5 A;  3H37 A;  3AA1 A;  2E9X C;  1J1J A;  1PHO A;  1WR0 A;  2DWK A;  3ZJ2 A;  5DL8 A;  3JTY A;  2VB6 A;  3ZCI A;  3F2E A;  2OA5 A;  2LSK A;  3SYB A;  3K3Q C;  2LLY A;  4UVB B;  3SY7 A;  1T8B A;  3A5X A;  3UUN A;  2VKD A;  1MIY A;  4ASK A;  1YKE B;  3N2O A;  3AEG A;  2YNK A;  3C4X A;  2XTQ A;  3FXE B;  3ZT5 A;  5FY1 A;  3P4W A;  5CFB A;  5KX5 E;  1J5E T;  1WR6 A;  2LSJ A;  4GK0 E;  3ZST A;  2D0T A;  3AB3 B;  2ERV A;  1UK5 A;  1PRN A;  3NRY A;  2YK0 A;  3P4S A;  4DR2 T;  3H3M A;  3RYI E;  2DNX A;  2BS4 A;  2A3D A;  5LB7 B;  3P7I A;  1FEW A;  4ZI2 C;  5CA0 E;  5J2U E;  2R6G F;  2D0U A;  2LE8 A;  1AJ3 A;  2X51 A;  4X1I E;  5EK3 A;  2BS2 A;  3ZMU B;  4CI3 B;  2LKH A;  2ZM6 T;  3I0Q A;  1UUS A;  2LSY A;  5C2T A;  4Z91 A;  2JMM A;  2BDE A;  2BG9 A;  1S35 A;  4H9N C;  4G75 A;  1W9R A;  4JI4 T;  2ZLD A;  3ZC1 A;  2XQ6 A;  3TZG A;  4CQI A;  4DMW A;  5CGM A;  5LMU T;  3PUS A;  3MKD A;  1OWA A;  4U33 A;  4IE0 A;  2K4T A;  1MPF A;  2G0U A;  2W81 C;  5FXV A;  3TLT A;  4EED A;  2BBH A;  2XQA A;  2AXT O;  3C64 A;  4ILB A;  3LBX B;  1Y64 B;  4QXC B;  1XZY A;  4TX5 A;  5EZY E;  2XJ7 A;  4P0B A;  4A56 A;  3V5U A;  1FMW A;  2KXP A;  4NUU A;  2V7K A;  3C4W A;  3EAB A;  4HFD A;  2Q9Q A;  3GP6 A;  4G76 A;  3WI4 A;  4PJL A;  4YSX A;  4HFV A;  5LNK A;  1JNR A;  2KDY A;  4DV3 T;  1GFM A;  3AEE A;  3N9O A;  5LGU B;  3F31 A;  4OYK A;  3RC8 A;  4NXM T;  2OV9 A;  3BK9 A;  3C51 A;  4X1K E;  3A0H O;  4P09 A;  2JQQ A;  4ILU A;  2BKO A;  1UUR A;  4HWD A;  4ZXL A;  4IDP A;  5FYM A;  4EOZ B;  4X66 T;  4E1S A;  4KP3 C;  3A7M A;  1IJ5 A;  2LRK A;  2PTF A;  3QUJ A;  2WMO A;  2WP9 A;  4K0U A;  4IDO A;  4ZEY A;  3NSG A;  2ACZ A;  2HN2 A;  2ZLY A;  4WW0 A;  3GA8 A;  4JI3 T;  5FXX A;  2W63 A;  3POX A;  2RPA A;  5G38 A;  4H9S E;  5A1L A;  3L3P A;  1XNQ T;  2XAH B;  2AE9 A;  4GHB A;  3QRA A;  4HFC A;  5E79 O;  3O9X A;  2QRX A;  2ES0 A;  4G63 A;  4HKA A;  3Q5D A;  2ODU A;  2Y0L A;  3L8R A;  5AQL B;  4EXT A;  4AYE C;  5IUX A;  2KWI B;  3K1S A;  2D2S A;  2LHF A;  3VRA A;  3K3O A;  4QX8 B;  3LK4 1;  4HFE A;  5DL5 A;  3DJB A;  5JTG A;  1HX8 A;  1YW0 A;  2ZM2 A;  5KMG P;  5GTH O;  1ORM A;  4ZI3 D;  5DAB A;  2YU1 A;  2M07 A;  4NUV A;  