3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3AA1A 4AKRA 3AA0B 5AFUL 3AAEA 3AA1B 5AFUK 4AKRB 3LK3A 2KZ7A 3LK2A 3AAEB 3AAAA 3AA7A 5ADXL 2KXPA 1IZNA 3AA6A 3LK42 3LK41 3LK3B 2KZ7B 3LK2B 5ADXK 3AAAB 3AA6B 3AA0A 2KXPB 3AA7B 1IZNB
chains in the Genus database with same CATH superfamily
4UEMA 4OYKA 4HE8A 3KZIO 4U2ZA 1VOMA 4CZZB 2J47A 4HKAA 3BS0A 3HR0A 1HF8A 3FB2A 2FGRA 4PR7A 3V5SA 3LK41 3QK6A 5JDPA 2UXDT 5AQLB 3AXJA 3P4RA 4AKRA 4Z91A 4E7ZA 3FHNA 1Y01A 2X9XA 3AEAA 4WYVA 3RF1A 2XQ4A 2KWIB 4A97A 1YQ4A 3UTKA 2M07A 1JNZA 3QOFA 4HGAA 4AKGA 3H3AA 5L47A 4ISSA 2D0TA 4RLCA 5LMNT 2JMHA 5FL0A 2CXLA 4ILCA 2L9QA 3G06A 1BR2A 3KVBA 4EEDA 3TLTA 5LGTB 4LSIA 2NW7A 4O2BE 3ZJ1A 4TWDA 2WJQA 3OPCA 2YN6A 4XNKA 3SRZA 2X0YA 2VK9A 3EAMA 3U78A 2LM9A 4IDOA 1L0VA 5HEHA 2CXDA 4GKKT 4WW0A 4DNDA 2V6XA 4A98A 1HS7A 5FXVA 4UIGA 2JQHA 3UUNA 5LBQB 1MMNA 3TLVA 1NWMX 3AB3B 1U5PA 2HN2A 2W67A 2NTXA 5ABHA 4KHPT 3OYXA 2XAGB 3ZYLA 2UUBT 3PDYA 5FXZA 3UU8A 1BH3A 2XAFB 1UX4A 3QC9A 2LT3A 2KNDA 1OXZA 1N34T 3T8OA 4FRTA 2VASA 4C90A 3BRYA 3NSGA 5DABA 2LSIA 2X9YA 3QUJA 2WSSV 2GK9A 4ILAA 3HI2A 3ZC0A 3ZMVB 2E9XC 4LSFA 2IW5B 5JDGA 5HWXA 3UQ4A 3MKDA 4D64A 3CMLA 2YPVA 2JJ9A 2LKGA 4I0UA 2X51A 3GP6A 3P4SA 1OPFA 5ABFB 4IL4A 2LHFA 2QVAA 2VB6A 2BDEA 2ACZA 4EEBA 1WFDA 2BKPA 3AE7A 4IGUA 4CXYA 2D0UA 4AUIA 1SUMB 4UV9B 3VY9X 5B66O 2WWVA 2MAWA 5H6QB 3EDUA 1HNZT 3Q2MA 4QH4A 3A0HO 3LK3A 3K3OA 4IIJE 4GK0E 2I6HA 2W80C 3V5UA 1S35A 2MBGA 3PJAA 1YQ3A 2VKHA 4TNWA 4PJJA 3ZMTB 3FXDB 4N58A 1N32T 2XTQA 4IL9A 3T1HT 1E54A 5HXHA 3RC8A 4PJNA 1YW0A 3KV9A 5ABEA 3ANWA 3D0TA 4DVDA 1P4TA 3WU2O 4C4VB 4EOZB 5FY0A 5L2LA 3C4XA 1ZHCA 3FZLB 2V6YA 2WVPA 4U33A 2HPLA 5ABFA 3A2SX 3PUGA 2CBJA 4IDQA 3OKQA 1XMQT 1OEDB 3TLUA 5AQJB 2CBIA 2AE9A 2BZBA 2WMOA 5TAOA 1YXRA 1B7TA 4CN4A 4AYID 2YOEA 3RX6A 2V7MA 4GKJT 2CEAA 4AXPA 3MZKB 6PRNA 3ZLIA 2UXCT 4UB8O 4H9PC 4QXCB 2NOXA 2DWKA 2VQFT 4YJ2E 4XBFB 5AQRB 3VE2A 7PRNA 4BUMX 2AXTO 3A0BO 2UU9T 3ZKRA 3ZT6A 4HFHA 3O4XE 3RYFE 2RA1A 4GCSA 4XZCA 3UU5A 4KUMB 4X64T 3B5MA 4GOUA 4HFDA 1AJ3A 3VY8X 2WBLA 5G38A 3P4QA 4QHOA 4YHJA 2CA5A 4C4VA 1D1CA 4LSEA 1W9RA 1THQA 3AA6A 2PFVA 4X66T 3O1JA 5LBMA 3HA4A 1OEDA 2WMNA 4KMCA 3C98B 2KSRA 3E0ZA 4DBQA 2E9XD 5AQPB 4RJWA 1VRBA 3A5XA 4FESA 4PW8A 1SE7A 2XE3A 4EXTA 4LMKA 1GQEA 2A2FX 3NBXX 1WYCA 5LHHB 3BK9A 2X9KA 3ZCJA 3RBHA 1IBLT 2WB5A 2N9DA 3CQXC 3UULA 3FBLA 2ZM2A 4AKIA 2XE2A 1D1AA 2JQKA 4DR3T 2R89A 3MJXA 2HPJA 1V9DA 2QRXA 2VURA 4YSXA 3T20A 3ZMUB 1YS5A 4DR1T 3HOEA 2XQ8A 2KLQA 3ZMZB 2R4PA 5FXWA 1YD8G 4AKHA 3FXEB 2CLYC 3P50A 2N2MA 2HN1A 2GE4A 3JCUO 4LF9T 4DV5T 3I9WA 3A7MA 3QB5K 5AQUB 3EABA 3JAFA 2LRLA 3N9MA 4MFRA 4KR8A 3O1IA 2UXNB 2WS3A 1FIOA 3RGLA 3JAEA 1R8IA 2D5UA 4CI1B 1MNEA 5LMUT 4UB6O 4HFCA 3HW9A 3SY7A 5JDHA 4B3MT 3VRBA 4AQYT 3RLFF 1XMOT 4JI6T 2XQ5A 5FP3A 3ZN0B 2WU5A 4FOZA 3KVDD 5FVNA 1CUNA 2QGSA 1OWAA 3UU2A 4CQIA 2X0LB 4AI6A 2ZM0A 3PUZF 5KMGP 2LOPA 4WZXA 5LB7B 2K5BB 3RYIE 1J5ET 4U7YA 3PUXF 5E0OA 2EHOB 3WI5A 4DR5T 4D65A 3UU3A 2IMLA 1W0AA 4JEUB 3C64A 3ETUA 4WBNE 2YNKA 5KX5E 2NP9A 1HXUA 4RL9A 1MNDA 2SPCA 5HAXA 5DQVA 3RYCE 4AISA 3M3ZB 2LLYA 2KINB 1HR0T 2V7LA 3KV6A 4LF7T 4X1YE 3FZMB 5LNKA 1KEYA 2E8IA 4IREA 4YY3T 4ZS2A 3PJAJ 4X62T 3GN5B 1HNWT 4RLBA 1IJ6A 1G73A 4GHBA 2XUEA 5KXJA 2R88A 5H2FO 2OLTA 3WAJA 4N74A 4O4UA 1SHZC 4UVBB 3RKOA 3UPGA 1FMVA 4JV5T 3KINB 5L3EB 3T24A 3PORA 4E1SA 4QX8B 1N36T 2KC0A 4X20E 3AECA 1ZHXA 2V7KA 3ZYMA 2IHR1 1KNZA 5G39A 3SZVA 1Z0PA 5L3FB 1MM5A 2QTKA 4YXDA 2Q9QC 1MMGA 4B61A 2K3WA 2CWOA 2LOSA 3VZUX 2LSGA 1UK5A 1GFQA 1KK7A 5J2UE 2I59A 1LVKA 4ERRA 2XE1A 3AE1A 2FUPA 4H9QC 3GN5A 2IIUA 2BS3A 3MACA 3H37A 1IZNA 3DZMA 4E1TA 3H3MA 5LJMA 1J1JA 4Z90A 4TZ4C 3VRAA 3QRCA 4PJ0O 5B5EO 2JPFA 4B3RT 4JI4T 5IWAT 1XNRT 5AFUK 4ZHQE 2XM1A 3W15B 2N2NA 3O1HA 4DV1T 3N9OA 2UXXB 4X1IE 4J2CA 3QB5A 4YLHA 2VKDA 1US7B 5C8YE 4YSYA 3VR9A 4FQEA 2CRBA 2ZM8A 2XMXA 2CPTA 2R6GF 5JR9B 5AQFB 5AQKB 4HWIB 2ES0A 1Q9FA 5FY7A 3PGUA 1PHOA 4EB6E 4QKNA 4ILUA 1H7CA 4L0RA 2OA5A 3LK42 3ZEFB 4WNKA 5C3JA 2V8SV 4P1NA 2VWAA 5GTHO 1Y64B 4GF4A 3AA0B 5JDFA 2X0HA 3JCFA 3ETVA 2CHNA 3ONJA 2PTFA 3UFEA 4H9OC 5LG3A 3PQUA 4DV3T 2VKJA 5LHGB 2E9XA 3S4UA 2DL1A 4IE0A 3GMIA 2FBWA 4IE4A 3J9X1 4LFBT 4JLEA 1YKHB 5FYMA 3TLWA 4U7IA 3N2GE 2R4LA 3LK3B 2W4XA 1HNXT 2K24A 4AYDC 5JR9A 2Y0KA 4ZI2C 5DL7A 2ODJA 4O2AE 5LOVE 4DIDB 2K0LA 3LG7A 4KP3C 4MHCA 2Y48B 4FZLA 4MALA 2JQ9A 3VKHA 3AE8A 3LFMA 4AQFC 2VQET 2XQ7A 3AA0A 3ANWB 1LVFA 3PUWF 1GFMA 2JMMA 1D0ZA 4TV9E 1W09A 2V6YB 2KDYA 2YDQA 4HFIA 4ASKA 3RYHE 3OJAA 2X9HA 4I55E 3ZSTA 3P4PA 3UFGA 5AQTB 4U2YA 4U31A 2IDOB 1QSDA 2V7IA 3P8CD 3ZYKA 2G0UA 3PUYF 2W62A 1ZHWA 1XWMA 4AYNA 4N75A 4LMJA 2PORA 1MIYA 1ZEEA 3E08A 3B13A 2F1CX 5LA6E 4O8SA 5FMNA 3I0OA 2IAKA 4FSPA 1G90A 4QH5A 1ZV4X 4JFBA 1X79A 5CA0E 3K1SA 2UUCT 3QRAA 5JVDE 1WCRA 3N9NA 1YKEB 4BJNA 3LBXA 1UGOA 2XQAA 2XAJB 3CVRA 5CJ5A 2H3RA 1BR4A 2JRKA 4ISTA 3SFEA 3DA4A 3HKBE 3CK6A 2BBJA 2BG9B 5HXEA 5HEGA 4ZI7E 1BT9A 4F8HA 4H9NC 4H9SE 3CX7B 3GWHA 2YKSA 4DUYT 3IHRA 3X1DA 1T98A 3B57A 3AA6B 4OX9T 4UR9A 4X5TA 4QXBB 3C51A 2ODUA 3J7Yq 2RPAA 4DR6T 5GTIO 4FI5A 5HCMA 1MIVA 3AA7A 8PRNA 3P7IA 3MK7C 4IHJE 3F57A 3N9QA 1I94T 2OV9A 2KMFA 2XY8B 3UU6A 2E2AA 4L9IA 4UV8B 3UU4A 1ZHZA 4H63V 4O3XB 1QJ8A 4ANJA 4JI2T 1QLBA 4DO0A 2F1VA 5EK3A 4Q25A 5D5DA 3KBUA 3PURA 