3AA7B

Crystal structure of actin capping protein
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 81
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3aa7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3aa7B02
3AA6B 2KZ7B 5AFUL 3AAAA 3LK2A 3AAEA 3AA6A 3LK42 2KZ7A 3LK3B 3AA0B 3LK3A 5ADXK 3AA1B 1IZNB 3AA7B 3AA0A 3AA1A 1IZNA 4AKRB 3AA7A 3LK41 5AFUK 5ADXL 2KXPB 3AAAB 4AKRA 3LK2B 2KXPA 3AAEB
chains in the Genus database with same CATH superfamily
2ZLDA 4LF7T 3WI4A 2DWKA 2D0UA 3W15B 3VU7H 1T16A 5PRNA 3T20A 2E9XC 3QB5K 4O2AE 2DNXA 2WM9A 2VVSA 2CPTA 3IBPA 2BBJA 3N9QA 5LOVE 2BBHA 5EE2A 4TN7B 3OBVE 2CBIA 2LJLA 2H3RA 3I9WA 1IAPA 5FY7A 3O1JA 4YTNA 2KWIB 4DV2T 2W66A 4U72A 4TNWA 4U74A 4EB6E 4O3WA 3DA4A 4AI6A 2ODJA 1P4TA 5C2TA 1MMNA 5DABA 4AQYT 2PBIA 2C0SA 1HS7A 3QK6A 3RH3A 4EV6A 2V6XA 4CI3B 3NRYA 3UULA 4BUMX 3PV0F 3C5OA 4GOUA 2IC6A 2GE4A 4PAGA 3UU8A 4CXYA 2VKDA 5HXRA 2LLYA 3J7Yq 4JI0T 2FJBA 4TV9E 2BVMA 3A7MA 4PUXA 5HCMA 3IHRA 2XAQB 2UXXB 2JRKA 3EI0A 2KMFA 2YDQA 4KRAA 1MM5A 2UU9T 1MIYA 1CUNA 2N2NA 3PQUA 3TKLB 3L39A 4QKNA 5LGUB 2ZFGA 4FRXA 4KHPT 3UU6A 5FVLA 4HFIA 4AYID 4I0UA 2VL0A 2O4VA 2W67A 3NZQA 3LK3A 2L3LA 2VQFT 3MA9A 4QH1A 3J9X1 2RA1A 3KBTA 2DCFA 5DQVA 1QJ8A 5AQSB 3BQLA 4LF4T 2HPJA 1HG2A 5J2UE 1E7PA 2B1EA 1BR0A 4OX9T 4AISA 5CFBA 3AEBA 5HWXA 3TLSA 5HXEA 2R4PA 2MHLA 2E9XB 1T1LA 1XMQT 4RLCA 4ZHQE 5CGMA 2ES0A 4JFBA 4I55E 3IA3A 3QRAA 1HG5A 5AFUL 2IIUA 3PU8A 1XNRT 1VCTA 4QH4A 4CN1A 4YHJA 1UUSA 3FBZA 2WAUA 2VQET 3AA1B 3P4PA 4QX7B 1Y64B 1XMOT 4EZ4A 1GFQA 3VKGA 5EZYE 2CM0A 4FQEA 4EYYR 1GQEA 2WWUA 4P0AA 4LMKA 4YJ2E 3UT5E 4BA9A 4OYJA 3JAEA 2WZIA 2D5UA 2XPKA 2X9HA 2J1DG 2KNDA 3FHNA 3N2KE 3MKDA 3LJCA 1IJ5A 1KF6A 3NKZA 2K0LA 3CQCB 4P09A 4B61A 5HEJA 5L4EA 3I9YA 2OLTA 1Z0PA 3AAEB 2B76A 2IDOB 5F5WA 5EK2A 3EMNX 2R4NA 5ADXK 5LYJE 2K24A 2R8AA 5DL7A 3Q2MA 4ASKA 4LF8T 3RI5A 4J2CA 4F4BA 4ZI2D 2D0TA 4JI8T 4ANJA 4UB8O 3C4WA 2GK9A 3CK6A 3Q5WA 2BS4A 4EIWA 4H9PC 4F6RC 2YOEA 1JNZA 1E1HB 4CN6A 3M3ZB 5FYMA 4JYAT 2V5DA 2XE3A 3AVSA 1QLBA 3FZMB 4AKGA 3BK9A 2LKGA 4K0UA 4GKKT 1G73A 2ZLYA 2YU2A 5JDMA 2WCAA 3LSVA 4O3ZA 5LG3A 4U2YA 5C3JA 2QYWA 3AAEA 3P4SA 4CI1B 4B3ST 2N9DA 5JDPA 4PJ0O 3KINB 3EVYA 3UQ7A 5L3CB 3H37A 3RYHE 2W80C 3UU2A 2WJRA 1HX1B 3I0OA 2KXPA 4Z91A 2I6HA 4YSXA 2H7OA 3G06A 1D0XA 2W2UA 2V7JA 1YQ4A 4YFSA 5ABGA 3VRBA 2E8IA 1HFAA 4X1IE 1E2AA 2CWOA 3DZMA 1S94A 3P4QA 2KINB 1IZNB 3AEEA 4AQFC 3UQ4A 3SOLA 2CA5A 3BRYA 4AXPA 4EGWA 3S4UA 3C4XA 5AQHB 2V7MA 3BS0A 2K9AA 3HOLA 4LF9T 5LBMA 3ZT5A 2BDEA 1IBKT 5LG4A 2XQ6A 2VASA 2LFUA 4ZI3D 5EK4A 1AJ3A 2X9XA 3GN5B 2FJDA 3P8CD 4P1NA 3LK41 3KV5A 4DR2T 5FXZA 3FZKB 2XAFB 4PK4A 4YHHT 4MBQA 3N9LA 1E54A 3RBHA 3AE1A 3I0QA 4HFVA 2F4VT 1ZOYA 5EK3A 4KP3C 5FVKA 3G7GA 4CN4A 4G2AA 2M07A 5JDGA 3GWHA 4U7YA 1HX8A 2J47A 4WW0A 1YS5A 2FUPA 2R4LA 4PNIA 3NSGA 1J1JA 3O1HA 4M1PA 1IZNA 4H9NC 4O8SA 3LBXB 5HEHA 4CXWA 2PJQA 3A2SX 4GCPA 2BKOA 4FRTA 1D0ZA 4IE7A 4JLEA 2C5KT 5CB4E 4HWHA 4IGUA 3V5UA 2YNKA 4ISTA 5FXWA 1BT9A 3DWOX 2XQ7A 2IAKA 3ONJA 2R89A 3K8PC 2FBWA 5LBQB 2ACXA 4NXMT 4GF4A 3WAJA 3K3NA 1OWAA 4JCHA 3TLUA 2BG9E 3IEEA 3K19A 2BG9B 4UVAB 4FMSA 3VE1A 3AXJB 3AECA 3RQWA 3NZPA 2DLRA 1QJ9A 3KV4A 1KK7A 3PUXF 3FXEB 5D5DA 3RYIE 2XSAA 3UUNA 4YJ3E 4HWCA 2XAJB 4G76A 4TX5A 2CRBA 2A72A 1UX5A 1QUUA 4UV9B 2OMFA 1UK5A 4F8HA 3JCUO 3LBXA 5DJQC 1D1AA 3AA0B 4FZMA 3JAFA 2E5VA 3HWBA 1EZ3A 4XAXB 4EEBA 3WI5A 4N75A 3ZJ2A 1N34T 5LNKA 2LM2A 3L8RA 3ZMTB 4PFOA 2N2MA 4MALA 2MBGA 2WU5A 3VE2A 4TWDA 4XNLA 2BKNA 5FXVA 2WSSV 1FMVA 3F2EA 1BR4A 2XTQA 2XE2A 2NP9A 3ZC1A 3KVBA 1N36T 1KFYA 2BZBA 1LVFA 5B66O 2NW8A 2M6BA 3OJAA 4NXNT 2Y7SA 1YQ3A 4N58A 2BG9A 3ANWB 2UXBT 4EYUA 3AXJA 3SYSA 1FMWA 3PUSA 3QNUA 3VR8A 2M67A 2VURA 4PJNA 1US7B 5GTHO 4IL6O 2OA5A 3AE3A 2WU2A 3OKQA 1Q9GA 2X51A 4G75A 2JQQA 2VKOA 1ZP0A 4JI5T 2QA7A 2M06A 1YD8G 2LHRA 2AXDS 2ZM8A 1V9DA 4JEUB 4YXDA 4E7ZA 3LK3B 2F1CX 3E08A 1G90A 2IUBA 3RKOA 4DO0A 4DR1T 3ZCIA 2YDRA 4RJWA 4UIGA 3AA0A 4DV7T 2W81C 4O4LE 3U78A 2A2FX 4IDOA 1GFNA 3CQGB 1W9RA 4X64T 2WVPA 2HH7A 1QSDA 4YT0A 4AIUA 3CX8B 3UFEA 2J1NA 2NTXA 5AQPB 4JI2T 2XQAA 3QC9A 3UU5A 3Q5DA 4ZS3A 1D1CA 3R84B 2JQHA 5JDHA 4AKMA 3AAAB 2X9WA 3TLTA 3E22E 1YW0A 3RGLA 1ZHZA 4WYVA 2H88A 4L9IA 3ANWA 3BQIA 3Q5XA 2IWVA 2ERVA 2JPFA 4NPPA 2LOPA 4PW8A 3NJTA 4JI6T 4LSHA 2IHR1 3AEAA 3KV6A 2NOXA 4HWIB 