4PUX A;  4DBQ A;  3VHL A;  2WB5 A;  3TLS A;  5FNV E;  3ZMV B;  4I4T E;  4QXB B;  4Z90 A;  5LHI B;  4LF4 T;  2XSB A;  1LVF A;  5AQI B;  2X9H A;  2YDQ A;  1I6Z A;  5AQT B;  5KXJ A;  3CWZ B;  3AE2 A;  1IZN B;  3PUZ F;  1N34 T;  2CWO A;  2MPK A;  3VKG A;  1T98 A;  5C8Y E;  2OLT A;  5JRC B;  2R4O A;  2FGQ X;  4B3T T;  3V8U A;  4MLK A;  1HR0 T;  4PK4 A;  4DR1 T;  4D64 A;  3RHW A;  2DCF A;  3BQI A;  1J5W A;  5AQR B;  3N5L A;  2NP9 A;  1IBL T;  4E7S A;  2ODJ A;  3QNU A;  4DUY T;  2VQE T;  2XMX A;  4P1N A;  1MIV A;  1FIO A;  5L3D B;  3N9L A;  2W4X A;  2WZH A;  2M06 A;  1U4Q A;  4KMC A;  2VVS A;  5LJN A;  2PBI A;  3LBX A;  2CE7 A;  4LMJ A;  2BBJ A;  2IUB A;  2BG9 C;  2J62 A;  4EZH A;  4PFP A;  4WYV A;  3PGS A;  1X9B A;  2X9X A;  4MAL A;  3JAD A;  3PJA J;  4U7I A;  2MYS A;  2QYW A;  3O1I A;  4RLC A;  3P4Q A;  5HXC A;  3OKQ A;  4AIS A;  1XWM A;  1KNP A;  3CX6 B;  3SZD A;  4JLE A;  3AED A;  3CML A;  2XHE B;  3NZQ A;  4JV5 T;  4RL9 A;  5ETW A;  3S4U A;  1OED E;  1D0X A;  5AQP B;  2XY8 B;  2MTQ A;  4IE7 A;  2V5D A;  4HN9 A;  4O3Y A;  2JMH A;  7PRN A;  3EDV A;  4AYM C;  3KV4 A;  3M3Z B;  4KBM B;  2J47 A;  3MXZ A;  2Q9Q C;  4NPP A;  1OPF A;  4YY3 T;  4DO0 A;  4E1T A;  2YU2 A;  4ILA A;  1SA0 E;  3A8Y C;  3QRC A;  2K24 A;  5JDL A;  4GIW A;  4EV6 A;  3O1H A;  3HKE E;  2BKP A;  2VKH A;  3MZK B;  5HWX A;  5FVN A;  1ZOY A; 
#chains in the Genus database with same CATH homology
 2WBL A;  1CUN A;  2CM0 A;  4MBQ A;  3IBP A;  1HXT A;  2F1V A;  2XE3 A;  3WI5 A;  4B61 A;  3I9W A;  4IHJ E;  4ZHQ E;  4KR8 A;  4UV9 B;  5L3F B;  4IE4 A;  2KMF A;  3E22 E;  5EK2 A;  2KZ7 A;  1KK7 A;  1D0Y A;  2DLR A;  4O4J E;  2UXX B;  2LHR A;  2ZM8 A;  3PU3 A;  2K0L A;  4JUY A;  8PRN A;  4CXX A;  2CWY A;  1BH3 A;  1MNE A;  1E1H B;  2IC6 A;  4YJ2 E;  4PFO A;  2VL8 A;  1THQ A;  1QJ9 A;  3FXD B;  3UU2 A;  3VZW X;  4TV8 E;  3FB2 A;  4FRX A;  2NWB A;  1V9D A;  2V26 A;  4ADZ A;  5HYA A;  2J1N A;  1GFP A;  3AA0 B;  1MMD A;  3HA4 A;  1S94 A;  5LP6 E;  2V1D B;  2XUE A;  2IAK A;  1G73 A;  2XAS B;  3C98 B;  5E0O A;  4GCP A;  2C0S A;  3EVY A;  5EE2 A;  3AA7 B;  2NW7 A;  4U72 A;  4FSO A;  2LJL A;  5KDM C;  5L3G B;  4XBF B;  4H9P C;  5DQV A;  3VKH