5J2TE 3SOLA 3T1YT 2F1TA 2BG9A 3IEEA 2LHRA 4IDPA 5BR8T 3NWIA 4LFCT 5DL6A 4U9CA 4KX6A 3EI0A 3HL6A 3UAQA 4DBRA 2MYSA 2K4TA 2BVMA 2H89A 1IAPA 5DQWA 2L3LA 2J1NA 3K3QC 3VZTX 4O3YA 5FVLA 3Q5DA 1QJ9A 3CX8B 1HX1B 3CQCB 2M6IA 4HEAA 5HXSA 5GV0A 3K19A 2WDRA 4DV7T 4DR2T 3T0SA 2CHOA 4Z8XA 5IHYA 2W61A 1WRDA 5LGUB 2YU2A 4PJLA 5M4YA 2WU2A 4JI8T 3AE2A 3PUVF 4IE5A 2ZMAA 4OFZA 5FKYA 2Y8DA 3UQ7A 4DMVA 4P09A 5DJQC 4V1Av 3KV4A 3AEFA 3VHLA 3KV5A 3TZGA 4U74A 5GONE 3QNUA 1GFOA 4EV6A 3PGRA 3ONXA 1OEDC 4ZOLE 3RPUA 3RRCA 3DTOA 2H7VC 2KWHA 4EZ4A 4HFVA 4QXHB 2XQ9A 4C69X 3ZT7A 3Q9DA 3I9YA 3ABVA 5AQNB 2UUAT 1KNRA 1KNPA 4ZS3A 4EYYR 4G75A 3RIUA 4PFOA 2LE8A 2NWBA 1MMAA 4ILBA 3Q5WA 1KFYA 5HEJA 4EIWA 3AE9A 4HWDA 4O4JE 4MBQA 2W81C 3DWNA 2BG9E 1NAFA 2R4OA 3LK2B 2YK0A 1DU2A 3Q5XA 5ETWA 2DCFA 4AZLA 4DR4T 2WP9A 3UUBA 5CA1E 2W63A 4B6XA 3NZPA 1OEDE 1X9BA 3L8RA 4CTDA 5HXRA 4O4LE 2C0SA 3FZKB 4IT4A 5C2TA 2Y0LA 2R4NA 2KXPB 4PFPA 4KR4A 2D9DA 2FGQX 5FL1A 4PK4A 4PK6A 2XTRA 3NKZA 5KDMC 2DHRA 2BKNA 2VVSA 4UF0B 4ZEYA 5AQGB 5AQVB 3POUA 3ZC1A 2LEHA 4C91A 1W0BA 4ADZA 5AFUL 1JNRA 1E2AA 4CXWA 2IWVA 4KHZF 4NIQA 4ZI3C 1QUUA 5L3CB 1T8BA 2WJRA 2K48A 3LK2A 5FNVE 4B3TT 5FY1A 3UUMA 3NVOA 3AE5A 3MA9A 5F5WA 5G3AA 1IBMT 4KBMB 2IC9A 3LJCA 3RH3A 1IZNB 3C50A 3GA8A 3M65A 2BBHA 1WR6A 2XJ7A 3AAIA 2N2LA 2XG6A 3CPZA 2DLRA 1NEKA 1IBKT 1EZ3A 2KXPA 2NW8A 3VR8A 2X27X 4GCQA 3CIRA 4P0AA 1BXWA 4AYMC 3R84B 4LF4T 2V5DA 4BA9A 2LJLA 3ZMSB 5JDLA 4JBWF 3ZCIA 3PUSA 4UF0A 4IE7A 2K9AA 4ZZCA 2YU1A 4CXXA 4JI1T 5AQOB 3ZN1B 2MNHA 4FZNA 5CGMA 5L3GB 3PGSA 4LF5T 4A56A 2LSYA 3AEBA 4I50E 1MIWA 2FJEA 5DL8A 3TLSA 1ZKEA 4KRAA 2LRKA 1FJGT 3PU3A 4DV0T 4O4XA 3DA3A 1XDPA 4TX5A 4QH1A 3VU7H 5BMVE 4GCPA 2BS4A 2MTQA 3SY9A 2XAQB 5HEOA 4K3BA 2H88A 4DR7T 3EUHA 2PBIA 5LYJE 5FXXA 1HTJF 3RC3A 4X65T 1M62A 2EHOC 3LDQB 5JQGE 3PF1A 2E9XB 2J1DG 3AE4A 4NXNT 2LKHA 4IE6A 3CKDA 4JI5T 4M1PA 3K8PC 2FJBA 2C5KT 3AEGA 4TN7B 2WDVA 4XNLA 3VE1A 2JQYA 2AXDS 2Y6XA 4TNVA 5JH7E 2UXBT 2C5IT 5JDNA 3RIFA 4FUVA 2XPKA 2A3DA 3AAAB 5KAFO 2XQYA 4HWHA 2ZM6T 2XASB 2QA7A 2XHEB 2M67A 2F4VT 4GYSA 3TKLB 2VL8A 3NJTA 3SZDA 5JREA 3RIAA 2YINA 1T7SA 3AAEB 1XDOA 2LM2A 3I0QA 5KAIO 4X1KE 3PUAA 1ZOYA 3HOLA 4N78D 4B3ST 2DNXA 2V1DB 2WM9A 4ZI3D 3PV0F 1D1BA 4NUVA 4AQFA 4DV6T 1WLXA 5JTGA 1N33T 2CCQA 2WY2A 3RQWA 2Y2XA 5LJNA 2A72A 3BQKA 3NZQA 1S94A 5LP6E 3V8UA 2ZFGA 3A8YC 1GFPA 3RI5A 4K3CA 2ZLDA 4FZMA 5HEUA 3R6NA 1MPFA 1SA0E 4C00A 4H63H 5L3BB 2WWUA 3SYSA 5TISO 3PUQA 3AAAA 3LBXB 3I1AA 3RRWA 1ZHTA 3UT5E 4K0UA 4AKLA 2B76A 3U3IA 5PRNA 2Q9QD 1LRZA 3N9PA 2WDQA 5L3DB 2X66A 3AAEA 4YJ3E 4RJXA 5A1LA 3OTOT 3L3PA 3AVRA 5ADXL 4IDZA 2PG8A 2BKOA 4UVAB 1FEWA 1O3XA 3N9LA 1BR1A 4YFSA 2KZ7B 3O0EA 5E79O 3AA7B 3K3NA 2W0GA 2KT9A 2W2UA 3DWOX 4JI0T 3Q5EA 5HYAA 2ODVA 4OYJA 4O49A 5JR9C 1NENA 3C5OA 4O4HE 3CQGB 1T72A 2WQYA 1XNQT 2BS2A 4H9RC 2WCAA 4OK0A 2LSJA 4LF8T 2Y7SA 3CX6B 3SFDA 4AKMA 2V5CA 3DP7A 2EHOD 5LXTE 3WI3A 4G76A 2CWYA 4E7SA 2P9BA 4FSOA 1QJPA 2VVNA 5ABGA 3L09A 5EK4A 1GFNA 4CI2B 4PAGA 1H6S1 5EK2A 2XAHB 3WAKA 4N59A 4AFKA 1MM4A 1HX8A 2IWWA 2NTYA 1UCUA 4PNIA 2Y0HA 3RHWA 4IL6O 3OBVE 2VL0A 4WBOA 2CMRA 4G2AA 3JTYA 2YEVC 4QQ1A 4HFBA 3FBZA 1HG2A 4G63A 5L4HA 2KZ7A 4YHHT 4JI3T 2FJAA 5IYZE 5LHIB 4HWFA 2JMKA 2ZLYA 2CLYB 4NXMT 4JUYA 3FZFB 2X68A 2J4GA 4CN1A 2XSBA 3PU8A 2L8KA 1M7KA 4ZXLA 4TWHA 4JI7T 3MXZA 1HCIA 2WZHA 4P0BA 4YTPA 1FMWA 5AQQB 3ESLA 5DL5A 5ADXK 3IF8B 4OHFA 4DV4T 1J5WA 4U72A 3ZPOA 1HXTA 5JDQA 3ZT5A 1LKXA 3KBTA 2M6BA 1BR0A 3JC6C 3KFWX 3RQUA 4GK5E 2H7OA 4K0KT 2I0MA 4PK5A 1UURA 4ZI2D 2LHNA 4MLKA 3N5LA 5AQMB 5T5FA 3POQA 4UELA 1OSMA 2JIWA 4JCHA 3EDVA 2PJQA 3OYZA 2J62A 3ONLC 4NUUA 3KDSE 3BRZA 3VZWX 4ZZBA 4AYEC 4I43B 2XSAA 2M06A 2CM0A 5LG4A 5F8PA 2XTLA 4D5UA 4A5XA 4PUXA 2B1EA 4BAYB 2E5LT 2OMFA 4TV8E 4JEHB 1ZHYA 3HKEE 4EGWA 4JYAT 4FMSA 4LFAT 4TWFA 2XQ6A 4UXNB 1WR0A 5HCJA 2X9WA 3G7GA 1G8XA 1MMDA 2BG9C 3N2OA 4XAXB 5F3JA 4F6RC 3BQLA 2WZIA 5AQIB 3WI4A 5J1GA 4HN9A 2V7JA 4YTNA 5IUXA 3SYBA 3SWHA 3N2KE 3PQSA 2CE7A 4KI0F 4NPPA 1ZP0A 5LCYA 2IUBA 3ZJ2A 2O4VA 3PTRB 3AEDA 4QWNB 1PRNA 5AQSB 3CWZB 5CB4E 2X67A 2MPKA 2XE5A 3OVUA 4O4IE 3IBPA 2QYWA 4IDNA 4CN6A 3NRXA 4AIUA 2DI4A 1T1LA 2Q9QB 4UVCB 3EVYA 3PRNA 4COFA 1KF6A 4BJMA 3AVSA 1Z8UA 2FJDA 5L4EA 4QX7B 4LF6T 4YSZA 2YDRA 3UUXB 2RP4A 1HG5A 4GYRA 5FVKA 2HHHT 1HFAA 3SS1A 3HKDE 2V26A 4GIWA 1HXXA 3RIUC 2BVLA 5IYUA 1UX5A 2W00A 5G26A 3C4WA 2Z6EA 3NRYA 1U4QA 4DMWA 2DWGA 3FZHB 3RKGA 2ACXA 4YTMA 2ERVA 2E5VA 5AQHB 4I4TE 3JC6D 3E22E 4AQGA 2D2SA 3AA1B 2N1GA 3POXA 3HKCE 5JRCB 2LSKA 3KVAA 5J0ZA 4LSHA 2CXFA 1Q9GA 3PE0A 4L5GA 1S5LO 2Q9QA 4TUYE 2XM2A 5HWYA 4EYUA 2WAUA 3VKGA 4U3CA 3FYXA 2C5JA 4O3WA 4FJOA 2NW9A 5LGNB 3AEEA 1UUSA 1T16A 1E1HB 4F4BA 5H6RB 3LSVA 3L39A 2XZEA 4FT6A 3JADA 1D0XA 4LMLA 4Z3TA 4HWCA 3P4WA 4HTEA 1XZYA 3AXJB 1E7PA 3AE3A 3ZSSA 4AKRB 3C4ZA 3AE6A 3EHZA 3O9XA 3DJBA 4PJMA 1D0YA 2MHLA 3F31A 2XQ3A 2LFUA 5CFBA 2VKOA 4EZHA 2R8AA 2NR4A 2EHOA 4CI3B 3IA3A 4FRXA 2J4UP 2IC6A 3AA1A 1ORMA 1VCSA 5HXCA 5JRCA 4DV2T 1CHUA 4YT0A 1IJ5A 4HFEA 2YDSA 4EAHA 4DUZT 3BQIA 5JDMA 3HWBA 1VCTA 2W66A 1WYBA 3F2EA 5EE2A 2JQQA 1I6ZA 2A9UA 3EMNX 2HH7A 2PRNA 4O3ZA 5EZYE 2MOZA
chains in the Genus database with same CATH topology