1YKEB 2WDVA 4LFCT 2XM2A 5LHGB 4O4UA 4HWFA 5KX5E 4LSFA 2WZHA 4D64A 3ZYKA 4XNKA 1ZHTA 2YDSA 5HXHA 3SYBA 3EUHA 1ORMA 1VRBA 1XZYA 4AKRB 3MJXA 4ZI2C 4QX8B 4YLHA 2VK9A 1ZHCA 3ETUA 3PUWF 4TUYE 2J62A 2V7LA 4QXCB 3TLVA 4YSZA 4BJMA 2CXLA 5AFUK 4O4IE 3WAKA 3AEFA 5GV0A 1WYCA 4QQ1A 2L9QA 3AAIA 2YINA 3AAAA 2N1GA 3PE0A 1KNPA 2F1VA 2MYSA 3ONXA 2J4UP 4IIJE 2WY2A 3RIUA 3ZSTA 5KDMC 4QWNB 5KMGP 5LMUT 4KUMB 1N33T 3PGSA 2W00A 3DA3A 2X67A 2WDQA 3NBXX 4DMVA 3EAMA 1DU2A 2W63A 5J0ZA 2HN2A 2JMHA 4B3RT 2G0UA 2V26A 3AE2A 4GK0E 4PK5A 5M4YA 3RLFF 3AA6A 3MK7C 4GYRA 4HFEA 4AUIA 3NVOA 4PJMA 3RX6A 5AQQB 3D0TA 3MXZA 2XQ4A 5ABEA 4AKRA 4YTPA 3AE5A 3VZUX 3VR9A 4IE4A 4DMWA 2Y0LA 2JJ9A 3HL6A 1BR2A 2H89A 2X27X 2X9YA 3DTOA 1X79A 5H2FO 1WCRA 1ZEEA 3VRAA 4GCQA 1GFMA 2IWWA 5AQKB 2KXPB 4RLBA 5L3GB 4I4TE 1FIOA 4K3CA 2BS3A 4WBNE 4TWFA 5FMNA 1ZKEA 5AQUB 4ZI3C 3U3IA 4MFRA 5HXSA 2LSIA 1Z8UA 3KVDD 1BR1A 3PU3A 3ONLC 1SHZC 1X9BA 4AKIA 2Y2XA 5JR9B 4AYEC 2DWGA 3R6NA 4IE5A 3SY9A 2Q9QD 2FJAA 4I43B 3K1SA 3T1HT 3SZDA 3SFDA 4HFBA 1QJPA 3AA7B 3MZKB 2WQYA 2MNHA 3OYXA 2ZMAA 4YY3T 3CPZA 1W0AA 4ISSA 1LRZA 3IF8B 4UXNB 5LB7B 2Q9QB 5GONE 3M65A 4O3XB 4HFHA 3RYFE 4DV4T 1THQA 3OTOT 4LFBT 4FOZA 1J5WA 1XDPA 2JIWA 5JTGA 2Y48B 4X5TA 2CHOA 2WS3A 2UXCT 2ACZA 4PR7A 3H3MA 2CXFA 2E2AA 4KBMB 4HTEA 1KEYA 1FEWA 2PFVA 3A5XA 4DUYT 1IJ6A 4O4JE 3ZJ1A 5HEOA 2BG9C 1HF8A 3F31A 2NW9A 3CVRA 4X1KE 4ERRA 3GA8A 3T1YT 3FXDB 5L2LA 2QGSA 5JR9A 5G26A 3DJBA 5H6QB 1UURA 3HW9A 2V7IA 3P4RA 2CCQA 4QXHB 2MAWA 2NWBA 3SWHA 2WP9A 5L4HA 3AA7A 1GFPA 1M7KA 4HEAA 1YKHB 3K3OA 5HCJA 3VHLA 4AQGA 4BJNA 5GTIO 4RL9A 1WRDA 3FZHB 4KR4A 3SRZA 3ZN0B 1H7CA 2AE9A 4HKAA 3CQXC 2QTKA 3C4ZA 4FSOA 1Q9FA 4Z90A 4H9QC 4IL4A 2Q9QA 2R4OA 5AQOB 2KWHA 5JQGE 3KZIO 3POQA 4LSIA 4O49A 4B3TT 5AQGB 3N9MA 5JDQA 1GFOA 2OV9A 4H9OC 3PF1A 3RRWA 3AVRA 3POXA 4NIQA 2CEAA 4UR9A 4Z8XA 4KR8A 3RHWA 4HE8A 2P9BA 3I1AA 3UAQA 2X66A 1OXZA 1WR0A 5E0OA 4AYDC 2YEVC 4Q25A 2D2SA 2XE5A 4UELA 4CI2B 2N2LA 3F57A 2YN6A 5FKYA 4Z3TA 1PRNA 5A1LA 4TWHA 3C98B 1S35A 3RC3A 2UUCT 2EHOD 2NTYA 4EZHA 3V5SA 2LEHA 3CKDA 4QXBB 4NUUA 3N2GE 4N59A 3JCFA 1OSMA 4HGAA 5IUXA 2KLQA 4K0KT 2EHOB 5FVNA 1W09A 3E0ZA 4COFA 2X0LB 4B6XA 5LGNB 4IT4A 2XSBA 2KC0A 1BH3A 2X68A 2W4XA 1T8BA 4CZZB 1UCUA 5HAXA 3L09A 1O3XA 2C5IT 2XQ3A 2PTFA 2KT9A 3UU4A 5BMVE 3UUXB 1LVKA 3OVUA 3AE7A 5DL5A 1XWMA 4DR3T 1WR6A 3WU2O 1HNZT 2VVNA 4G63A 2A3DA 2CMRA 3UUMA 1J5ET 5KXJA 3JC6D 2W0GA 2IW5B 4DV1T 3RIUC 2YU1A 3PRNA 3TLWA 1PHOA 3ZMUB 4FZNA 1HNXT 3ZT7A 2IC9A 4HFCA 4IDNA 2I0MA 2WB5A 5FNVE 2C5JA 2L8KA 2EHOA 4CQIA 3Q9DA 4XBFB 5KAIO 1D0YA 4O4XA 4LF6T 4YTMA 4FUVA 2BVLA 3PUZF 4DIDB 1ZV4X 3P4WA 3SY7A 1MMDA 2V5CA 4WNKA 2UUAT 4CTDA 4UVBB 4C69X 3KVAA 1U4QA 5DL6A 3CMLA 3GP6A 2LT3A 2LHNA 2WJQA 1OEDC 1WYBA 4O2BE 2XASB 1LKXA 4KMCA 4V1Av 3KV9A 5E79O 4GHBA 5TAOA 1UGOA 2XY8B 1MM4A 3QOFA 5C8YE 2V6YA 1HNWT 1Y01A 4H63H 3ZC0A 5HYAA 3RRCA 2LM9A 3ZCJA 4E7SA 4H63V 4A56A 2YKSA 1B7TA 1CHUA 3QRCA 5AQFB 3RYCE 3LDQB 2KZ7B 4ZOLE 2XHEB 3SFEA 3VZWX 2E5LT 3CWZB 1MNEA 2WMOA 2D9DA 1WLXA 4DR6T 2LOSA 5HEGA 4JBWF 3DP7A 4C91A 3HR0A 4LF5T 1MMGA 4DV6T 1I94T 2CHNA 1I6ZA 4JV5T 1HXUA 4ZS2A 4IDZA 4DV0T 5L47A 4OYKA 3ZEFB 2JMKA 5LCYA 3JTYA 1VCSA 2V7KA 2DI4A 3KFWX 2DHRA 2LRKA 3HA4A 4JI7T 3ZMSB 3K3QC 2F1TA 4AZLA 5DQWA 3T24A 4EAHA 4U31A 2BS2A 1NENA 2LHFA 2PORA 3VY9X 3AA6B 3RIFA 2FGRA 2ODVA 3ZMZB 4JI3T 3PUGA 3KDSE 3ZYLA 2VKHA 3WI3A 3Q5EA 4OHFA 5AQLB 2H7VC 3PJAJ 3AEDA 3ETVA 2K3WA 5AQMB 3RKGA 4GK5E 2M6IA 2UXDT 2XG6A 5AQNB 2WDRA 3LFMA 3LK2B 5HWYA 2K5BB 3HKEE 5JR9C 2AXTO 2Y6XA 3P7IA 5JREA 5AQRB 2JQ9A 2VB6A 2KZ7A 4PJLA 2ZM2A 5AQTB 5LXTE 4AFKA 4U7IA 5ABFB 2HHHT 3O1IA 3ZYMA 5J1GA 1OEDE 2W61A 5F8PA 1OEDB 4GYSA 1HCIA 2E9XD 2Y0HA 3HKDE 1OPFA 4WBOA 1MNDA 4KI0F 4JI1T 4D65A 3EDUA 2CE7A 2J4GA 3PJAA 3X1DA 2Q9QC 5CA0E 5JDFA 1FJGT 4ILCA 4IDPA 1W0BA 3QB5A 5F3JA 5JRCB 4LMJA 2HPLA 2XM1A 5L3BB 3PDYA 4B3MT 1U5PA 2QRXA 5KAFO 5G3AA 4GCSA 3AE6A 3RQUA 2A9UA 3ZSSA 4JI4T 4LSEA 2ODUA 4U33A 1XDOA 4IHJE 5AQIB 4TNVA 1HTJF 2XQ9A 1HXXA 5TISO 4XZCA 2WWVA 4FZLA 4JEHB 5DL8A 3BRZA 4OFZA 2V1DB 4UF0B 4ILBA 5LGTB 3PUVF 3LK2A 5IYZE 4C90A 3B13A 3FZFB 1BXWA 3HKBE 5LJNA 5ABFA 2MOZA 5BR8T 3ZKRA 5FL1A 3ZT6A 3DWNA 5FY0A 1OEDA 5JDLA 4UB6O 5J2TE 2XUEA 1T7SA 2PG8A 4KHZF 1UX4A 3CIRA 4DUZT 4PJJA 3UUBA 3C51A 4H9RC 3KBUA 2KDYA 4E1SA 2UXNB 3CX7B 3N9OA 4ZEYA 