A;  2KLQ A;  3AAA B;  3CQC B;  3H37 A;  2E9X C;  1MM5 A;  2QTK A;  3AA1 A;  3ETV A;  3PQS A;  2RA1 A;  4N58 A;  1PHO A;  2DWK A;  3CVR A;  4UEL A;  1WRD A;  3ZJ2 A;  1P4T A;  3AA6 A;  4F6R C;  4XNL A;  4HE8 A;  5DL8 A;  1UX4 A;  3JTY A;  2VB6 A;  3ZCI A;  4FZN A;  3F2E A;  3AAE A;  3PRN A;  2E9X B;  2OA5 A;  5LBM A;  4EYU A;  1IZN A;  1LKX A;  5JDH A;  2LOP A;  1BR4 A;  2E9X D;  2HPL A;  2LSK A;  3SYB A;  3K3Q C;  4O4X A;  4UVB B;  4BJN A;  3SY7 A;  4I43 B;  3CQX C;  1VRB A;  5LBQ B;  3RYC E;  3AVS A;  3A5X A;  3UUN A;  2VKD A;  1HTJ F;  2K9A A;  4C69 X;  5JRC A;  1ZEE A;  2X67 A;  1MIY A;  5ADX L;  4B6X A;  5LG4 A;  2Y2X A;  4IE6 A;  4FZL A;  4ASK A;  2FGR A;  1YKE B;  5M4Y A;  4L0R A;  3N2O A;  3UTK A;  2YNK A;  3C4X A;  2XTQ A;  3LK3 B;  2L8K A;  3FXE B;  1QUU A;  2JRK A;  1MMA A;  4KUM B;  2MNH A;  5FY1 A;  3PUG A;  5LCY A;  2X66 A;  5F8P A;  2W00 A;  1NAF A;  3K8P C;  4MHC A;  5KX5 E;  4AYN A;  4ERR A;  4H63 H;  4X1Y E;  3WAK A;  1UX5 A;  1WR6 A;  2LSJ A;  4GK0 E;  2F1T A;  5LHG B;  3MAC A;  4EIW A;  1HG2 A;  4O2B E;  2D0T A;  1MMN A;  2XAQ B;  3AB3 B;  2HH7 A;  2ERV A;  3GN5 A;  1PRN A;  3VE1 A;  4LSF A;  4PK5 A;  3NRY A;  3POR A;  2YK0 A;  3U78 A;  5AFU K;  4DBR A;  2XE1 A;  5HXE A;  2Y7S A;  4BA9 A;  3UAQ A;  3RYI E;  2DNX A;  2A3D A;  2DHR A;  4QXH B;  3TKL B;  3P7I A;  3WAJ A;  4PJJ A;  1FEW A;  4ZI2 C;  5CA0 E;  3FHN A;  5J2U E;  4O4L E;  1ZKE A;  3D0T A;  2W80 C;  3RRW A;  4CI2 B;  1HS7 A;  2D0U A;  2LE8 A;  4H63 V;  1IAP A;  3T20 A;  5J2T E;  1AJ3 A;  2MHL A;  2X51 A;  5HAX A;  2WMN A;  3O1J A;  4X1I E;  2VKJ A;  5EK3 A;  4GOU A;  3ZC0 A;  2X68 A;  5HXR A;  5JDG A;  4ZI2 D;  5FMN A;  4AKH A;  2XTR A;  3ZMU B;  4CI3 B;  5CA1 E;  3Q5X A;  2XE5 A;  3I0Q A;  3ANW A;  1MM4 A;  2LSY A;  3PUQ A;  3T0S A;  2JMM A;  3POQ A;  2BDE A;  3PU8 A;  3E0Z A;  4AKR A;  5HWY A;  4DND A;  1S35 A;  4H9N C;  2Y6X A;  3LG7 A;  3SY9 A;  4IIJ E;  4G75 A;  2LSI A;  2CLY C;  3WI3 A;  5GV0 A;  3C50 A;  4WBN E;  2W0G A;  4O4I E;  2LFU A;  2I59 A;  2ZLD A;  3ZC1 A;  1H6S 1;  3C5O A;  1D1B A;  1IJ6 A;  2Z6E A;  4CQI A;  4EB6 E;  4DMW A;  3TZG A;  2LM9 A;  2CLY B;  3PUS A;  4D5U A;  1MMG A;  2W61 A;  4AKI