3U3IA 4UEMA 5PRNA 3KBUA 2Q9QD 3PURA 4OYKA 1LRZA 4HE8A 4RJWA 5J2TE 3SOLA 3N9PA 5FP3A 3ZN0B 4FOZA 3KVDD 5L3DB 5FVNA 1VOMA 2X66A 4CZZB 2F1TA 3AAEA 3IEEA 4HKAA 2LHRA 4YJ3E 4RJXA 1CUNA 5A1LA 2QGSA 3L3PA 1OWAA 3UU2A 3AVRA 5DL6A 3HR0A 4U9CA 1HF8A 3FB2A 4CQIA 4IDZA 2X0LB 2PG8A 5ADXL 4AI6A 2ZM0A 2FGRA 4EB6E 3HL6A 4UVAB 3V5SA 3UAQA 1FEWA 2MYSA 1O3XA 3N9LA 1BR1A 3QK6A 4YFSA 2KZ7B 2LOPA 4DBRA 5KMGP 2K4TA 3O0EA 2BVMA 5JDPA 2K5BB 3AA7B 3RYIE 1IAPA 2W0GA 3K3NA 2KT9A 5DQWA 2L3LA 2J1NA 3K3QC 3VZTX 4O3YA 4AKRA 1QJ9A 4E7ZA 3CX8B 3FHNA 2EHOB 5E0OA 5HYAA 3CQCB 3WI5A 2ODVA 2X9XA 4OYJA 4D65A 4HEAA 5HXSA 5GV0A 4O49A 4JEUB 3K19A 5JR9C 3C64A 2KWIB 3C5OA 3UTKA 4O4HE 3ETUA 3CQGB 4WBNE 3T0SA 2M07A 2YNKA 5KX5E 3LK41 2NP9A 1HXUA 4RL9A 1MNDA 2SPCA 4Z8XA 4H9RC 5HAXA 5IHYA 2W61A 5DQVA 3RYCE 4HGAA 1WRDA 2LSJA 2YU2A 4OK0A 4PJLA 5LGUB 2KINB 3G7GA 2Y7SA 2V7LA 3H3AA 3CX6B 3KV6A 4AKGA 4AKMA 5M4YA 3DP7A 2EHOD 2D0TA 4ISSA 3WI3A 5LXTE 4X1YE 4G76A 4RLCA 2CWYA 4E7SA 2P9BA 4FSOA 4IE5A 1QJPA 2JMHA 2CXLA 2ZMAA 4OFZA 5LNKA 2Y8DA 2E8IA 2L9QA 3L09A 4DMVA 5EK4A 1GFNA 4P09A 4CI2B 1BR2A 4PAGA 4V1Av 5DJQC 4ZS2A 1H6S1 3KV4A 3KVBA 5EK2A 5LGTB 2XAHB 3WAKA 4LSIA 3VHLA 4N59A 3GN5B 4AFKA 2NW7A 1MM4A 1IJ6A 4RLBA 1HX8A 4O2BE 3KV5A 1G73A 3ZJ1A 3TZGA 4GHBA 4U74A 5GONE 2XUEA 2NTYA 1UCUA 4PNIA 2Y0HA 3WAJA 3OBVE 4O4UA 1GFOA 4XNKA 1SHZC 4UVBB 3SRZA 3RKOA 3ONXA 3UPGA 4WBOA 1FMVA 2CMRA 4G2AA 3KINB 5L3EB 4ZOLE 3JTYA 3PORA 3T24A 3RPUA 2VK9A 2YEVC 3DTOA 3RRCA 4E1SA 2H7VC 4QQ1A 3FBZA 1HG2A 4G63A 2KWHA 3U78A 2KZ7A 2LM9A 4EZ4A 4QX8B 4HFVA 4QXHB 2KC0A 2CXDA 4C69X 4WW0A 3Q9DA 3I9YA 4X20E 4DNDA 1ZHXA 2V7KA 4ZS3A 1HS7A 5FXVA 4UIGA 5IYZE 3ZYMA 4EYYR 5LHIB 4G75A 3UUNA 2ZLYA 2JMKA 1MMNA 5LBQB 1NWMX 4PFOA 1KNZA 3AB3B 3SZVA 1U5PA 2LE8A 1Z0PA 2CLYB 5L3FB 2NWBA 2NTXA 1MMAA 4JUYA 2X68A 1MM5A 2QTKA 3Q5WA 3PU8A 3OYXA 2L8KA 2Q9QC 2XAGB 4EIWA 3ZYLA 1MMGA 4B61A 3PDYA 4O4JE 5FXZA 2CWOA 3MXZA 4MBQA 2W81C 1HCIA 1BH3A 4P0BA 2XAFB 1NAFA 1UX4A 2LOSA 1FMWA 3ESLA 3LK2B 5DL5A 5ADXK 3IF8B 3VZUX 2YK0A 2LSGA 2LT3A 3QC9A 2KNDA 4OHFA 1GFQA 1OXZA 1KK7A 4U72A 3ZPOA 5J2UE 1HXTA 5JDQA 2I59A 3Q5XA 3T8OA 1LVKA 5ETWA 2DCFA 4FRTA 4AZLA 4ERRA 5CA1E 1LKXA 2VASA 3KBTA 2XE1A 2W63A 4B6XA 1BR0A 4C90A 3NZPA 3NSGA 4H9QC 5DABA 2LSIA 3GN5A 2N2MA 5HXRA 4O4LE 2X9YA 3QUJA 2WSSV 2GK9A 3JC6C 3KFWX 3MACA 3HI2A 2C0SA 3ZC0A 3ZMVB 3H37A 4GK5E 2E9XC 2H7OA 1IZNA 2IW5B 4LSFA 5JDGA 2Y0LA 5HWXA 4PK5A 4ZI2D 2KXPB 2LHNA 3MKDA 4MLKA 4D64A 3CMLA 4PFPA 4KR4A 3N5LA 2YPVA 2FGQX 4E1TA 2JJ9A 5LJMA 3POQA 5T5FA 2X51A 3GP6A 4UELA 4TZ4C 1OPFA 1OSMA 3QRCA 4JCHA 3EDVA 4PK4A 2JPFA 4PK6A 2PJQA 2XTRA 3OYZA 2LHFA 5AFUK 2VB6A 4ZHQE 4NUUA 3KDSE 2BDEA 3W15B 5KDMC 3VZWX 2DHRA 2N2NA 4I43B 4AYEC 3O1HA 2CM0A 2M06A 3N9OA 4IGUA 4CXYA 2UXXB 2D0UA 4AUIA 4X1IE 4UF0B 4J2CA 5LG4A 4UV9B 3VY9X 3POUA 5F8PA 3ZC1A 2LEHA 2XTLA 4YLHA 4C91A 4D5UA 4PUXA 2B1EA 2VKDA 1US7B 5C8YE 4BAYB 5H6QB 3EDUA 4ADZA 2OMFA 3Q2MA 4TV8E 5AFUL 4JEHB 2ZM8A 1ZHYA 3HKEE 2XMXA 5JR9B 4FMSA 4CXWA 3LK3A 4ZI3C 2ES0A 1QUUA 3K3OA 1Q9FA 4IIJE 4UXNB 4GK0E 5FY7A 5L3CB 2K48A 3LK2A 2W80C 1PHOA 5FNVE 2X9WA 4QKNA 4ILUA 5FY1A 3UUMA 3V5UA 1H7CA 1G8XA 1MMDA 1S35A 4L0RA 2OA5A 3MA9A 3N2OA 2MBGA 3LK42 3ZEFB 2VKHA 4WNKA 4XAXB 4PJJA 3ZMTB 3FXDB 4KBMB 5F3JA 2IC9A 3LJCA 4N58A 3RH3A 3C50A 1IZNB 2VWAA 3GA8A 3M65A 4F6RC 2XTQA 3BQLA 1WR6A 1Y64B 4GF4A 3WI4A 3AAIA 2N2LA 3AA0B 5J1GA 4HN9A 5JDFA 2V7JA 1E54A 2XG6A 5HXHA 3RC8A 3SYBA 3ETVA 3CPZA 1YW0A 4PJNA 2DLRA 3SWHA 3KV9A 3ANWA 1EZ3A 3D0TA 2KXPA 2NW8A 4DVDA 3N2KE 2X27X 1P4TA 4GCQA 3UFEA 3PQSA 4H9OC 2CE7A 4EOZB 5FY0A 5L2LA 3C4XA 1ZHCA 4P0AA 5D5DA 5LCYA 1BXWA 4AYMC 3PQUA 2HPLA 3ZJ2A 2O4VA 3R84B 3PTRB 3A2SX 4QWNB 3PUGA 1PRNA 3OKQA 4BA9A 2VKJA 5LHGB 2LJLA 2E9XA 3ZMSB 3S4UA 5JDLA 2BZBA 2WMOA 4IE0A 3GMIA 5TAOA 3ZCIA 3J9X1 4IE4A 3PUSA 1B7TA 4UF0A 4IE7A 4JLEA 2K9AA 3CWZB 1YKHB 5FYMA 2X67A 5CB4E 4AYID 3RX6A 2V7MA 2YU1A 2XE5A 2CEAA 4CXXA 3N2GE 4FZNA 3ZN1B 2MNHA 4O4IE 4AXPA 3IBPA 3LK3B 3MZKB 6PRNA 5L3GB 3ZLIA 4A56A 4H9PC 2LSYA 4QXCB 2K24A 2NOXA 2DWKA 3NRXA 4I50E 4AYDC 5JR9A 2DI4A 1MIWA 2Y0KA 4YJ2E 4ZI2C 4XBFB 5DL7A 3VE2A 5DL8A 7PRNA 1ZKEA 2Q9QB 2ODJA 4O2AE 5LOVE 4BUMX 2K0LA 3LG7A 4KRAA 4KP3C 4MHCA 3EVYA 4UVCB 3PRNA 3PU3A 4O4XA 3DA3A 4BJMA 2Y48B 4FZLA 4TX5A 3VU7H 4MALA 3VKHA 5BMVE 3O4XE 3AVSA 3LFMA 4AQFC 3RYFE 4GCPA 4QX7B 2MTQA 3SY9A 2RA1A 2XAQB 4GCSA 4XZCA 3AA0A 3ANWB 3UUXB 2RP4A 4KUMB 1LVFA 1HG5A 3EUHA 1GFMA 2PBIA 1D0ZA 4GYRA 5LYJE 2JMMA 4GOUA 4TV9E 5JH7E 1HFAA 1HTJF 5FXXA 3SS1A 2KDYA 3HKDE 1AJ3A 3VY8X 3RC3A 2V26A 2WBLA 4GIWA 2EHOC 4ASKA 3RYHE 1HXXA 3OJAA 5JQGE 2X9HA 4I55E 2BVLA 4QHOA 4YHJA 5IYUA 2CA5A 1UX5A 2W00A 1D1CA 3POXA 2E9XB 3C4WA 4LSEA 5G26A 2J1DG 1THQA 3AA6A 2Z6EA 4IE6A 3CKDA 2PFVA 3NRYA 1U4QA 3K8PC 2DWGA 3O1JA 1QSDA 3HA4A 4M1PA 5LBMA 2ACXA 2V7IA 2WMNA 3P8CD 3ZYKA 2G0UA 2C5KT 4TN7B 4KMCA 2W62A 2ERVA 1ZHWA 4XNLA 4I4TE 3VE1A 3C98B 4AYNA 3E0ZA 4DBQA 1MIYA 1ZEEA 3E22E 3JC6D 2PORA 3E08A 3B13A 4AQGA 2D2SA 3AA1B 2E9XD 2N1GA 2Y6XA 5LA6E 1VRBA 3HKCE 2C5IT 3A5XA 3I0OA 2IAKA 4O8SA 4PW8A 5FMNA 5JDNA 5JRCB 4FESA 4FSPA 4FUVA 1G90A 2LSKA 3KVAA 2XE3A 4EXTA 1ZV4X 4JFBA 2A2FX 1X79A 4LSHA 2CXFA 5CA0E 3NBXX 1Q9GA 1WYCA 5LHHB 3BK9A 2A3DA 3ZCJA 3QRAA 3RBHA 3AAAB 5JVDE 2XQYA 3PE0A 4L5GA 2N9DA 3CQXC 3UULA 2Q9QA 3FBLA 4TUYE 3N9NA 2XASB 2QA7A 1YKEB 4BJNA 2ZM2A 5HWYA 4DMWA 4AKIA 2XE2A 1D1AA 2XHEB 2M67A 4EYUA 2WAUA 