1ZHWA 3EABA 4ZXLA 2JQYA 5JVDE 5JRCA 3V8UA 2LSKA 2E9XA 2LE8A 1MIWA 5ADXL 1YXRA 7PRNA 4AKLA 2XQYA 2CBJA 3AE9A 2W62A 2HN1A 3VKHA 3FYXA 3LK42 5LMNT 5CA1E 4FESA 2RPAA 3O0EA 4UEMA 3PGRA 3AA1A 4H9SE 5IWAT 2LSJA 2LSGA 5HXCA 3B5MA 1N32T 4UF0A 3MACA 3UTKA 6PRNA 4ZI7E 3LG7A 4IE6A 3SS1A 2MPKA 2KSRA 4D5UA 1VOMA 3UU3A 5LA6E 4GKJT 4KX6A 1KNZA 2LSYA 3T0SA 2NR4A 2XAHB 2EHOC 1HR0T 1HXTA 4U3CA 2XTRA 5AQVB 4A5XA 2XTLA 2VL8A 1T72A 4UV8B 3OPCA 3B57A 4FT6A 5FY1A 4LMLA 3VY8X 4MHCA 4TV8E 1ZHXA 1T98A 4U9CA 1MPFA 4DR7T 2WBLA 3ESLA 2Y8DA 4AKHA 4X62T 3HOEA 3VZTX 3PUQA 2DL1A 4U2ZA 1XNQT 4X20E 3AE4A 4EEDA 2LKHA 3A0BO 4X65T 3PTRB 2CLYC 2V8SV 3NWIA 2FJEA 4GIWA 1MMAA 4C00A 3NRXA 5L3FB 5JDNA 1H6S1 1ZHYA 2XJ7A 1D1BA 4ILUA 2NW7A 1SE7A 5LJMA 3JC6C 4ADZA 3OYZA 3PUAA 4CXXA 4YSYA 4PFPA 3T8OA 5H6RB 4DBQA 3UPGA 5G38A 3FBLA 3O9XA 4LFAT 1IBLT 4A98A 3PORA 3HKCE 2WMNA 2Z6EA 2XZEA 5LHHB 4E1TA 4AYNA 2QVAA 4QH5A 4EXTA 4WZXA 3AB3B 4DV5T 1G8XA 3N9NA 4PK6A 2CWYA 4L5GA 4X66T 2MTQA 2XMXA 3ABVA 3N9PA 3A0HO 4N74A 4MLKA 4IDQA 4I50E 4DV3T 2JMMA 3QUJA 3ZPOA 3L3PA 2RP4A 5ETWA 4IREA 5LP6E 1NEKA 3P50A 3C64A 3N5LA 2LRLA 2XQ8A 2SPCA 5IYUA 4DNDA 3A8YC 3O4XE 4HFDA 5L3EB 3ZLIA 4DBRA 4AYMC 3HI2A 4FI5A 2XE1A 3POUA 2Y0KA 2X0HA 5B5EO 4UVCB 4RJXA 4L0RA 1JNRA 4OK0A 2VWAA 3GN5A 4DR4T 1L0VA 4FJOA 3UFGA 4NUVA 4ILAA 2X9KA 3RPUA 8PRNA 2ZM0A 1R8IA 5LHIB 3CX6B 2R6GF 5IHYA 3AE8A 4C4VB 4HN9A 3GMIA 1WFDA 3FB2A 2YK0A 4TZ4C 3ZN1B 2FGQX 1M62A 4FSPA 3RIAA 2JQKA 2R88A 2X0YA 2YPVA 2V6YB 2IMLA 2CLYB 3PURA 4HWDA 4X1YE 1NAFA 4IE0A 4IL9A 5L3DB 3AEGA 4A97A 3BQKA 4BAYB 2K4TA 4DVDA 4DR5T 3ZMVB 3PUYF 3EDVA 2ZM6T 4N78D 3TZGA 5HEUA 5CJ5A 3PQSA 4K3BA 1KNRA 3JADA 4ZZCA 2PRNA 4P0BA 3FZLB 5ABHA 2XQ5A 1SA0E 2VKJA 4O4HE 4EOZB 2XAGB 3H3AA 3SZVA 3C50A 5G39A 1SUMB 4ZZBA 2CXDA 3N2OA 1IBMT 4JUYA 2I59A 3RC8A 5FXXA 5AQJB 3RF1A 4QHOA 1S5LO 2K48A 5FL0A 1MIVA 5FP3A 4O3YA 5JH7E 4C4VA 4AQFA 3EHZA 2UUBT 2BKPA 3PGUA 1NWMX 5T5FA
chains in the Genus database with same CATH topology
4CXWA 4UXNB 2CE7A 2ZLDA 3WI4A 2PJQA 2Q9QC 2DWKA 2Q9QB 5CA0E 3A2SX 2D0UA 5GONE 4GCPA 5JDFA 3M65A 4FRTA 4O3XB 1D0ZA 4IE7A 4JLEA 3RYFE 3W15B 2C5KT 5CB4E 1THQA 3VU7H 5F3JA 5PRNA 5JRCB 3T20A 2HPLA 2E9XC 4IGUA 3V5UA 5L3BB 3PDYA 4O2AE 4FOZA 2DNXA 2WM9A 2YNKA 1U5PA 2Y48B 3IBPA 3N9QA 4ISTA 5FXWA 5LOVE 4GCSA 5EE2A 4TN7B 3OBVE 1BT9A 2LJLA 2H3RA 4LSEA 2ODUA 3I9WA 2IAKA 1IAPA 4IHJE 2CXFA 3K8PC 5FY7A 3O1JA 1HTJF 4KBMB 4HTEA 5LBQB 1FEWA 1HXXA 2KWIB 2ACXA 4GF4A 3WAJA 2PFVA 3A5XA 4XZCA 4U72A 3K3NA 1OWAA 4FZLA 4JEHB 4JCHA 1IJ6A 4O4JE 3ZJ1A 5DL8A 3IEEA 4U74A 4EB6E 3K19A 4OFZA 2V1DB 4UF0B 4UVAB 1HF8A 4O3WA 4FMSA 3F31A 3VE1A 2NW9A 3DA4A 3CVRA 4X1KE 4AI6A 4ERRA 5LGTB 1P4TA 2ODJA 3GA8A 3FXDB 2DLRA 3NZPA 5IYZE 5L2LA 3KV4A 1QJ9A 3LK2A 4C90A 3B13A 1BXWA 1MMNA 5DABA 2PBIA 2QGSA 5JR9A 5G26A 3DJBA 1KK7A 2C0SA 3FXEB 3HKBE 1HS7A 5LJNA 5D5DA 3RYIE 5H6QB 3QK6A 2MOZA 3UUNA 3HW9A 4YJ3E 2V7IA 3RH3A 4CI3B 3NRYA 2CCQA 4QXHB 3UULA 2NWBA 2XAJB 5FY0A 3SWHA 5JDLA 4G76A 4TX5A 3AA7A 1GFPA 5J2TE 4BUMX 2A72A 2XUEA 4HEAA 3C5OA 1YKHB 3K3OA 4GOUA 2IC6A 3VHLA 1UX5A 2PG8A 4AQGA 4BJNA 4PAGA 1QUUA 4UV9B 2GE4A 2OMFA 4RL9A 1WRDA 4KR4A 4CXYA 3SRZA 3ZN0B 1H7CA 2VKDA 1UX4A 4HKAA 5HXRA 4PJJA 3LBXA 3J7Yq 3CQXC 3C51A 4H9RC 3C4ZA 2QTKA 5DJQC 3KBUA 1Q9FA 2KDYA 4FSOA 4TV9E 2BVMA 4H9QC 1D1AA 2Q9QA 4E1SA 3AA0B 2UXNB 4FZMA 4PUXA 2KWHA 3IHRA 5JQGE 2XAQB 2UXXB 3HWBA 1EZ3A 4XAXB 3CX7B 3N9OA 1ZHWA 2JRKA 3POQA 2KMFA 3V8UA 5JVDE 5JRCA 4KRAA 4LSIA 3ZJ2A 4O49A 3WI5A 1MM5A 2LSKA 3N9MA 2E9XA 2LE8A 5LNKA 1MIWA 5ADXL 1MIYA 5JDQA 7PRNA 1CUNA 2N2NA 3ZMTB 4PFOA 4AKLA 2XQYA 1GFOA 4H9OC 2N2MA 3PQUA 3TKLB 4MALA 2W62A 2MBGA 3RRWA 3AVRA 4QKNA 5LGUB 2ZFGA 3POXA 3VKHA 4FRXA 2CEAA 3VE2A 4Z8XA 4KR8A 3FYXA 3LK42 4HE8A 4XNLA 4AYID 2P9BA 3I1AA 5FXVA 2O4VA 3NZQA 5CA1E 4FESA 3LK3A 2L3LA 3UAQA 2WSSV 2X66A 3MA9A 3J9X1 1OXZA 5E0OA 4AYDC 1FMVA 2RA1A 2YEVC 3F2EA 2D2SA 1BR4A 2XE5A 2XTQA 3KBTA 4UEMA 4UELA 2XE2A 3AA1A 3O0EA 2DCFA 2NP9A 5DQVA 4H9SE 4CI2B 3ZC1A 3KVBA 2N2LA 2BZBA 1LVFA 3F57A 2LSJA 2LSGA 1QJ8A 2NW8A 3BQLA 3OJAA 2Y7SA 2HPJA 4Z3TA 1PRNA 1HG2A 5HXCA 5A1LA 5J2UE 4N58A 3ANWB 4UF0A 2B1EA 4EYUA 3C98B 1BR0A 1S35A 3MACA 3UTKA 3SYSA 1FMWA 3RC3A 6PRNA 3PUSA 2EHOD 2NTYA 2M67A 5HWXA 4PJNA 4EZHA 4ZI7E 3LG7A 1US7B 3V5SA 2LEHA 4IE6A 5HXEA 2OA5A 3CKDA 3SS1A 3OKQA 1Q9GA 2MHLA 2X51A 