A;  3KVB A;  3MKD A;  1OWA A;  2CCQ A;  3VU7 H;  4BUM X;  3GMI A;  5JDN A;  4IE0 A;  4GF4 A;  2P9B A;  2C5K T;  4UIG A;  3SS1 A;  4L9I A;  3GWH A;  4EYY R;  5DL7 A;  2K4T A;  3AAI A;  1MPF A;  5IHY A;  2G0U A;  3KBU A;  2W81 C;  3KIN B;  1ZV4 X;  5FXV A;  5H6R B;  3ZMT B;  3VY8 X;  5GON E;  3G7G A;  4FT6 A;  3JC6 D;  5DJQ C;  2BVM A;  2EHO A;  1GFN A;  5LGN B;  1D1C A;  3UPG A;  5HXS A;  5L3E B;  3ZYL A;  3C64 A;  3LBX B;  1Y64 B;  4C90 A;  4QXC B;  4UF0 B;  3I9Y A;  5JQG E;  4TX5 A;  3MA9 A;  3H3A A;  5EZY E;  5JR9 A;  4P0B A;  4A56 A;  4AQF A;  1BXW A;  3V5U A;  1LRZ A;  1FMW A;  3MJX A;  2KXP A;  3BQK A;  4HTE A;  4JCH A;  4NUU A;  2V7K A;  4PJM A;  3C4W A;  3T8O A;  2ZM0 A;  2NTY A;  3J7Y q;  2Q9Q A;  3GP6 A;  4G76 A;  3WI4 A;  2BVL A;  3POU A;  4M1P A;  4PJL A;  1Q9F A;  3RX6 A;  4HFV A;  5LNK A;  2WM9 A;  2KDY A;  2Y0K A;  3KV6 A;  2LOS A;  4KR4 A;  2JJ9 A;  1GFM A;  3N9O A;  2K5B B;  5LGU B;  3PDY A;  2XTL A;  4U9C A;  3F31 A;  1QJP A;  2JMK A;  4XNK A;  4TN7 B;  2BZB A;  4WBO A;  2C5J A;  1QJ8 A;  5L3C B;  4OYK A;  4TUY E;  3HL6 A;  2N9D A;  4AKG A;  3CX8 B;  3RC8 A;  4P0A A;  4QHO A;  2GE4 A;  3KV5 A;  3BK9 A;  3RPU A;  3C51 A;  3K19 A;  3IHR A;  4X1K E;  5HXH A;  5L2L A;  3CKD A;  4AI6 A;  4OYJ A;  5CB4 E;  4FUV A;  2J4U P;  2WSS V;  4P09 A;  5JDF A;  2JQQ A;  4ILU A;  3DP7 A;  1WLX A;  4GYS A;  2X27 X;  4MFR A;  2KC0 A;  2N2L A;  1UCU A;  2CEA A;  2WAU A;  3KVA A;  5L3B B;  3LFM A;  5FYM A;  4EOZ B;  5LGT B;  3ZMS B;  4E1S A;  4KP3 C;  1ZHC A;  3FYX A;  1IJ5 A;  3B13 A;  3QC9 A;  3HKD E;  2NW8 A;  4YFS A;  3B57 A;  2X9Y A;  3P8C D;  4CZZ B;  3OBV E;  4QQ1 A;  3QUJ A;  3ZYM A;  3PQU A;  2WMO A;  4JFB A;  2JPF A;  1OSM A;  4K0U A;  3VZT X;  2D5U A;  3AA0 A;  3DA4 A;  2POR A;  3NSG A;  2CXF A;  2Y0H A;  2VWA A;  3C4Z A;  4ISS A;  3RH3 A;  4PNI A;  2ZLY A;  3LK4 2;  2XAJ B;  3GA8 A;  4WW0 A;  5FXX A;  2W63 A;  1E54 A;  3POX A;  4PK6 A;  2Y8D A;  3AA7 A;  4H9S E;  4WNK A;  5A1L A;  5BMV E;  4DVD A;  2ACX A;  3L3P A;  3NRX A;  4TZ4 C;  4FRT A;  2XAH B;  1X79 A;  3AAA A;  4O49 A;  4Z3T A;  3KBT A;  3ZLI A;  4GHB A;  2YPV A;  3F57 A;  3QRA A;  5JDM A;  4HGA A;  4IGU A;  2M67 A;  