3VKGA 3FYXA 2C5JA 4O3WA 3LBXA 4GYSA 3TKLB 4FJOA 2XAJB 3CVRA 2NW9A 2VL8A 3MJXA 2HPJA 5LGNB 3SZDA 2H3RA 1V9DA 5JREA 1BR4A 2JRKA 4ISTA 2YINA 3DA4A 3HKBE 3AAEB 5HXEA 1E1HB 3I0QA 3T20A 4X1KE 3PUAA 4ZI7E 4F4BA 1BT9A 3ZMUB 4H9NC 4H9SE 3CX7B 5H6RB 1YS5A 3GWHA 3HOEA 3IHRA 4FT6A 2KLQA 1D0XA 1T98A 3HOLA 4N78D 3ZMZB 3B57A 2DNXA 3AA6B 2V1DB 4Z3TA 2WM9A 4ZI3D 4QXBB 3C51A 4HTEA 1D1BA 1YD8G 4NUVA 5FXWA 4AKHA 4AQFA 3FXEB 1WLXA 2CLYC 2ODUA 3J7Yq 2CCQA 2Y2XA 5LJNA 4AKRB 3C4ZA 2A72A 4FI5A 3BQKA 1MIVA 3AA7A 8PRNA 3NZQA 3MK7C 1S94A 3P7IA 4IHJE 3DJBA 3O9XA 4PJMA 1D0YA 5LP6E 2GE4A 2MHLA 3F31A 2ZFGA 3V8UA 1GFPA 3F57A 2LFUA 3N9QA 2VKOA 4EZHA 3I9WA 2EHOA 4CI3B 2ZLDA 4FZMA 4FRXA 2J4UP 2IC6A 2KMFA 3R6NA 1MPFA 3AA1A 1SA0E 1ORMA 5HXCA 5JRCA 3N9MA 4MFRA 4KR8A 4L9IA 3O1IA 4UV8B 2UXNB 4H63H 5L3BB 2WWUA 1FIOA 1IJ5A 1ZHZA 4H63V 3SYSA 4EAHA 2D5UA 4O3XB 4CI1B 1QJ8A 3BQIA 4ANJA 3PUQA 5JDMA 3HWBA 1MNEA 3AAAA 1WYBA 3LBXB 3I1AA 3F2EA 5EE2A 4DO0A 3HW9A 3RRWA 2JQQA 2F1VA 3SY7A 1ZHTA 3UT5E 5EK3A 3EMNX 4K0UA 5JDHA 2HH7A 4AKLA 2PRNA 4O3ZA 5EZYE 2MOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  4AKR A;  3AA0 B;  5AFU L;  3AAE A;  3AA1 B;  5AFU K;  4AKR B;  3LK3 A;  2KZ7 A;  3LK2 A;  3AAE B;  3AAA A;  3AA7 A;  5ADX L;  2KXP A;  1IZN A;  3AA6 A;  3LK4 2;  3LK4 1;  3LK3 B;  2KZ7 B;  3LK2 B;  5ADX K;  3AAA B;  3AA6 B;  3AA0 A;  2KXP B;  3AA7 B;  1IZN B; 
#chains in the Genus database with same CATH topology
 4UEM A;  4OYK A;  4HE8 A;  3KZI O;  4U2Z A;  1VOM A;  4CZZ B;  2J47 A;  4HKA A;  3BS0 A;  3HR0 A;  1HF8 A;  3FB2 A;  2FGR A;  4PR7 A;  3V5S A;  3LK4 1;  3QK6 A;  5JDP A;  2UXD T;  5AQL B;  3AXJ A;  3P4R A;  4AKR A;  4Z91 A;  4E7Z A;  3FHN A;  1Y01 A;  2X9X A;  3AEA A;  4WYV A;  3RF1 A;  2XQ4 A;  2KWI B;  4A97 A;  1YQ4 A;  3UTK A;  2M07 A;  1JNZ A;  3QOF A;  4HGA A;  4AKG A;  3H3A A;  5L47 A;  4ISS A;  2D0T A;  4RLC A;  5LMN T;  2JMH A;  5FL0 A;  2CXL A;  4ILC A;  2L9Q A;  3G06 A;  1BR2 A;  3KVB A;  4EED A;  3TLT A;  5LGT B;  4LSI A;  2NW7 A;  4O2B E;  3ZJ1 A;  4TWD A;  2WJQ A;  3OPC A;  2YN6 A;  4XNK A;  3SRZ A;  2X0Y A;  2VK9 A;  3EAM A;  3U78 A;  2LM9 A;  4IDO A;  1L0V A;  5HEH A;  2CXD A;  4GKK T;  4WW0 A;  4DND A;  2V6X A;  4A98 A;  1HS7 A;  5FXV A;  4UIG A;  2JQH A;  3UUN A;  5LBQ B;  1MMN A;  3TLV A;  1NWM X;  3AB3 B;  1U5P A;  2HN2 A;  2W67 A;  2NTX A;  5ABH A;  4KHP T;  3OYX A;  2XAG B;  3ZYL A;  2UUB T;  3PDY A;  5FXZ A;  3UU8 A;  1BH3 A;  2XAF B;  1UX4 A;  3QC9 A;  2LT3 A;  2KND A;  1OXZ A;  1N34 T;  3T8O A;  4FRT A;  2VAS A;  4C90 A;  3BRY A;  3NSG A;  5DAB A;  2LSI A;  2X9Y A;  3QUJ A;  2WSS V;  2GK9 A;  4ILA A;  3HI2 A;  3ZC0 A;  3ZMV B;  2E9X C;  4LSF A;  2IW5 B;  5JDG A;  5HWX A;  3UQ4 A;  3MKD A;  4D64 A;  3CML A;  2YPV A;  2JJ9 A;  2LKG A;  4I0U A;  2X51 A;  3GP6 A;  3P4S A;  1OPF A;  5ABF B;  4IL4 A;  2LHF A;  2QVA A;  2VB6 A;  2BDE A;  2ACZ A;  4EEB A;  1WFD A;  2BKP A;  3AE7 A;  4IGU A;  4CXY A;  2D0U A;  4AUI A;  1SUM B;  4UV9 B;  3VY9 X;  5B66 O;  2WWV A;  2MAW A;  5H6Q B;  3EDU A;  1HNZ T;  3Q2M A;  4QH4 A;  3A0H O;  3LK3 A;  3K3O A;  4IIJ E;  4GK0 E;  2I6H A;  2W80 C;  3V5U A;  1S35 A;  2MBG A;  3PJA A;  1YQ3 A;  2VKH A;  4TNW A;  4PJJ A;  3ZMT B;  3FXD B;  4N58 A;  1N32 T;  2XTQ A;  4IL9 A;  3T1H T;  1E54 A;  5HXH A;  3RC8 A;  4PJN A;  1YW0 A;  3KV9 A;  5ABE A;  3ANW A;  3D0T A;  4DVD A;  1P4T A;  3WU2 O;  4C4V B;  4EOZ B;  5FY0 A;  5L2L A;  3C4X A;  1ZHC A;  3FZL B;  2V6Y A;  2WVP A;  4U33 A;  2HPL A;  5ABF A;  3A2S X;  3PUG A;  2CBJ A;  4IDQ A;  3OKQ A;  1XMQ T;  1OED B;  3TLU A;  5AQJ B;  2CBI A;  2AE9 A;  2BZB A;  2WMO A;  5TAO A;  1YXR A;  1B7T A;  4CN4 A;  4AYI D;  2YOE A;  3RX6 A;  2V7M A;  4GKJ T;  2CEA A;  4AXP A;  3MZK B;  6PRN A;  3ZLI A;  2UXC T;  4UB8 O;  4H9P C;  4QXC B;  2NOX A;  2DWK A;  2VQF T;  4YJ2 E;  4XBF B;  5AQR B;  3VE2 A;  7PRN A;  4BUM X;  2AXT O;  3A0B O;  2UU9 T;  3ZKR A;  3ZT6 A;  4HFH A;  3O4X E;  3RYF E;  2RA1 A;  4GCS A;  4XZC A;  3UU5 A;  4KUM B;  4X64 T;  3B5M A;  4GOU A;  4HFD A;  1AJ3 A;  3VY8 X;  2WBL A;  5G38 A;  3P4Q A;  4QHO A;  4YHJ A;  2CA5 A;  4C4V A;  1D1C A;  4LSE A;  1W9R A;  1THQ A;  3AA6 A;  2PFV A;  4X66 T;  3O1J A;  5LBM A;  3HA4 A;  1OED A;  2WMN A;  4KMC A;  3C98 B;  2KSR A;  3E0Z A;  4DBQ A;  2E9X D;  5AQP B;  4RJW A;  1VRB A;  3A5X A;  4FES A;  4PW8 A;  1SE7 A;  2XE3 A;  4EXT A;  4LMK A;  1GQE A;  2A2F X;  3NBX X;  1WYC A;  5LHH B;  3BK9 A;  2X9K A;  3ZCJ A;  3RBH A;  1IBL T;  2WB5 A;  2N9D A;  3CQX C;  3UUL A;  3FBL A;  2ZM2 A;  4AKI A;  2XE2 A;  1D1A A;  2JQK A;  4DR3 T;  2R89 A;  3MJX A;  2HPJ A;  1V9D A;  2QRX A;  2VUR A;  4YSX A;  3T20 A;  3ZMU B;  1YS5 A;  4DR1 T;  3HOE A;  2XQ8 A;  2KLQ A;  3ZMZ B;  2R4P A;  5FXW A;  1YD8 G;  4AKH A;  3FXE B;  2CLY C;  3P50 A;  2N2M A;  2HN1 A;  2GE4 A;  3JCU O;  4LF9 T;  4DV5 T;  3I9W A;  3A7M A;  3QB5 K;  5AQU B;  3EAB A;  3JAF A;  2LRL A;  3N9M A;  4MFR A;  4KR8 A;  3O1I A;  2UXN B;  2WS3 A;  1FIO A;  3RGL A;  3JAE A;  1R8I A;  2D5U A;  4CI1 B;  1MNE A;  5LMU T;  4UB6 O;  4HFC A;  3HW9 A;  3SY7 A;  5JDH A;  4B3M T;  3VRB A;  4AQY T;  3RLF F;  1XMO T;  4JI6 T;  2XQ5 A;  5FP3 A;  3ZN0 B;  2WU5 A;  4FOZ A;  3KVD D;  5FVN A;  1CUN A;  2QGS