4QXBB 4NUUA 4D5UA 2E9XB 3N2GE 4G75A 4N59A 2JQQA 1VOMA 2VKOA 4RLCA 1OSMA 4HGAA 5LA6E 2QA7A 2M06A 4ZHQE 2ES0A 4JFBA 4I55E 2KLQA 3QRAA 1KNZA 2LSYA 3T0SA 1HG5A 1YD8G 2LHRA 2ZM8A 5AFUL 1V9DA 2EHOC 2XAHB 2EHOB 1HXTA 2XTRA 4JEUB 5FVNA 3PU8A 4E7ZA 3LK3B 1G90A 3E08A 3E0ZA 4YHJA 3RKOA 3FBZA 2WAUA 2XTLA 2VL8A 4DO0A 3ZCIA 3AA1B 3LBXB 2X0LB 4B6XA 4UIGA 4RJWA 5LGNB 3AA0A 4UV8B 4QX7B 2W81C 4O4LE 2KC0A 1Y64B 3U78A 1BH3A 2A2FX 2X68A 4CZZB 1UCUA 3B57A 5HAXA 4EZ4A 1GFQA 3VKGA 3L09A 5EZYE 1O3XA 3CQGB 1GFNA 2C5IT 2CM0A 2KT9A 4EYYR 4FT6A 2WWUA 5FY1A 4P0AA 4YJ2E 2HH7A 3UT5E 4BA9A 4OYJA 3VY8X 1QSDA 5BMVE 4MHCA 4TV8E 1ZHXA 1T98A 4U9CA 1MPFA 2D5UA 2WBLA 3CX8B 3UFEA 2X9HA 2J1NA 2NTXA 2J1DG 1LVKA 3ESLA 3UUXB 2Y8DA 4AKHA 2KNDA 5DL5A 3FHNA 3N2KE 3MKDA 3HOEA 3LJCA 3QC9A 1IJ5A 3VZTX 1WR6A 2K0LA 3CQCB 3PUQA 4ZS3A 1D1CA 3R84B 4G63A 2A3DA 2CMRA 4P09A 3UUMA 4B61A 5JDHA 4AKMA 3I9YA 3JC6D 3AAAB 2X9WA 4X20E 2W0GA 3AAEB 1Z0PA 3E22E 1YW0A 2IW5B 5EK2A 3PTRB 3EMNX 1ZHZA 4L9IA 2YU1A 2CLYC 3ANWA 3BQIA 3Q5XA 2ERVA 4GIWA 1MMAA 2JPFA 3NRXA 5L3FB 2LOPA 5JDNA 4PW8A 3PRNA 5ADXK 5LYJE 1PHOA 1H6S1 1ZHYA 4LSHA 2K24A 1D1BA 4ILUA 3KV6A 3ZMUB 2NOXA 2NW7A 5LJMA 4FZNA 3Q2MA 5DL7A 1YKEB 3JC6C 4ADZA 3OYZA 3PUAA 5LHGB 2IC9A 4CXXA 4O4UA 5KX5E 4PFPA 4ASKA 3T8OA 4LSFA 4J2CA 5FNVE 2C5JA 5H6RB 4F4BA 2L8KA 4DBQA 2D0TA 4ZI2D 4D64A 4ANJA 3UPGA 3FBLA 3O9XA 3ZYKA 4XNKA 1ZHTA 5HXHA 2EHOA 3SYBA 3EUHA 4CQIA 3C4WA 3HKCE 2GK9A 2WMNA 2Z6EA 3Q9DA 1ORMA 3PORA 4XBFB 1VRBA 5LHHB 1D0YA 4E1TA 3Q5WA 4O4XA 4AYNA 4EIWA 4EXTA 4H9PC 4F6RC 3AB3B 4AKRB 4FUVA 2BVLA 1G8XA 3N9NA 4PK6A 1E1HB 1ZV4X 5FYMA 3MJXA 4ZI2C 4QX8B 2CWYA 3SY7A 4L5GA 1MMDA 4WNKA 2VK9A 4YLHA 2MTQA 2XE3A 3AVSA 4UVBB 1ZHCA 2XMXA 3N9PA 4C69X 3ETUA 3KVAA 4AKGA 3BK9A 4MLKA 1U4QA 5DL6A 4I50E 4TUYE 2V7LA 3CMLA 2LT3A 2JMMA 3GP6A 2LHNA 4K0UA 3QUJA 3ZPOA 3L3PA 4QXCB 2RP4A 1WYBA 4BJMA 1G73A 2ZLYA 2CXLA 5AFUK 5ETWA 2YU2A 4O2BE 4O4IE 3WAKA 2XASB 5JDMA 5LP6E 1LKXA 4KMCA 3C64A 4V1Av 3N5LA 3KV9A 5GV0A 1WYCA 4QQ1A 4O3ZA 2L9QA 3AAIA 2YINA 3AAAA 2N1GA 2SPCA 3PE0A 4GHBA 5IYUA 5TAOA 4DNDA 3AAEA 3O4XE 2MYSA 3ONXA 5L3EB 2F1VA 3ZLIA 2J4UP 4CI1B 4IIJE 1MM4A 2N9DA 4DBRA 5C8YE 4AYMC 5JDPA 3HI2A 4FI5A 5KDMC 2XE1A 3POUA 4QWNB 3KINB 5KMGP 4H63H 2Y0KA 4UVCB 3EVYA 4RJXA 4L0RA 4KUMB 3ZC0A 5HYAA 3RRCA 2LM9A 2W00A 5L3CB 3DA3A 3H37A 2X67A 3RYHE 2W80C 3NBXX 3ZCJA 3UU2A 4DMVA 4E7SA 4OK0A 2VWAA 3GN5A 2W63A 2JMHA 4FJOA 4H63V 4A56A 1B7TA 4NUVA 2G0UA 3I0OA 2KXPA 3QRCA 3RPUA 8PRNA 3RYCE 2KZ7B 2V26A 4ZOLE 2H7OA 4GK0E 1D0XA 2ZM0A 2XHEB 4PK5A 2V7JA 4YFSA 5M4YA 3AA6A 3VZWX 3MK7C 4GYRA 2E8IA 1HFAA 1MNEA 2WMOA 3CWZB 4X1IE 4PJMA 5LHIB 4AUIA 1WLXA 2CWOA 3CX6B 3RX6A 1S94A 2LOSA 2KINB 5IHYA 1IZNB 4HN9A 4AQFC 3GMIA 3D0TA 3DP7A 3MXZA 3SOLA 2CA5A 3FB2A 4C91A 4AXPA 3HR0A 3S4UA 2YK0A 4TZ4C 3ZN1B 1MMGA 3C4XA 2FGQX 2V7MA 4AKRA 1HXUA 3VZUX 4ZS2A 4IDZA 4FSPA 2K9AA 4OYKA 3ZEFB 3HOLA 4IE4A 4DMWA 2YPVA 2JMKA 5LCYA 5LBMA 2CLYB 2Y0LA 3PURA 2BDEA 3JTYA 2JJ9A 3HL6A 1BR2A 4X1YE 5LG4A 2VASA 2X27X 2X9YA 2V7KA 2DI4A 3KFWX 3DTOA 2DHRA 2LFUA 4ZI3D 1X79A 3HA4A 5EK4A 1AJ3A 3ZMSB 1NAFA 3K3QC 4IE0A 2X9XA 3GN5B 2F1TA 1ZEEA 4AZLA 4GCQA 3P8CD 5L3DB 1GFMA 3KV5A 3LK41 5DQWA 2KXPB 5FXZA 3T24A 3BQKA 4RLBA 4BAYB 4EAHA 2K4TA 4DVDA 5L3GB 4I4TE 3ZMVB 2LHFA 3EDVA 2XAFB 1FIOA 4PK4A 2PORA 3VY9X 3AA6B 4N78D 4MBQA 3TZGA 3N9LA 1E54A 4WBNE 2ODVA 2FGRA 5FMNA 3RBHA 1ZKEA 3ZMZB 3PQSA 3PUGA 3KDSE 3ZYLA 3I0QA 4ZI3C 3U3IA 4MFRA 2VKHA 5HXSA 4HFVA 3WI3A 2LSIA 4OHFA 2H7VC 2PRNA 4P0BA 5EK3A 3ETVA 4KP3C 3G7GA 3KVDD 1SA0E 1BR1A 2VKJA 4GK5E 4O4HE 4EOZB 2XG6A 3PU3A 2XAGB 3LFMA 1SHZC 3H3AA 3LK2B 4G2AA 3SZVA 5HWYA 2K5BB 3HKEE 3C50A 4AKIA 2Y2XA 2CXDA 5JR9C 5JR9B 2Y6XA 3P7IA 5JREA 3N2OA 4AYEC 2M07A 5JDGA 2DWGA 2VB6A 3GWHA 4JUYA 4IE5A 2ZM2A 4PJLA 3R6NA 2I59A 1HX8A 5LXTE 2KZ7A 3SY9A 4AFKA 4WW0A 2Q9QD 3O1IA 3ZYMA 5J1GA 4I43B 5FXXA 3RC8A 2W61A 5F8PA 1YS5A 3SZDA 4QHOA 1QJPA 3AA7B 3MZKB 4PNIA 4GYSA 2MNHA 2K48A 3NSGA 3O1HA 1MIVA 4M1PA 1HCIA 5FP3A 4O3YA 5JH7E 2E9XD 1IZNA 3OYXA 2Y0HA 2ZMAA 4H9NC 4AQFA 3CPZA 3HKDE 4WBOA 1MNDA 1OPFA 4ISSA 1NWMX 5T5FA 4D65A 1LRZA 3IF8B 4O8SA 3EDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA6 B;  2KZ7 B;  5AFU L;  3AAA A;  3LK2 A;  3AAE A;  3AA6 A;  3LK4 2;  2KZ7 A;  3LK3 B;  3AA0 B;  3LK3 A;  5ADX K;  3AA1 B;  1IZN B;  3AA7 B;  3AA0 A;  3AA1 A;  1IZN A;  4AKR B;  3AA7 A;  3LK4 1;  5AFU K;  5ADX L;  2KXP B;  3AAA B;  4AKR A;  3LK2 B;  2KXP A;  3AAE B; 