3ZEF B;  2LSG A;  3O0E A;  3LK2 B;  2NOX A;  3O9X A;  1OXZ A;  2ES0 A;  4G63 A;  4HKA A;  2E9X A;  3AVR A;  2ODU A;  2Y0L A;  1BR2 A;  1HCI A;  2ODV A;  2YIN A;  4KRA A;  3Q5W A;  4O3Z A;  3Q9D A;  4IE5 A;  2H7O A;  4UVC B;  4EXT A;  1ZHX A;  4AFK A;  4AYE C;  4RJW A;  2IC9 A;  4AXP A;  2KZ7 B;  3N2G E;  2KWI B;  4DMV A;  2XQY A;  2D2S A;  3RRC A;  2LHF A;  3NZP A;  4N59 A;  3RKO A;  3A2S X;  3K3O A;  2SPC A;  4QX8 B;  4QKN A;  3UT5 E;  4LSH A;  3LK4 1;  3N9M A;  1WYC A;  3N2K E;  5IYZ E;  3RBH A;  4F4B A;  2YEV C;  4ZI3 C;  5DL5 A;  4H9R C;  4PJN A;  3DJB A;  4O2A E;  4HEA A;  5FY7 A;  3R84 B;  2N2M A;  3LK3 A;  1HX8 A;  2VK9 A;  2EHO D;  5ADX K;  1YW0 A;  4JEU B;  4GYR A;  2ZM2 A;  4FMS A;  5KMG P;  2N2N A;  4X20 E;  3CPZ A;  4AYD C;  4I50 E;  4OHF A;  4BAY B;  1ORM A;  4ZI3 D;  5DAB A;  2YU1 A;  1BR0 A;  3ZYK A;  2VKO A;  3ZMZ B;  2M07 A;  4NUV A;  4PUX A;  4DBQ A;  2DI4 A;  3HKB E;  2KND A;  3VHL A;  2KT9 A;  3JC6 C;  5FNV E;  2Q9Q B;  3ZMV B;  3QK6 A;  2MBG A;  4I4T E;  4PAG A;  4QXB B;  1YS5 A;  4O4H E;  4FJO A;  4UV8 B;  3PUA A;  2Q9Q D;  5JVD E;  3Q2M A;  2ZFG A;  5LHI B;  2IW5 B;  1LVF A;  5FP3 A;  4GK5 E;  4AKM A;  2MOZ A;  2X9H A;  3RYH E;  3AA1 B;  3HI2 A;  2O4V A;  4FI5 A;  1Z0P A;  1U5P A;  2L3L A;  3AA6 B;  5DQW A;  4GCS A;  1BT9 A;  4E7Z A;  1HXX A;  2E8I A;  3BQL A;  1ZHW A;  1MIW A;  1D1A A;  1ZHT A;  3CWZ B;  2QGS A;  3AAE B;  2OMF A;  5T5F A;  4EAH A;  1IZN B;  2H3R A;  3KFW X;  4V1A v;  1HXU A;  2CWO A;  4LSI A;  1GFO A;  4AZL A;  3ZJ1 A;  3VKG A;  1T98 A;  5C8Y E;  2WWU A;  5JDQ A;  2C5I T;  5JRC B;  1YD8 G;  3ZN0 B;  2CA5 A;  5FXW A;  1LVK A;  4XZC A;  3ZPO A;  4GCQ A;  5DL6 A;  1FMV A;  2B1E A;  1O3X A;  4OK0 A;  4ZS3 A;  1D0Z A;  2FGQ X;  4UEM A;  3SRZ A;  3IF8 B;  2KIN B;  3V8U A;  4MLK A;  4PK4 A;  3ZCJ A;  1KNZ A;  3VY9 X;  2DWG A;  2Y48 B;  3V5S A;  5D5D A;  4D64 A;  2V7L A;  3M65 A;  2L9Q A;  3PE0 A;  5LHH B;  2DCF A;  4J2C A;  3LJC A;  3HOE A;  1HF8 A;  2V7I A;  3SWH A;  3E08 A;  1WYB A;  3CX7 B;  5FXZ A;  3BQI A;  3SOL A;  4I55 E;  3EDU A;  5AFU L;  3N5L A;  2NP9 A;  4IST A;  2NTX A;  4O4U A;  3VE2 A;  4E7S A;  5JDP A;  2X0L B;  5LA6 E;  4Z8X A;  3EUH