A;  1OWA A;  3UU2 A;  4CQI A;  2X0L B;  4AI6 A;  2ZM0 A;  3PUZ F;  5KMG P;  2LOP A;  4WZX A;  5LB7 B;  2K5B B;  3RYI E;  1J5E T;  4U7Y A;  3PUX F;  5E0O A;  2EHO B;  3WI5 A;  4DR5 T;  4D65 A;  3UU3 A;  2IML A;  1W0A A;  4JEU B;  3C64 A;  3ETU A;  4WBN E;  2YNK A;  5KX5 E;  2NP9 A;  1HXU A;  4RL9 A;  1MND A;  2SPC A;  5HAX A;  5DQV A;  3RYC E;  4AIS A;  3M3Z B;  2LLY A;  2KIN B;  1HR0 T;  2V7L A;  3KV6 A;  4LF7 T;  4X1Y E;  3FZM B;  5LNK A;  1KEY A;  2E8I A;  4IRE A;  4YY3 T;  4ZS2 A;  3PJA J;  4X62 T;  3GN5 B;  1HNW T;  4RLB A;  1IJ6 A;  1G73 A;  4GHB A;  2XUE A;  5KXJ A;  2R88 A;  5H2F O;  2OLT A;  3WAJ A;  4N74 A;  4O4U A;  1SHZ C;  4UVB B;  3RKO A;  3UPG A;  1FMV A;  4JV5 T;  3KIN B;  5L3E B;  3T24 A;  3POR A;  4E1S A;  4QX8 B;  1N36 T;  2KC0 A;  4X20 E;  3AEC A;  1ZHX A;  2V7K A;  3ZYM A;  2IHR 1;  1KNZ A;  5G39 A;  3SZV A;  1Z0P A;  5L3F B;  1MM5 A;  2QTK A;  4YXD A;  2Q9Q C;  1MMG A;  4B61 A;  2K3W A;  2CWO A;  2LOS A;  3VZU X;  2LSG A;  1UK5 A;  1GFQ A;  1KK7 A;  5J2U E;  2I59 A;  1LVK A;  4ERR A;  2XE1 A;  3AE1 A;  2FUP A;  4H9Q C;  3GN5 A;  2IIU A;  2BS3 A;  3MAC A;  3H37 A;  1IZN A;  3DZM A;  4E1T A;  3H3M A;  5LJM A;  1J1J A;  4Z90 A;  4TZ4 C;  3VRA A;  3QRC A;  4PJ0 O;  5B5E O;  2JPF A;  4B3R T;  4JI4 T;  5IWA T;  1XNR T;  5AFU K;  4ZHQ E;  2XM1 A;  3W15 B;  2N2N A;  3O1H A;  4DV1 T;  3N9O A;  2UXX B;  4X1I E;  4J2C A;  3QB5 A;  4YLH A;  2VKD A;  1US7 B;  5C8Y E;  4YSY A;  3VR9 A;  4FQE A;  2CRB A;  2ZM8 A;  2XMX A;  2CPT A;  2R6G F;  5JR9 B;  5AQF B;  5AQK B;  4HWI B;  2ES0 A;  1Q9F A;  5FY7 A;  3PGU A;  1PHO A;  4EB6 E;  4QKN A;  4ILU A;  1H7C A;  4L0R A;  2OA5 A;  3LK4 2;  3ZEF B;  4WNK A;  5C3J A;  2V8S V;  4P1N A;  2VWA A;  5GTH O;  1Y64 B;  4GF4 A;  3AA0 B;  5JDF A;  2X0H A;  3JCF A;  3ETV A;  2CHN A;  3ONJ A;  2PTF A;  3UFE A;  4H9O C;  5LG3 A;  3PQU A;  4DV3 T;  2VKJ A;  5LHG B;  2E9X A;  3S4U A;  2DL1 A;  4IE0 A;  3GMI A;  2FBW A;  4IE4 A;  3J9X 1;  4LFB T;  4JLE A;  1YKH B;  5FYM A;  3TLW A;  4U7I A;  3N2G E;  2R4L A;  3LK3 B;  2W4X A;  1HNX T;  2K24 A;  4AYD C;  5JR9 A;  2Y0K A;  4ZI2 C;  5DL7 A;  2ODJ A;  4O2A E;  5LOV E;  4DID B;  2K0L A;  3LG7 A;  4KP3 C;  4MHC A;  2Y48 B;  4FZL A;  4MAL A;  2JQ9 A;  3VKH A;  3AE8 A;  3LFM A;  4AQF C;  2VQE T;  2XQ7 A;  3AA0 A;  3ANW B;  1LVF A;  3PUW F;  1GFM A;  2JMM A;  1D0Z A;  4TV9 E;  1W09 A;  2V6Y B;  2KDY A;  2YDQ A;  4HFI A;  4ASK A;  3RYH E;  3OJA A;  2X9H A;  4I55 E;  3ZST A;  3P4P A;  3UFG A;  5AQT B;  4U2Y A;  4U31 A;  2IDO B;  1QSD A;  2V7I A;  3P8C D;  3ZYK A;  2G0U A;  3PUY F;  2W62 A;  1ZHW A;  1XWM A;  4AYN A;  4N75 A;  4LMJ A;  2POR A;  1MIY A;  1ZEE A;  3E08 A;  3B13 A;  2F1C X;  5LA6 E;  4O8S A;  5FMN A;  3I0O A;  2IAK A;  4FSP A;  1G90 A;  4QH5 A;  1ZV4 X;  4JFB A;  1X79 A;  5CA0 E;  3K1S A;  2UUC T;  3QRA A;  5JVD E;  1WCR A;  3N9N A;  1YKE B;  4BJN A;  3LBX A;  1UGO A;  2XQA A;  2XAJ B;  3CVR A;  5CJ5 A;  2H3R A;  1BR4 A;  2JRK A;  4IST A;  3SFE A;  3DA4 A;  3HKB E;  3CK6 A;  2BBJ A;  2BG9 B;  5HXE A;  5HEG A;  4ZI7 E;  1BT9 A;  4F8H A;  4H9N C;  4H9S E;  3CX7 B;  3GWH A;  2YKS A;  4DUY T;  3IHR A;  3X1D A;  1T98 A;  3B57 A;  3AA6 B;  4OX9 T;  4UR9 A;  4X5T A;  4QXB B;  3C51 A;  2ODU A;  3J7Y q;  2RPA A;  4DR6 T;  5GTI O;  4FI5 A;  5HCM A;  1MIV A;  3AA7 A;  8PRN A;  3P7I A;  3MK7 C;  4IHJ E;  3F57 A;  3N9Q A;  1I94 T;  2OV9 A;  2KMF A;  2XY8 B;  3UU6 A;  2E2A A;  4L9I A;  4UV8 B;  3UU4 A;  1ZHZ A;  4H63 V;  4O3X B;  1QJ8 A;  4ANJ A;  4JI2 T;  1QLB A;  4DO0 A;  2F1V A;  5EK3 A;  4Q25 A;  5D5D A;  3KBU A;  3PUR A;  5J2T E;  3SOL A;  3T1Y T;  2F1T A;  2BG9 A;  3IEE A;  2LHR A;  4IDP A;  5BR8 T;  3NWI A;  4LFC T;  5DL6 A;  4U9C A;  4KX6 A;  3EI0 A;  3HL6 A;  3UAQ A;  4DBR A;  2MYS A;  2K4T A;  2BVM A;  2H89 A;  1IAP A;  5DQW A;  2L3L A;  2J1N A;  3K3Q C;  3VZT X;  4O3Y A;  5FVL A;  3Q5D A;  1QJ9 A;  3CX8 B;  1HX1 B;  3CQC B;  2M6I A;  4HEA A;  5HXS A;  5GV0 A;  3K19 A;  2WDR A;  4DV7 T;  4DR2 T;  3T0S A;  2CHO A;  4Z8X A;  5IHY A;  2W61 A;  1WRD A;  5LGU B;  2YU2 A;  4PJL A;  5M4Y A;  2WU2 A;  4JI8 T;  3AE2 A;  3PUV F;  4IE5 A;  2ZMA A;  4OFZ A;  5FKY A;  2Y8D A;  3UQ7 A;  4DMV A;  4P09 A;  5DJQ C;  4V1A v;  3KV4 A;  3AEF A;  3VHL A;  3KV5 A;  3TZG A;  4U74 A;  5GON E;  3QNU A;  1GFO A;  4EV6 A;  3PGR A;  3ONX A;  1OED C;  4ZOL E;  3RPU A;  3RRC A;  3DTO A;  2H7V C;  2KWH A;  4EZ4 A;  4HFV A;  4QXH B;  2XQ9 A;  4C69 X;  3ZT7 A;  3Q9D A;  3I9Y A;  3ABV A;  5AQN B;  2UUA T;  1KNR A;  1KNP A;  4ZS3 A;  4EYY R;  4G75 A;  3RIU A;  4PFO A;  2LE8 A;  2NWB A;  1MMA A;  4ILB A;  3Q5W A;  1KFY A;  5HEJ A;  4EIW A;  3AE9 A;  4HWD A;  4O4J E;  4MBQ A;  2W81 C;  3DWN A;  2BG9 E;  1NAF A;  2R4O A;  3LK2 B;  2YK0 A;  1DU2 A;  3Q5X A;  5ETW A;  2DCF A;  4AZL A;  4DR4 T;  2WP9 A;  3UUB A;  5CA1 E;  2W63 A;  4B6X A;  3NZP A;  1OED E;  1X9B A;  3L8R A;  4CTD A;  5HXR A;  4O4L E;  2C0S A;  3FZK B;  4IT4 A;  5C2T A;  2Y0L A;  2R4N A;  2KXP B;  4PFP A;  4KR4 A;  2D9D A;  2FGQ X;  5FL1 A;  4PK4 A;  4PK6 A;  2XTR A;  3NKZ A;  5KDM C;  2DHR A;  2BKN A;  2VVS A;  4UF0 B;  4ZEY A;  5AQG B;  5AQV B;  3POU A;  3ZC1 A;  2LEH A;  4C91 A;  1W0B A;  4ADZ A;  5AFU L;  1JNR