#chains in the Genus database with same CATH topology
 2ZLD A;  4LF7 T;  3WI4 A;  2DWK A;  2D0U A;  3W15 B;  3VU7 H;  1T16 A;  5PRN A;  3T20 A;  2E9X C;  3QB5 K;  4O2A E;  2DNX A;  2WM9 A;  2VVS A;  2CPT A;  3IBP A;  2BBJ A;  3N9Q A;  5LOV E;  2BBH A;  5EE2 A;  4TN7 B;  3OBV E;  2CBI A;  2LJL A;  2H3R A;  3I9W A;  1IAP A;  5FY7 A;  3O1J A;  4YTN A;  2KWI B;  4DV2 T;  2W66 A;  4U72 A;  4TNW A;  4U74 A;  4EB6 E;  4O3W A;  3DA4 A;  4AI6 A;  2ODJ A;  1P4T A;  5C2T A;  1MMN A;  5DAB A;  4AQY T;  2PBI A;  2C0S A;  1HS7 A;  3QK6 A;  3RH3 A;  4EV6 A;  2V6X A;  4CI3 B;  3NRY A;  3UUL A;  4BUM X;  3PV0 F;  3C5O A;  4GOU A;  2IC6 A;  2GE4 A;  4PAG A;  3UU8 A;  4CXY A;  2VKD A;  5HXR A;  2LLY A;  3J7Y q;  4JI0 T;  2FJB A;  4TV9 E;  2BVM A;  3A7M A;  4PUX A;  5HCM A;  3IHR A;  2XAQ B;  2UXX B;  2JRK A;  3EI0 A;  2KMF A;  2YDQ A;  4KRA A;  1MM5 A;  2UU9 T;  1MIY A;  1CUN A;  2N2N A;  3PQU A;  3TKL B;  3L39 A;  4QKN A;  5LGU B;  2ZFG A;  4FRX A;  4KHP T;  3UU6 A;  5FVL A;  4HFI A;  4AYI D;  4I0U A;  2VL0 A;  2O4V A;  2W67 A;  3NZQ A;  3LK3 A;  2L3L A;  2VQF T;  3MA9 A;  4QH1 A;  3J9X 1;  2RA1 A;  3KBT A;  2DCF A;  5DQV A;  1QJ8 A;  5AQS B;  3BQL A;  4LF4 T;  2HPJ A;  1HG2 A;  5J2U E;  1E7P A;  2B1E A;  1BR0 A;  4OX9 T;  4AIS A;  5CFB A;  3AEB A;  5HWX A;  3TLS A;  5HXE A;  2R4P A;  2MHL A;  2E9X B;  1T1L A;  1XMQ T;  4RLC A;  4ZHQ E;  5CGM A;  2ES0 A;  4JFB A;  4I55 E;  3IA3 A;  3QRA A;  1HG5 A;  5AFU L;  2IIU A;  3PU8 A;  1XNR T;  1VCT A;  4QH4 A;  4CN1 A;  4YHJ A;  1UUS A;  3FBZ A;  2WAU A;  2VQE T;  3AA1 B;  3P4P A;  4QX7 B;  1Y64 B;  1XMO T;  4EZ4 A;  1GFQ A;  3VKG A;  5EZY E;  2CM0 A;  4FQE A;  4EYY R;  1GQE A;  2WWU A;  4P0A A;  4LMK A;  4YJ2 E;  3UT5 E;  4BA9 A;  4OYJ A;  3JAE A;  2WZI A;  2D5U A;  2XPK A;  2X9H A;  2J1D G;  2KND A;  3FHN A;  3N2K E;  3MKD A;  3LJC A;  1IJ5 A;  1KF6 A;  3NKZ A;  2K0L A;  3CQC B;  4P09 A;  4B61 A;  5HEJ A;  5L4E A;  3I9Y A;  2OLT A;  1Z0P A;  3AAE B;  2B76 A;  2IDO B;  5F5W A;  5EK2 A;  3EMN X;  2R4N A;  5ADX K;  5LYJ E;  2K24 A;  2R8A A;  5DL7 A;  3Q2M A;  4ASK A;  4LF8 T;  3RI5 A;  4J2C A;  4F4B A;  4ZI2 D;  2D0T A;  4JI8 T;  4ANJ A;  4UB8 O;  3C4W A;  2GK9 A;  3CK6 A;  3Q5W A;  2BS4 A;  4EIW A;  4H9P C;  4F6R C;  2YOE A;  1JNZ A;  1E1H B;  4CN6 A;  3M3Z B;  5FYM A;  4JYA T;  2V5D A;  2XE3 A;  3AVS A;  1QLB A;  3FZM B;  4AKG A;  3BK9 A;  2LKG A;  4K0U A;  4GKK T;  1G73 A;  2ZLY A;  2YU2 A;  5JDM A;  2WCA A;  3LSV A;  4O3Z A;  5LG3 A;  4U2Y A;  5C3J A;  2QYW A;  3AAE A;  3P4S A;  4CI1 B;  4B3S T;  2N9D A;  5JDP A;  4PJ0 O;  3KIN B;  3EVY A;  3UQ7 A;  5L3C B;  3H37 A;  3RYH E;  2W80 C;  3UU2 A;  2WJR A;  1HX1 B;  3I0O A;  2KXP A;  4Z91 A;  2I6H A;  4YSX A;  2H7O A;  3G06 A;  1D0X A;  2W2U A;  2V7J A;  1YQ4 A;  4YFS A;  5ABG A;  3VRB A;  2E8I A;  1HFA A;  4X1I E;  1E2A A;  2CWO A;  3DZM A;  1S94 A;  3P4Q A;  2KIN B;  1IZN B;  3AEE A;  4AQF C;  3UQ4 A;  3SOL A;  2CA5 A;  3BRY A;  4AXP A;  4EGW A;  3S4U A;  3C4X A;  5AQH B;  2V7M A;  3BS0 A;  2K9A A;  3HOL A;  4LF9 T;  5LBM A;  3ZT5 A;  2BDE A;  1IBK T;  5LG4 A;  2XQ6 A;  2VAS A;  2LFU A;  4ZI3 D;  5EK4 A;  1AJ3 A;  2X9X A;  3GN5 B;  2FJD A;  3P8C D;  4P1N A;  3LK4 1;  3KV5 A;  4DR2 T;  5FXZ A;  3FZK B;  2XAF B;  4PK4 A;  4YHH T;  4MBQ A;  3N9L A;  1E54 A;  3RBH A;  3AE1 A;  3I0Q A;  4HFV A;  2F4V T;  1ZOY A;  5EK3 A;  4KP3 C;  5FVK A;  3G7G A;  4CN4 A;  4G2A A;  2M07 A;  5JDG A;  3GWH A;  4U7Y A;  1HX8 A;  2J47 A;  4WW0 A;  1YS5 A;  2FUP A;  2R4L A;  4PNI A;  3NSG A;  1J1J A;  3O1H A;  4M1P A;  1IZN A;  4H9N C;  4O8S A;  3LBX B;  5HEH A;  4CXW A;  2PJQ A;  3A2S X;  4GCP A;  2BKO A;  4FRT A;  1D0Z A;  4IE7 A;  4JLE A;  2C5K T;  5CB4 E;  4HWH A;  4IGU A;  3V5U A;  2YNK A;  4IST A;  5FXW A;  1BT9 A;  3DWO X;  2XQ7 A;  2IAK A;  3ONJ A;  2R89 A;  3K8P C;  2FBW A;  5LBQ B;  2ACX A;  4NXM T;  4GF4 A;  3WAJ A;  3K3N A;  1OWA A;  4JCH A;  3TLU A;  2BG9 E;  3IEE A;  3K19 A;  2BG9 B;  4UVA B;  4FMS A;  3VE1 A;  3AXJ B;  3AEC A;  3RQW A;  3NZP A;  2DLR A;  1QJ9 A;  3KV4 A;  1KK7 A;  3PUX F;  3FXE B;  5D5D A;  3RYI E;  2XSA A;  3UUN A;  4YJ3 E;  4HWC