A;  3GN5 B;  5JH7 E;  1Q9G A;  2ODJ A;  4AQG A;  3VZU X;  4AUI A;  2XMX A;  2V7M A;  2ZMA A;  3PTR B;  1YKH B;  1MIV A;  4IDZ A;  5H6Q B;  3HR0 A;  4RLB A;  1BR1 A;  3CQG B;  2GK9 A;  5EK4 A;  1FIO A;  4QX7 B;  5J1G A;  4FOZ A;  3T24 A;  3EMN X;  4ZI7 E;  2LEH A;  5L3D B;  3N9L A;  2M06 A;  4AKL A;  1U4Q A;  3KDS E;  4CXY A;  4D65 A;  5IYU A;  4KMC A;  5LJN A;  3UUX B;  4ZOL E;  2PBI A;  3LBX A;  2CE7 A;  4UF0 A;  4FES A;  2K48 A;  4OFZ A;  3ESL A;  2W62 A;  3N9P A;  5LXT E;  3KV9 A;  2NW9 A;  4CXW A;  4PFP A;  4EZH A;  3RC3 A;  2PRN A;  3ANW B;  2XE2 A;  4O8S A;  3ETU A;  4LSE A;  2PFV A;  4YJ3 E;  4CI1 B;  2H7V C;  2X9X A;  3I0O A;  4MAL A;  4YHJ A;  4AKR B;  3N9Q A;  4ANJ A;  3DA3 A;  3O4X E;  4RJX A;  4BJM A;  3ONX A;  2V7J A;  5PRN A;  2N1G A;  2MYS A;  4AYI D;  4G2A A;  3UFE A;  4L5G A;  3O1I A;  2HPJ A;  2VAS A;  5LJM A;  4RLC A;  1ZHZ A;  5HXC A;  4FSP A;  4EZ4 A;  3SYS A;  3OKQ A;  4H9Q C;  3UUM A;  3OJA A;  3FBZ A;  3CX6 B;  5FY0 A;  3SZD A;  4JLE A;  1EZ3 A;  4QWN B;  4O3W A;  3DTO A;  1HFA A;  2CXD A;  3CML A;  4YLH A;  4C91 A;  2XHE B;  2XG6 A;  5LOV E;  3NZQ A;  4XAX B;  4RL9 A;  4UXN B;  5ETW A;  3W15 B;  2CMR A;  2UXN B;  3S4U A;  3HOL A;  2EHO C;  1D0X A;  1MND A;  2CXL A;  2MTQ A;  3PUR A;  4H9O C;  4IE7 A;  5JRE A;  4ZS2 A;  3HW9 A;  4HN9 A;  1H7C A;  4O3Y A;  2JMH A;  3R6N A;  5F3J A;  4FZM A;  4JEH B;  7PRN A;  3MK7 C;  2QA7 A;  3EDV A;  4AYM C;  3KV4 A;  3L09 A;  2EHO B;  5JR9 C;  3KVD D;  4O3X B;  5LYJ E;  4AQF C;  3N9N A;  4KBM B;  2KWH A;  3OYX A;  1SHZ C;  3MXZ A;  3RYF E;  1HG5 A;  3IEE A;  2J1D G;  5JR9 B;  2Q9Q C;  3K3N A;  3I1A A;  4UVA B;  2X9W A;  1NWM X;  2KXP B;  1OPF A;  4U74 A;  3FBL A;  1G8X A;  4N78 D;  1ZHY A;  2XAG B;  5TAO A;  4DO0 A;  3NBX X;  1QSD A;  2YU2 A;  2PJQ A;  1GFQ A;  3J9X 1;  3HWB A;  5G26 A;  4TV9 E;  2RP4 A;  4E1T A;  1VOM A;  1SA0 E;  3QRC A;  6PRN A;  2K24 A;  2LT3 A;  5JDL A;  3SZV A;  3OYZ A;  4PW8 A;  4GIW A;  2LHN A;  1G90 A;  3O1H A;  3HKE E;  2PG8 A;  2A2F X;  1US7 B;  2XAF B;  3U3I A;  3ZN1 B;  2VKH A;  2A72 A;  1B7T A;  3MZK B;  5HWX A;  3HKC E;  5FVN A;  3UUL A;  3LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...