A;  1E2A A;  4CXW A;  2IWV A;  4KHZ F;  4NIQ A;  4ZI3 C;  1QUU A;  5L3C B;  1T8B A;  2WJR A;  2K48 A;  3LK2 A;  5FNV E;  4B3T T;  5FY1 A;  3UUM A;  3NVO A;  3AE5 A;  3MA9 A;  5F5W A;  5G3A A;  1IBM T;  4KBM B;  2IC9 A;  3LJC A;  3RH3 A;  1IZN B;  3C50 A;  3GA8 A;  3M65 A;  2BBH A;  1WR6 A;  2XJ7 A;  3AAI A;  2N2L A;  2XG6 A;  3CPZ A;  2DLR A;  1NEK A;  1IBK T;  1EZ3 A;  2KXP A;  2NW8 A;  3VR8 A;  2X27 X;  4GCQ A;  3CIR A;  4P0A A;  1BXW A;  4AYM C;  3R84 B;  4LF4 T;  2V5D A;  4BA9 A;  2LJL A;  3ZMS B;  5JDL A;  4JBW F;  3ZCI A;  3PUS A;  4UF0 A;  4IE7 A;  2K9A A;  4ZZC A;  2YU1 A;  4CXX A;  4JI1 T;  5AQO B;  3ZN1 B;  2MNH A;  4FZN A;  5CGM A;  5L3G B;  3PGS A;  4LF5 T;  4A56 A;  2LSY A;  3AEB A;  4I50 E;  1MIW A;  2FJE A;  5DL8 A;  3TLS A;  1ZKE A;  4KRA A;  2LRK A;  1FJG T;  3PU3 A;  4DV0 T;  4O4X A;  3DA3 A;  1XDP A;  4TX5 A;  4QH1 A;  3VU7 H;  5BMV E;  4GCP A;  2BS4 A;  2MTQ A;  3SY9 A;  2XAQ B;  5HEO A;  4K3B A;  2H88 A;  4DR7 T;  3EUH A;  2PBI A;  5LYJ E;  5FXX A;  1HTJ F;  3RC3 A;  4X65 T;  1M62 A;  2EHO C;  3LDQ B;  5JQG E;  3PF1 A;  2E9X B;  2J1D G;  3AE4 A;  4NXN T;  2LKH A;  4IE6 A;  3CKD A;  4JI5 T;  4M1P A;  3K8P C;  2FJB A;  2C5K T;  3AEG A;  4TN7 B;  2WDV A;  4XNL A;  3VE1 A;  2JQY A;  2AXD S;  2Y6X A;  4TNV A;  5JH7 E;  2UXB T;  2C5I T;  5JDN A;  3RIF A;  4FUV A;  2XPK A;  2A3D A;  3AAA B;  5KAF O;  2XQY A;  4HWH A;  2ZM6 T;  2XAS B;  2QA7 A;  2XHE B;  2M67 A;  2F4V T;  4GYS A;  3TKL B;  2VL8 A;  3NJT A;  3SZD A;  5JRE A;  3RIA A;  2YIN A;  1T7S A;  3AAE B;  1XDO A;  2LM2 A;  3I0Q A;  5KAI O;  4X1K E;  3PUA A;  1ZOY A;  3HOL A;  4N78 D;  4B3S T;  2DNX A;  2V1D B;  2WM9 A;  4ZI3 D;  3PV0 F;  1D1B A;  4NUV A;  4AQF A;  4DV6 T;  1WLX A;  5JTG A;  1N33 T;  2CCQ A;  2WY2 A;  3RQW A;  2Y2X A;  5LJN A;  2A72 A;  3BQK A;  3NZQ A;  1S94 A;  5LP6 E;  3V8U A;  2ZFG A;  3A8Y C;  1GFP A;  3RI5 A;  4K3C A;  2ZLD A;  4FZM A;  5HEU A;  3R6N A;  1MPF A;  1SA0 E;  4C00 A;  4H63 H;  5L3B B;  2WWU A;  3SYS A;  5TIS O;  3PUQ A;  3AAA A;  3LBX B;  3I1A A;  3RRW A;  1ZHT A;  3UT5 E;  4K0U A;  4AKL A;  2B76 A;  3U3I A;  5PRN A;  2Q9Q D;  1LRZ A;  3N9P A;  2WDQ A;  5L3D B;  2X66 A;  3AAE A;  4YJ3 E;  4RJX A;  5A1L A;  3OTO T;  3L3P A;  3AVR A;  5ADX L;  4IDZ A;  2PG8 A;  2BKO A;  4UVA B;  1FEW A;  1O3X A;  3N9L A;  1BR1 A;  4YFS A;  2KZ7 B;  3O0E A;  5E79 O;  3AA7 B;  3K3N A;  2W0G A;  2KT9 A;  2W2U A;  3DWO X;  4JI0 T;  3Q5E A;  5HYA A;  2ODV A;  4OYJ A;  4O49 A;  5JR9 C;  1NEN A;  3C5O A;  4O4H E;  3CQG B;  1T72 A;  2WQY A;  1XNQ T;  2BS2 A;  4H9R C;  2WCA A;  4OK0 A;  2LSJ A;  4LF8 T;  2Y7S A;  3CX6 B;  3SFD A;  4AKM A;  2V5C A;  3DP7 A;  2EHO D;  5LXT E;  3WI3 A;  4G76 A;  2CWY A;  4E7S A;  2P9B A;  4FSO A;  1QJP A;  2VVN A;  5ABG A;  3L09 A;  5EK4 A;  1GFN A;  4CI2 B;  4PAG A;  1H6S 1;  5EK2 A;  2XAH B;  3WAK A;  4N59 A;  4AFK A;  1MM4 A;  1HX8 A;  2IWW A;  2NTY A;  1UCU A;  4PNI A;  2Y0H A;  3RHW A;  4IL6 O;  3OBV E;  2VL0 A;  4WBO A;  2CMR A;  4G2A A;  3JTY A;  2YEV C;  4QQ1 A;  4HFB A;  3FBZ A;  1HG2 A;  4G63 A;  5L4H A;  2KZ7 A;  4YHH T;  4JI3 T;  2FJA A;  5IYZ E;  5LHI B;  4HWF A;  2JMK A;  2ZLY A;  2CLY B;  4NXM T;  4JUY A;  3FZF B;  2X68 A;  2J4G A;  4CN1 A;  2XSB A;  3PU8 A;  2L8K A;  1M7K A;  4ZXL A;  4TWH A;  4JI7 T;  3MXZ A;  1HCI A;  2WZH A;  4P0B A;  4YTP A;  1FMW A;  5AQQ B;  3ESL A;  5DL5 A;  5ADX K;  3IF8 B;  4OHF A;  4DV4 T;  1J5W A;  4U72 A;  3ZPO A;  1HXT A;  5JDQ A;  3ZT5 A;  1LKX A;  3KBT A;  2M6B A;  1BR0 A;  3JC6 C;  3KFW X;  3RQU A;  4GK5 E;  2H7O A;  4K0K T;  2I0M A;  4PK5 A;  1UUR A;  4ZI2 D;  2LHN A;  4MLK A;  3N5L A;  5AQM B;  5T5F A;  3POQ A;  4UEL A;  1OSM A;  2JIW A;  4JCH A;  3EDV A;  2PJQ A;  3OYZ A;  2J62 A;  3ONL C;  4NUU A;  3KDS E;  3BRZ A;  3VZW X;  4ZZB A;  4AYE C;  4I43 B;  2XSA A;  2M06 A;  2CM0 A;  5LG4 A;  5F8P A;  2XTL A;  4D5U A;  4A5X A;  4PUX A;  2B1E A;  4BAY B;  2E5L T;  2OMF A;  4TV8 E;  4JEH B;  1ZHY A;  3HKE E;  4EGW A;  4JYA T;  4FMS A;  4LFA T;  4TWF A;  2XQ6 A;  4UXN B;  1WR0 A;  5HCJ A;  2X9W A;  3G7G A;  1G8X A;  1MMD A;  2BG9 C;  3N2O A;  4XAX B;  5F3J A;  4F6R C;  3BQL A;  2WZI A;  5AQI B;  3WI4 A;  5J1G A;  4HN9 A;  2V7J A;  4YTN A;  5IUX A;  3SYB A;  3SWH A;  3N2K E;  3PQS A;  2CE7 A;  4KI0 F;  4NPP A;  1ZP0 A;  5LCY A;  2IUB A;  3ZJ2 A;  2O4V A;  3PTR B;  3AED A;  4QWN B;  1PRN A;  5AQS B;  3CWZ B;  5CB4 E;  2X67 A;  2MPK A;  2XE5 A;  3OVU A;  4O4I E;  3IBP A;  2QYW A;  4IDN A;  4CN6 A;  3NRX A;  4AIU A;  2DI4 A;  1T1L A;  2Q9Q B;  4UVC B;  3EVY A;  3PRN A;  4COF A;  1KF6 A;  4BJM A;  3AVS A;  1Z8U A;  2FJD A;  5L4E A;  4QX7 B;  4LF6 T;  4YSZ A;  2YDR A;  3UUX B;  2RP4 A;  1HG5 A;  4GYR A;  5FVK A;  2HHH T;  1HFA A;  3SS1 A;  3HKD E;  2V26 A;  4GIW A;  1HXX A;  3RIU C;  2BVL A;  5IYU A;  1UX5 A;  2W00 A;  5G26 A;  3C4W A;  2Z6E A;  3NRY A;  1U4Q A;  4DMW A;  2DWG A;  3FZH B;  3RKG A;  2ACX A;  4YTM A;  2ERV A;  2E5V A;  5AQH B;  4I4T E;  3JC6 D;  3E22 E;  4AQG A;  2D2S A;  3AA1 B;  2N1G A;  3POX A;  3HKC E;  5JRC B;  2LSK A;  3KVA A;  5J0Z A;  4LSH A;  2CXF A;  1Q9G A;  3PE0 A;  4L5G A;  1S5L O;  2Q9Q A;  4TUY E;  2XM2 A;  5HWY A;  4EYU A;  2WAU A;  3VKG A;  4U3C A;  3FYX A;  2C5J A;  4O3W A;  4FJO A;  2NW9 A;  5LGN B;  3AEE A;  1UUS A;  1T16 A;  1E1H B;  4F4B A;  5H6R B;  3LSV A;  3L39 A;  2XZE A;  4FT6 A;  3JAD A;  1D0X A;  4LML A;  4Z3T A;  4HWC A;  3P4W A;  4HTE A;  1XZY A;  3AXJ B;  1E7P A;  3AE3 A;  3ZSS A;  4AKR B;  3C4Z A;  3AE6 A;  3EHZ A;  3O9X A;  3DJB A;  4PJM A;  1D0Y A;  2MHL A;  3F31 A;  2XQ3 A;  2LFU A;  5CFB A;  2VKO A;  4EZH A;  2R8A A;  2NR4 A;  2EHO A;  4CI3 B;  3IA3 A;  4FRX A;  2J4U P;  2IC6 A;  3AA1 A;  1ORM A;  1VCS A;  5HXC A;  5JRC A;  4DV2 T;  1CHU A;  4YT0 A;  1IJ5 A;  4HFE A;  2YDS A;  4EAH A;  4DUZ T;  3BQI A;  5JDM A;  3HWB A;  1VCT A;  2W66 A;  1WYB A;  3F2E A;  5EE2 A;  2JQQ A;  1I6Z A;  2A9U A;  3EMN X;  2HH7 A;  2PRN A;  4O3Z A;  5EZY E;  2MOZ A; 