A;  2XAJ B;  4G76 A;  4TX5 A;  2CRB A;  2A72 A;  1UX5 A;  1QUU A;  4UV9 B;  2OMF A;  1UK5 A;  4F8H A;  3JCU O;  3LBX A;  5DJQ C;  1D1A A;  3AA0 B;  4FZM A;  3JAF A;  2E5V A;  3HWB A;  1EZ3 A;  4XAX B;  4EEB A;  3WI5 A;  4N75 A;  3ZJ2 A;  1N34 T;  5LNK A;  2LM2 A;  3L8R A;  3ZMT B;  4PFO A;  2N2M A;  4MAL A;  2MBG A;  2WU5 A;  3VE2 A;  4TWD A;  4XNL A;  2BKN A;  5FXV A;  2WSS V;  1FMV A;  3F2E A;  1BR4 A;  2XTQ A;  2XE2 A;  2NP9 A;  3ZC1 A;  3KVB A;  1N36 T;  1KFY A;  2BZB A;  1LVF A;  5B66 O;  2NW8 A;  2M6B A;  3OJA A;  4NXN T;  2Y7S A;  1YQ3 A;  4N58 A;  2BG9 A;  3ANW B;  2UXB T;  4EYU A;  3AXJ A;  3SYS A;  1FMW A;  3PUS A;  3QNU A;  3VR8 A;  2M67 A;  2VUR A;  4PJN A;  1US7 B;  5GTH O;  4IL6 O;  2OA5 A;  3AE3 A;  2WU2 A;  3OKQ A;  1Q9G A;  2X51 A;  4G75 A;  2JQQ A;  2VKO A;  1ZP0 A;  4JI5 T;  2QA7 A;  2M06 A;  1YD8 G;  2LHR A;  2AXD S;  2ZM8 A;  1V9D A;  4JEU B;  4YXD A;  4E7Z A;  3LK3 B;  2F1C X;  3E08 A;  1G90 A;  2IUB A;  3RKO A;  4DO0 A;  4DR1 T;  3ZCI A;  2YDR A;  4RJW A;  4UIG A;  3AA0 A;  4DV7 T;  2W81 C;  4O4L E;  3U78 A;  2A2F X;  4IDO A;  1GFN A;  3CQG B;  1W9R A;  4X64 T;  2WVP A;  2HH7 A;  1QSD A;  4YT0 A;  4AIU A;  3CX8 B;  3UFE A;  2J1N A;  2NTX A;  5AQP B;  4JI2 T;  2XQA A;  3QC9 A;  3UU5 A;  3Q5D A;  4ZS3 A;  1D1C A;  3R84 B;  2JQH A;  5JDH A;  4AKM A;  3AAA B;  2X9W A;  3TLT A;  3E22 E;  1YW0 A;  3RGL A;  1ZHZ A;  4WYV A;  2H88 A;  4L9I A;  3ANW A;  3BQI A;  3Q5X A;  2IWV A;  2ERV A;  2JPF A;  4NPP A;  2LOP A;  4PW8 A;  3NJT A;  4JI6 T;  4LSH A;  2IHR 1;  3AEA A;  3KV6 A;  2NOX A;  4HWI B;  1YKE B;  2WDV A;  4LFC T;  2XM2 A;  5LHG B;  4O4U A;  4HWF A;  5KX5 E;  4LSF A;  2WZH A;  4D64 A;  3ZYK A;  4XNK A;  1ZHT A;  2YDS A;  5HXH A;  3SYB A;  3EUH A;  1ORM A;  1VRB A;  1XZY A;  4AKR B;  3MJX A;  4ZI2 C;  4QX8 B;  4YLH A;  2VK9 A;  1ZHC A;  3ETU A;  3PUW F;  4TUY E;  2J62 A;  2V7L A;  4QXC B;  3TLV A;  4YSZ A;  4BJM A;  2CXL A;  5AFU K;  4O4I E;  3WAK A;  3AEF A;  5GV0 A;  1WYC A;  4QQ1 A;  2L9Q A;  3AAI A;  2YIN A;  3AAA A;  2N1G A;  3PE0 A;  1KNP A;  2F1V A;  2MYS A;  3ONX A;  2J4U P;  4IIJ E;  2WY2 A;  3RIU A;  3ZST A;  5KDM C;  4QWN B;  5KMG P;  5LMU T;  4KUM B;  1N33 T;  3PGS A;  2W00 A;  3DA3 A;  2X67 A;  2WDQ A;  3NBX X;  4DMV A;  3EAM A;  1DU2 A;  2W63 A;  5J0Z A;  2HN2 A;  2JMH A;  4B3R T;  2G0U A;  2V26 A;  3AE2 A;  4GK0 E;  4PK5 A;  5M4Y A;  3RLF F;  3AA6 A;  3MK7 C;  4GYR A;  4HFE A;  4AUI A;  3NVO A;  4PJM A;  3RX6 A;  5AQQ B;  3D0T A;  3MXZ A;  2XQ4 A;  5ABE A;  4AKR A;  4YTP A;  3AE5 A;  3VZU X;  3VR9 A;  4IE4 A;  4DMW A;  2Y0L A;  2JJ9 A;  3HL6 A;  1BR2 A;  2H89 A;  2X27 X;  2X9Y A;  3DTO A;  1X79 A;  5H2F O;  1WCR A;  1ZEE A;  3VRA A;  4GCQ A;  1GFM A;  2IWW A;  5AQK B;  2KXP B;  4RLB A;  5L3G B;  4I4T E;  1FIO A;  4K3C A;  2BS3 A;  4WBN E;  4TWF A;  5FMN A;  1ZKE A;  5AQU B;  4ZI3 C;  3U3I A;  4MFR A;  5HXS A;  2LSI A;  1Z8U A;  3KVD D;  1BR1 A;  3PU3 A;  3ONL C;  1SHZ C;  1X9B A;  4AKI A;  2Y2X A;  5JR9 B;  4AYE C;  2DWG A;  3R6N A;  4IE5 A;  3SY9 A;  2Q9Q D;  2FJA A;  4I43 B;  3K1S A;  3T1H T;  3SZD A;  3SFD A;  4HFB A;  1QJP A;  3AA7 B;  3MZK B;  2WQY A;  2MNH A;  3OYX A;  2ZMA A;  4YY3 T;  3CPZ A;  1W0A A;  4ISS A;  1LRZ A;  3IF8 B;  4UXN B;  5LB7 B;  2Q9Q B;  5GON E;  3M65 A;  4O3X B;  4HFH A;  3RYF E;  4DV4 T;  1THQ A;  3OTO T;  4LFB T;  4FOZ A;  1J5W A;  1XDP A;  2JIW A;  5JTG A;  2Y48 B;  4X5T A;  2CHO A;  2WS3 A;  2UXC T;  2ACZ A;  4PR7 A;  3H3M A;  2CXF A;  2E2A A;  4KBM B;  4HTE A;  1KEY A;  1FEW A;  2PFV A;  3A5X A;  4DUY T;  1IJ6 A;  4O4J E;  3ZJ1 A;  5HEO A;  2BG9 C;  1HF8 A;  3F31 A;  2NW9 A;  3CVR A;  4X1K E;  4ERR A;  3GA8 A;  3T1Y T;  3FXD B;  5L2L A;  2QGS A;  5JR9 A;  5G26 A;  3DJB A;  5H6Q B;  1UUR A;  3HW9 A;  2V7I A;  3P4R A;  2CCQ A;  4QXH B;  2MAW A;  2NWB A;  3SWH A;  2WP9 A;  5L4H A;  3AA7 A;  1GFP A;  1M7K A;  4HEA A;  1YKH B;  3K3O A;  5HCJ A;  3VHL A;  4AQG A;  4BJN A;  5GTI O;  4RL9 A;  1WRD A;  3FZH B;  4KR4 A;  3SRZ A;  3ZN0 B;  1H7C A;  2AE9 A;  4HKA A;  3CQX C;  2QTK A;  3C4Z A;  4FSO A;  1Q9F A;  4Z90 A;  4H9Q C;  4IL4 A;  2Q9Q A;  2R4O A;  5AQO B;  2KWH A;  5JQG E;  3KZI O;  3POQ A;  4LSI A;  4O49 A;  4B3T T;  5AQG B;  3N9M A;  5JDQ A;  1GFO A;  2OV9 A;  4H9O