#chains in the Genus database with same CATH homology
 3U3I A;  4UEM A;  5PRN A;  3KBU A;  2Q9Q D;  3PUR A;  4OYK A;  1LRZ A;  4HE8 A;  4RJW A;  5J2T E;  3SOL A;  3N9P A;  5FP3 A;  3ZN0 B;  4FOZ A;  3KVD D;  5L3D B;  5FVN A;  1VOM A;  2X66 A;  4CZZ B;  2F1T A;  3AAE A;  3IEE A;  4HKA A;  2LHR A;  4YJ3 E;  4RJX A;  1CUN A;  5A1L A;  2QGS A;  3L3P A;  1OWA A;  3UU2 A;  3AVR A;  5DL6 A;  3HR0 A;  4U9C A;  1HF8 A;  3FB2 A;  4CQI A;  4IDZ A;  2X0L B;  2PG8 A;  5ADX L;  4AI6 A;  2ZM0 A;  2FGR A;  4EB6 E;  3HL6 A;  4UVA B;  3V5S A;  3UAQ A;  1FEW A;  2MYS A;  1O3X A;  3N9L A;  1BR1 A;  3QK6 A;  4YFS A;  2KZ7 B;  2LOP A;  4DBR A;  5KMG P;  2K4T A;  3O0E A;  2BVM A;  5JDP A;  2K5B B;  3AA7 B;  3RYI E;  1IAP A;  2W0G A;  3K3N A;  2KT9 A;  5DQW A;  2L3L A;  2J1N A;  3K3Q C;  3VZT X;  4O3Y A;  4AKR A;  1QJ9 A;  4E7Z A;  3CX8 B;  3FHN A;  2EHO B;  5E0O A;  5HYA A;  3CQC B;  3WI5 A;  2ODV A;  2X9X A;  4OYJ A;  4D65 A;  4HEA A;  5HXS A;  5GV0 A;  4O49 A;  4JEU B;  3K19 A;  5JR9 C;  3C64 A;  2KWI B;  3C5O A;  3UTK A;  4O4H E;  3ETU A;  3CQG B;  4WBN E;  3T0S A;  2M07 A;  2YNK A;  5KX5 E;  3LK4 1;  2NP9 A;  1HXU A;  4RL9 A;  1MND A;  2SPC A;  4Z8X A;  4H9R C;  5HAX A;  5IHY A;  2W61 A;  5DQV A;  3RYC E;  4HGA A;  1WRD A;  2LSJ A;  2YU2 A;  4OK0 A;  4PJL A;  5LGU B;  2KIN B;  3G7G A;  2Y7S A;  2V7L A;  3H3A A;  3CX6 B;  3KV6 A;  4AKG A;  4AKM A;  5M4Y A;  3DP7 A;  2EHO D;  2D0T A;  4ISS A;  3WI3 A;  5LXT E;  4X1Y E;  4G76 A;  4RLC A;  2CWY A;  4E7S A;  2P9B A;  4FSO A;  4IE5 A;  1QJP A;  2JMH A;  2CXL A;  2ZMA A;  4OFZ A;  5LNK A;  2Y8D A;  2E8I A;  2L9Q A;  3L09 A;  4DMV A;  5EK4 A;  1GFN A;  4P09 A;  4CI2 B;  1BR2 A;  4PAG A;  4V1A v;  5DJQ C;  4ZS2 A;  1H6S 1;  3KV4 A;  3KVB A;  5EK2 A;  5LGT B;  2XAH B;  3WAK A;  4LSI A;  3VHL A;  4N59 A;  3GN5 B;  4AFK A;  2NW7 A;  1MM4 A;  1IJ6 A;  4RLB A;  1HX8 A;  4O2B E;  3KV5 A;  1G73 A;  3ZJ1 A;  3TZG A;  4GHB A;  4U74 A;  5GON E;  2XUE A;  2NTY A;  1UCU A;  4PNI A;  2Y0H A;  3WAJ A;  3OBV E;  4O4U A;  1GFO A;  4XNK A;  1SHZ C;  4UVB B;  3SRZ A;  3RKO A;  3ONX A;  3UPG A;  4WBO A;  1FMV A;  2CMR A;  4G2A A;  3KIN B;  5L3E B;  4ZOL E;  3JTY A;  3POR A;  3T24 A;  3RPU A;  2VK9 A;  2YEV C;  3DTO A;  3RRC A;  4E1S A;  2H7V C;  4QQ1 A;  3FBZ A;  1HG2 A;  4G63 A;  2KWH A;  3U78 A;  2KZ7 A;  2LM9 A;  4EZ4 A;  4QX8 B;  4HFV A;  4QXH B;  2KC0 A;  2CXD A;  4C69 X;  4WW0 A;  3Q9D A;  3I9Y A;  4X20 E;  4DND A;  1ZHX A;  2V7K A;  4ZS3 A;  1HS7 A;  5FXV A;  4UIG A;  5IYZ E;  3ZYM A;  4EYY R;  5LHI B;  4G75 A;  3UUN A;  2ZLY A;  2JMK A;  1MMN A;  5LBQ B;  1NWM X;  4PFO A;  1KNZ A;  3AB3 B;  3SZV A;  1U5P A;  2LE8 A;  1Z0P A;  2CLY B;  5L3F B;  2NWB A;  2NTX A;  1MMA A;  4JUY A;  2X68 A;  1MM5 A;  2QTK A;  3Q5W A;  3PU8 A;  3OYX A;  2L8K A;  2Q9Q C;  2XAG B;  4EIW A;  3ZYL A;  1MMG A;  4B61 A;  3PDY A;  4O4J E;  5FXZ A;  2CWO A;  3MXZ A;  4MBQ A;  2W81 C;  1HCI A;  1BH3 A;  4P0B A;  2XAF B;  1NAF A;  1UX4 A;  2LOS A;  1FMW A;  3ESL A;  3LK2 B;  5DL5 A;  5ADX K;  3IF8 B;  3VZU X;  2YK0 A;  2LSG A;  2LT3 A;  3QC9 A;  2KND A;  4OHF A;  1GFQ A;  1OXZ A;  1KK7 A;  4U72 A;  3ZPO A;  5J2U E;  1HXT A;  5JDQ A;  2I59 A;  3Q5X A;  3T8O A;  1LVK A;  5ETW A;  2DCF A;  4FRT A;  4AZL A;  4ERR A;  5CA1 E;  1LKX A;  2VAS A;  3KBT A;  2XE1 A;  2W63 A;  4B6X A;  1BR0 A;  4C90 A;  3NZP A;  3NSG A;  4H9Q C;  5DAB A;  2LSI A;  3GN5 A;  2N2M A;  5HXR A;  4O4L E;  2X9Y A;  3QUJ A;  2WSS V;  2GK9 A;  3JC6 C;  3KFW X;  3MAC A;  3HI2 A;  2C0S A;  3ZC0 A;  3ZMV B;  3H37 A;  4GK5 E;  2E9X C;  2H7O A;  1IZN A;  2IW5 B;  4LSF A;  5JDG A;  2Y0L A;  5HWX A;  4PK5 A;  4ZI2 D;  2KXP B;  2LHN A;  3MKD A;  4MLK A;  4D64 A;  3CML A;  4PFP A;  4KR4 A;  3N5L A;  2YPV A;  2FGQ X;  4E1T A;  2JJ9 A;  5LJM A;  3POQ A;  5T5F A;  2X51 A;  3GP6 A;  4UEL A;  4TZ4 C;  1OPF A;  1OSM A;  3QRC A;  4JCH A;  3EDV A;  4PK4 A;  2JPF A;  4PK6 A;  2PJQ A;  2XTR A;  3OYZ A;  2LHF A;  5AFU K;  2VB6 A;  4ZHQ E;  4NUU A;  3KDS E;  2BDE A;  3W15 B;  5KDM C;  3VZW X;  2DHR A;  2N2N A;  4I43 B;  4AYE C;  3O1H A;  2CM0 A;  2M06 A;  3N9O A;  4IGU A;  4CXY A;  2UXX B;  2D0U A;  4AUI A;  4X1I E;  4UF0 B;  4J2C A;  5LG4 A;  4UV9 B;  3VY9 X;  3POU A;  5F8P A;  3ZC1 A;  2LEH A;  2XTL A;  4YLH A;  4C91 A;  4D5U A;  4PUX A;  2B1E A;  2VKD A;  1US7 B;  5C8Y E;  4BAY B;  5H6Q B;  3EDU A;  4ADZ A;  2OMF A;  3Q2M A;  4TV8 E;  5AFU L;  4JEH B;  2ZM8 A;  1ZHY A;  3HKE E;  2XMX A;  5JR9 B;  4FMS A;  4CXW A;  3LK3 A;  4ZI3 C;  2ES0 A;  1QUU A;  3K3O A;  1Q9F A;  4IIJ E;  4UXN B;  4GK0 E;  5FY7 A;  5L3C B;  2K48 A;  3LK2 A;  2W80 C;  1PHO A;  5FNV E;  2X9W A;  4QKN A;  4ILU A;  5FY1 A;  3UUM A;  3V5U A;  1H7C A;  1G8X A;  1MMD A;  1S35 A;  4L0R A;  2OA5 A;  3MA9 A;  3N2O A;  2MBG A;  3LK4 2;  3ZEF B;  2VKH A;  4WNK A;  4XAX B;  4PJJ A;  3ZMT B;  3FXD B;  4KBM B;  5F3J A;  2IC9 A;  3LJC A;  4N58 A;  3RH3 A;  3C50 A;  1IZN B;  2VWA A;  3GA8 A;  3M65 A;  4F6R C;  2XTQ A;  3BQL A;  1WR6 A;  1Y64 B;  4GF4 A;  3WI4 A;  3AAI A;  2N2L A;  3AA0 B;  5J1G A;  4HN9 A;  5JDF A;  2V7J A;  1E54 A;  2XG6 A;  5HXH A;  3RC8 A;  3SYB A;  3ETV A;  3CPZ A;  1YW0 A;  4PJN A;  2DLR A;  3SWH A;  3KV9 A;  3ANW A;  1EZ3 A;  3D0T A;  2KXP A;  2NW8 A;  4DVD A;  3N2K E;  2X27 X;  1P4T A;  4GCQ A;  3UFE A;  3PQS A;  4H9O C;  2CE7 A;  4EOZ B;  5FY0 A;  5L2L A;  3C4X A;  1ZHC A;  4P0A A;  5D5D A;  5LCY A;  1BXW A;  4AYM C;  3PQU A;  2HPL A;  3ZJ2 A;  2O4V A;  3R84 B;  3PTR B;  3A2S X;  4QWN B;  3PUG A;  1PRN A;  3OKQ A;  4BA9 A;  2VKJ A;  5LHG B;  2LJL A;  2E9X A;  3ZMS B;  3S4U A;  5JDL A;  2BZB A;  2WMO A;  4IE0 A;  3GMI A;  5TAO A;  3ZCI A;  3J9X 1;  4IE4 A;  3PUS A;  1B7T A;  4UF0 A;  4IE7 A;  4JLE A;  2K9A A;  3CWZ B;  1YKH B;  5FYM A;  2X67 A;  5CB4 E;  4AYI D;  3RX6 A;  2V7M A;  2YU1 A;  2XE5 A;  2CEA A;  4CXX A;  3N2G E;  4FZN A;  3ZN1 B;  2MNH A;  4O4I E;  4AXP A;  3IBP A;  3LK3 B;  3MZK B;  6PRN A;  5L3G B;  3ZLI A;  4A56 A;  4H9P C;  2LSY A;  4QXC B;  2K24 A;  2NOX A;  2DWK A;  3NRX A;  4I50 E;  4AYD C;  5JR9 A;  2DI4 A;  1MIW A;  2Y0K A;  4YJ2 E;  4ZI2 C;  4XBF B;  5DL7 A;  3VE2 A;  5DL8 A;  7PRN A;  1ZKE A;  2Q9Q B;  2ODJ A;  4O2A E;  5LOV E;  4BUM X;  2K0L A;  3LG7 A;  4KRA A;  4KP3 C;  4MHC A;  3EVY A;  4UVC B;  3PRN A;  3PU3 A;  4O4X A;  3DA3 A;  4BJM A;  2Y48 B;  4FZL A;  4TX5 A;  3VU7 H;  4MAL A;  3VKH A;  5BMV E;  3O4X E;  3AVS A;  3LFM A;  4AQF C;  3RYF E;  4GCP A;  4QX7 B;  2MTQ A;  3SY9 A;  2RA1 A;  2XAQ B;  4GCS A;  4XZC A;  3AA0 A;  3ANW B;  3UUX B;  2RP4 A;  4KUM B;  1LVF A;  1HG5 A;  3EUH A;  1GFM A;  2PBI A;  1D0Z A;  4GYR A;  5LYJ E;  2JMM A;  4GOU A;  4TV9 E;  5JH7 E;  1HFA A;  1HTJ F;  5FXX A;  3SS1 A;  2KDY A;  3HKD E;  1AJ3 A;  3VY8 X;  3RC3 A;  2V26 A;  2WBL A;  4GIW A;  2EHO C;  4ASK A;  3RYH E;  1HXX A;  3OJA A;  5JQG E;  2X9H A;  4I55 E;  2BVL A;  4QHO A;  4YHJ A;  5IYU A;  2CA5 A;  1UX5 A;  2W00 A;  1D1C A;  3POX A;  2E9X B;  3C4W A;  4LSE A;  5G26 A;  2J1D G;  1THQ A;  3AA6 A;  2Z6E A;  4IE6 A;  3CKD A;  2PFV A;  3NRY A;  1U4Q A;  3K8P C;  2DWG A;  3O1J A;  1QSD A;  3HA4 A;  4M1P A;  5LBM A;  2ACX A;  2V7I A;  2WMN A;  3P8C D;  3ZYK A;  2G0U A;  2C5K T;  4TN7 B;  4KMC A;  2W62 A;  2ERV A;  1ZHW A;  4XNL A;  4I4T E;  3VE1 A;  3C98 B;  4AYN A;  3E0Z A;  4DBQ A;  1MIY A;  1ZEE A;  3E22 E;  3JC6 D;  2POR A;  3E08 A;  3B13 A;  4AQG A;  2D2S A;  3AA1 B;  2E9X D;  2N1G A;  2Y6X A;  5LA6 E;  1VRB A;  3HKC E;  2C5I T;  3A5X A;  3I0O A;  2IAK A;  4O8S A;  4PW8 A;  5FMN A;  5JDN A;  5JRC B;  4FES A;  4FSP A;  4FUV A;  1G90 A;  2LSK A;  3KVA A;  2XE3 A;  4EXT A;  1ZV4 X;  4JFB A;  2A2F X;  1X79 A;  4LSH A;  2CXF A;  5CA0 E;  3NBX X;  1Q9G A;  1WYC A;  5LHH B;  3BK9 A;  2A3D A;  3ZCJ A;  3QRA A;  3RBH A;  3AAA B;  5JVD E;  2XQY A;  3PE0 A;  4L5G A;  2N9D A;  3CQX C;  3UUL A;  2Q9Q A;  3FBL A;  4TUY E;  3N9N A;  2XAS B;  2QA7 A;  1YKE B;  4BJN A;  2ZM2 A;  5HWY A;  4DMW A;  4AKI A;  2XE2 A;  1D1A A;  2XHE B;  2M67 A;  4EYU A;  2WAU A;  3VKG A;  3FYX A;  2C5J A;  4O3W A;  3LBX A;  4GYS A;  3TKL B;  4FJO A;  2XAJ B;  3CVR A;  2NW9 A;  2VL8 A;  3MJX A;  2HPJ A;  5LGN B;  3SZD A;  2H3R A;  1V9D A;  5JRE A;  1BR4 A;  2JRK A;  4IST A;  2YIN A;  3DA4 A;  3HKB E;  3AAE B;  5HXE A;  1E1H B;  3I0Q A;  3T20 A;  4X1K E;  3PUA A;  4ZI7 E;  4F4B A;  1BT9 A;  3ZMU B;  4H9N C;  4H9S E;  3CX7 B;  5H6R B;  1YS5 A;  3GWH A;  3HOE A;  3IHR A;  4FT6 A;  2KLQ A;  1D0X A;  1T98 A;  3HOL A;  4N78 D;  3ZMZ B;  3B57 A;  2DNX A;  3AA6 B;  2V1D B;  4Z3T A;  2WM9 A;  4ZI3 D;  4QXB B;  3C51 A;  4HTE A;  1D1B A;  1YD8 G;  4NUV A;  5FXW A;  4AKH A;  4AQF A;  3FXE B;  1WLX A;  2CLY C;  2ODU A;  3J7Y q;  2CCQ A;  2Y2X A;  5LJN A;  4AKR B;  3C4Z A;  2A72 A;  4FI5 A;  3BQK A;  1MIV A;  3AA7 A;  8PRN A;  3NZQ A;  3MK7 C;  1S94 A;  3P7I A;  4IHJ E;  3DJB A;  3O9X A;  4PJM A;  1D0Y A;  5LP6 E;  2GE4 A;  2MHL A;  3F31 A;  2ZFG A;  3V8U A;  1GFP A;  3F57 A;  2LFU A;  3N9Q A;  2VKO A;  4EZH A;  3I9W A;  2EHO A;  4CI3 B;  2ZLD A;  4FZM A;  4FRX A;  2J4U P;  2IC6 A;  2KMF A;  3R6N A;  1MPF A;  3AA1 A;  1SA0 E;  1ORM A;  5HXC A;  5JRC A;  3N9M A;  4MFR A;  4KR8 A;  4L9I A;  3O1I A;  4UV8 B;  2UXN B;  4H63 H;  5L3B B;  2WWU A;  1FIO A;  1IJ5 A;  1ZHZ A;  4H63 V;  3SYS A;  4EAH A;  2D5U A;  4O3X B;  4CI1 B;  1QJ8 A;  3BQI A;  4ANJ A;  3PUQ A;  5JDM A;  3HWB A;  1MNE A;  3AAA A;  1WYB A;  3LBX B;  3I1A A;  3F2E A;  5EE2 A;  4DO0 A;  3HW9 A;  3RRW A;  2JQQ A;  2F1V A;  3SY7 A;  1ZHT A;  3UT5 E;  5EK3 A;  3EMN X;  4K0U A;  5JDH A;  2HH7 A;  4AKL A;  2PRN A;  4O3Z A;  5EZY E;  2MOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...