C;  3PF1 A;  3RRW A;  3AVR A;  3POX A;  4NIQ A;  2CEA A;  4UR9 A;  4Z8X A;  4KR8 A;  3RHW A;  4HE8 A;  2P9B A;  3I1A A;  3UAQ A;  2X66 A;  1OXZ A;  1WR0 A;  5E0O A;  4AYD C;  2YEV C;  4Q25 A;  2D2S A;  2XE5 A;  4UEL A;  4CI2 B;  2N2L A;  3F57 A;  2YN6 A;  5FKY A;  4Z3T A;  1PRN A;  5A1L A;  4TWH A;  3C98 B;  1S35 A;  3RC3 A;  2UUC T;  2EHO D;  2NTY A;  4EZH A;  3V5S A;  2LEH A;  3CKD A;  4QXB B;  4NUU A;  3N2G E;  4N59 A;  3JCF A;  1OSM A;  4HGA A;  5IUX A;  2KLQ A;  4K0K T;  2EHO B;  5FVN A;  1W09 A;  3E0Z A;  4COF A;  2X0L B;  4B6X A;  5LGN B;  4IT4 A;  2XSB A;  2KC0 A;  1BH3 A;  2X68 A;  2W4X A;  1T8B A;  4CZZ B;  1UCU A;  5HAX A;  3L09 A;  1O3X A;  2C5I T;  2XQ3 A;  2PTF A;  2KT9 A;  3UU4 A;  5BMV E;  3UUX B;  1LVK A;  3OVU A;  3AE7 A;  5DL5 A;  1XWM A;  4DR3 T;  1WR6 A;  3WU2 O;  1HNZ T;  2VVN A;  4G63 A;  2A3D A;  2CMR A;  3UUM A;  1J5E T;  5KXJ A;  3JC6 D;  2W0G A;  2IW5 B;  4DV1 T;  3RIU C;  2YU1 A;  3PRN A;  3TLW A;  1PHO A;  3ZMU B;  4FZN A;  1HNX T;  3ZT7 A;  2IC9 A;  4HFC A;  4IDN A;  2I0M A;  2WB5 A;  5FNV E;  2C5J A;  2L8K A;  2EHO A;  4CQI A;  3Q9D A;  4XBF B;  5KAI O;  1D0Y A;  4O4X A;  4LF6 T;  4YTM A;  4FUV A;  2BVL A;  3PUZ F;  4DID B;  1ZV4 X;  3P4W A;  3SY7 A;  1MMD A;  2V5C A;  4WNK A;  2UUA T;  4CTD A;  4UVB B;  4C69 X;  3KVA A;  1U4Q A;  5DL6 A;  3CML A;  3GP6 A;  2LT3 A;  2LHN A;  2WJQ A;  1OED C;  1WYB A;  4O2B E;  2XAS B;  1LKX A;  4KMC A;  4V1A v;  3KV9 A;  5E79 O;  4GHB A;  5TAO A;  1UGO A;  2XY8 B;  1MM4 A;  3QOF A;  5C8Y E;  2V6Y A;  1HNW T;  1Y01 A;  4H63 H;  3ZC0 A;  5HYA A;  3RRC A;  2LM9 A;  3ZCJ A;  4E7S A;  4H63 V;  4A56 A;  2YKS A;  1B7T A;  1CHU A;  3QRC A;  5AQF B;  3RYC E;  3LDQ B;  2KZ7 B;  4ZOL E;  2XHE B;  3SFE A;  3VZW X;  2E5L T;  3CWZ B;  1MNE A;  2WMO A;  2D9D A;  1WLX A;  4DR6 T;  2LOS A;  5HEG A;  4JBW F;  3DP7 A;  4C91 A;  3HR0 A;  4LF5 T;  1MMG A;  4DV6 T;  1I94 T;  2CHN A;  1I6Z A;  4JV5 T;  1HXU A;  4ZS2 A;  4IDZ A;  4DV0 T;  5L47 A;  4OYK A;  3ZEF B;  2JMK A;  5LCY A;  3JTY A;  1VCS A;  2V7K A;  2DI4 A;  3KFW X;  2DHR A;  2LRK A;  3HA4 A;  4JI7 T;  3ZMS B;  3K3Q C;  2F1T A;  4AZL A;  5DQW A;  3T24 A;  4EAH A;  4U31 A;  2BS2 A;  1NEN A;  2LHF A;  2POR A;  3VY9 X;  3AA6 B;  3RIF A;  2FGR A;  2ODV A;  3ZMZ B;  4JI3 T;  3PUG A;  3KDS E;  3ZYL A;  2VKH A;  3WI3 A;  3Q5E A;  4OHF A;  5AQL B;  2H7V C;  3PJA J;  3AED A;  3ETV A;  2K3W A;  5AQM B;  3RKG A;  4GK5 E;  2M6I A;  2UXD T;  2XG6 A;  5AQN B;  2WDR A;  3LFM A;  3LK2 B;  5HWY A;  2K5B B;  3HKE E;  5JR9 C;  2AXT O;  2Y6X A;  3P7I A;  5JRE A;  5AQR B;  2JQ9 A;  2VB6 A;  2KZ7 A;  4PJL A;  2ZM2 A;  5AQT B;  5LXT E;  4AFK A;  4U7I A;  5ABF B;  2HHH T;  3O1I A;  3ZYM A;  5J1G A;  1OED E;  2W61 A;  5F8P A;  1OED B;  4GYS A;  1HCI A;  2E9X D;  2Y0H A;  3HKD E;  1OPF A;  4WBO A;  1MND A;  4KI0 F;  4JI1 T;  4D65 A;  3EDU A;  2CE7 A;  2J4G A;  3PJA A;  3X1D A;  2Q9Q C;  5CA0 E;  5JDF A;  1FJG T;  4ILC A;  4IDP A;  1W0B A;  3QB5 A;  5F3J A;  5JRC B;  4LMJ A;  2HPL A;  2XM1 A;  5L3B B;  3PDY A;  4B3M T;  1U5P A;  2QRX A;  5KAF O;  5G3A A;  4GCS A;  3AE6 A;  3RQU A;  2A9U A;  3ZSS A;  4JI4 T;  4LSE A;  2ODU A;  4U33 A;  1XDO A;  4IHJ E;  5AQI B;  4TNV A;  1HTJ F;  2XQ9 A;  1HXX A;  5TIS O;  4XZC A;  2WWV A;  4FZL A;  4JEH B;  5DL8 A;  3BRZ A;  4OFZ A;  2V1D B;  4UF0 B;  4ILB A;  5LGT B;  3PUV F;  3LK2 A;  5IYZ E;  4C90 A;  3B13 A;  3FZF B;  1BXW A;  3HKB E;  5LJN A;  5ABF A;  2MOZ A;  5BR8 T;  3ZKR A;  5FL1 A;  3ZT6 A;  3DWN A;  5FY0 A;  1OED A;  5JDL A;  4UB6 O;  5J2T E;  2XUE A;  1T7S A;  2PG8 A;  4KHZ F;  1UX4 A;  3CIR A;  4DUZ T;  4PJJ A;  3UUB A;  3C51 A;  4H9R C;  3KBU A;  2KDY A;  4E1S A;  2UXN B;  3CX7 B;  3N9O A;  4ZEY A;  1ZHW A;  3EAB A;  4ZXL A;  2JQY A;  5JVD E;  5JRC A;  3V8U A;  2LSK A;  2E9X A;  2LE8 A;  1MIW A;  5ADX L;  1YXR A;  7PRN A;  4AKL A;  2XQY A;  2CBJ A;  3AE9 A;  2W62 A;  2HN1 A;  3VKH A;  3FYX A;  3LK4 2;  5LMN T;  5CA1 E;  4FES A;  2RPA A;  3O0E A;  4UEM A;  3PGR A;  3AA1 A;  4H9S E;  5IWA T;  2LSJ A;  2LSG A;  5HXC A;  3B5M A;  1N32 T;  4UF0 A;  3MAC A;  3UTK A;  6PRN A;  4ZI7 E;  3LG7 A;  4IE6 A;  3SS1 A;  2MPK A;  2KSR A;  4D5U A;  1VOM A;  3UU3 A;  5LA6 E;  4GKJ T;  4KX6 A;  1KNZ A;  2LSY A;  3T0S A;  2NR4 A;  2XAH B;  2EHO C;  1HR0 T;  1HXT A;  4U3C A;  2XTR A;  5AQV B;  4A5X A;  2XTL A;  2VL8 A;  1T72 A;  4UV8 B;  3OPC A;  3B57 A;  4FT6 A;  5FY1 A;  4LML A;  3VY8 X;  4MHC A;  4TV8 E;  1ZHX A;  1T98 A;  4U9C A;  1MPF A;  4DR7 T;  2WBL A;  3ESL A;  2Y8D A;  4AKH A;  4X62 T;  3HOE A;  3VZT X;  3PUQ A;  2DL1 A;  4U2Z A;  1XNQ T;  4X20 E;  3AE4 A;  4EED A;  2LKH A;  3A0B O;  4X65 T;  3PTR B;  2CLY C;  2V8S V;  3NWI A;  2FJE A;  4GIW A;  1MMA A;  4C00 A;  3NRX A;  5L3F B;  5JDN A;  1H6S 1;  1ZHY A;  2XJ7 A;  1D1B A;  4ILU A;  2NW7 A;  1SE7 A;  5LJM A;  3JC6 C;  4ADZ A;  3OYZ A;  3PUA A;  4CXX A;  4YSY A;  4PFP A;  3T8O A;  5H6R B;  4DBQ A;  3UPG A;  5G38 A;  3FBL A;  3O9X A;  4LFA T;  1IBL T;  4A98 A;  3POR A;  3HKC E;  2WMN A;  2Z6E A;  2XZE A;  5LHH B;  4E1T A;  4AYN A;  2QVA A;  4QH5 A;  4EXT A;  4WZX A;  3AB3 B;  4DV5 T;  1G8X A;  3N9N A;  4PK6 A;  2CWY A;  4L5G A;  4X66 T;  2MTQ A;  2XMX A;  3ABV A;  3N9P A;  3A0H O;  4N74 A;  4MLK A;  4IDQ A;  4I50 E;  4DV3 T;  2JMM A;  3QUJ A;  3ZPO A;  3L3P A;  2RP4 A;  5ETW A;  4IRE A;  5LP6 E;  1NEK A;  3P50 A;  3C64 A;  3N5L A;  2LRL A;  2XQ8 A;  2SPC A;  5IYU A;  4DND A;  3A8Y C;  3O4X E;  4HFD A;  5L3E B;  3ZLI A;  4DBR A;  4AYM C;  3HI2 A;  4FI5 A;  2XE1 A;  3POU A;  2Y0K A;  2X0H A;  5B5E O;  4UVC B;  4RJX A;  4L0R A;  1JNR A;  4OK0 A;  2VWA A;  3GN5 A;  4DR4 T;  1L0V A;  4FJO A;  3UFG A;  4NUV A;  4ILA A;  2X9K A;  3RPU A;  8PRN A;  2ZM0 A;  1R8I A;  5LHI B;  3CX6 B;  2R6G F;  5IHY A;  3AE8 A;  4C4V B;  4HN9 A;  3GMI A;  1WFD A;  3FB2 A;  2YK0 A;  4TZ4 C;  3ZN1 B;  2FGQ X;  1M62 A;  4FSP A;  3RIA A;  2JQK A;  2R88 A;  2X0Y A;  2YPV A;  2V6Y B;  2IML A;  2CLY B;  3PUR A;  4HWD A;  4X1Y E;  1NAF A;  4IE0 A;  4IL9 A;  5L3D B;  3AEG A;  4A97 A;  3BQK A;  4BAY B;  2K4T A;  4DVD A;  4DR5 T;  3ZMV B;  3PUY F;  3EDV A;  2ZM6 T;  4N78 D;  3TZG A;  5HEU A;  5CJ5 A;  3PQS A;  4K3B A;  1KNR A;  3JAD A;  4ZZC A;  2PRN A;  4P0B A;  3FZL B;  5ABH A;  2XQ5 A;  1SA0 E;  2VKJ A;  4O4H E;  4EOZ B;  2XAG B;  3H3A A;  3SZV A;  3C50 A;  5G39 A;  1SUM B;  4ZZB A;  2CXD A;  3N2O A;  1IBM T;  4JUY A;  2I59 A;  3RC8 A;  5FXX A;  5AQJ B;  3RF1 A;  4QHO A;  1S5L O;  2K48 A;  5FL0 A;  1MIV A;  5FP3 A;  4O3Y A;  5JH7 E;  4C4V A;  4AQF A;  3EHZ A;  2UUB T;  2BKP A;  3PGU A;  1NWM X;  5T5F A; 
#chains in the Genus database with same CATH homology
 4CXW A;  4UXN B;  2CE7 A;  2ZLD A;  3WI4 A;  2PJQ A;  2Q9Q C;  2DWK A;  2Q9Q B;  5CA0 E;  3A2S X;  2D0U A;  5GON E;  4GCP A;  5JDF A;  3M65 A;  4FRT A;  4O3X B;  1D0Z A;  4IE7 A;  4JLE A;  3RYF E;  3W15 B;  2C5K T;  5CB4 E;  1THQ A;  3VU7 H;  5F3J A;  5PRN A;  5JRC B;  3T20 A;  2HPL A;  2E9X C;  4IGU A;  3V5U A;  5L3B B;  3PDY A;  4O2A E;  4FOZ A;  2DNX A;  2WM9 A;  2YNK A;  1U5P A;  2Y48 B;  3IBP A;  3N9Q A;  4IST A;  5FXW A;  5LOV E;  4GCS A;  5EE2 A;  4TN7 B;  3OBV E;  1BT9 A;  2LJL A;  2H3R A;  4LSE A;  2ODU A;  3I9W A;  2IAK A;  1IAP A;  4IHJ E;  2CXF A;  3K8P C;  5FY7 A;  3O1J A;  1HTJ F;  4KBM B;  4HTE A;  5LBQ B;  1FEW A;  1HXX A;  2KWI B;  2ACX A;  4GF4 A;  3WAJ A;  2PFV A;  3A5X A;  4XZC A;  4U72 A;  3K3N A;  1OWA A;  4FZL A;  4JEH B;  4JCH A;  1IJ6 A;  4O4J E;  3ZJ1 A;  5DL8 A;  3IEE A;  4U74 A;  4EB6 E;  3K19 A;  4OFZ A;  2V1D B;  4UF0 B;  4UVA B;  1HF8 A;  4O3W A;  4FMS A;  3F31 A;  3VE1 A;  2NW9 A;  3DA4 A;  3CVR A;  4X1K E;  4AI6 A;  4ERR A;  5LGT B;  1P4T A;  2ODJ A;  3GA8 A;  3FXD B;  2DLR A;  3NZP A;  5IYZ E;  5L2L A;  3KV4 A;  1QJ9 A;  3LK2 A;  4C90 A;  3B13 A;  1BXW A;  1MMN A;  5DAB A;  2PBI A;  2QGS A;  5JR9 A;  5G26 A;  3DJB A;  1KK7 A;  2C0S A;  3FXE B;  3HKB E;  1HS7 A;  5LJN A;  5D5D A;  3RYI E;  5H6Q B;  3QK6 A;  2MOZ A;  3UUN A;  3HW9 A;  4YJ3 E;  2V7I A;  3RH3 A;  4CI3 B;  3NRY A;  2CCQ A;  4QXH B;  3UUL A;  2NWB A;  2XAJ B;  5FY0 A;  3SWH A;  5JDL A;  4G76 A;  4TX5 A;  3AA7 A;  1GFP A;  5J2T E;  4BUM X;  2A72 A;  2XUE A;  4HEA A;  3C5O A;  1YKH B;  3K3O A;  4GOU A;  2IC6 A;  3VHL A;  1UX5 A;  2PG8 A;  4AQG A;  4BJN A;  4PAG A;  1QUU A;  4UV9 B;  2GE4 A;  2OMF A;  4RL9 A;  1WRD A;  4KR4 A;  4CXY A;  3SRZ A;  3ZN0 B;  1H7C A;  2VKD A;  1UX4 A;  4HKA A;  5HXR A;  4PJJ A;  3LBX A;  3J7Y q;  3CQX C;  3C51 A;  4H9R C;  3C4Z A;  2QTK A;  5DJQ C;  3KBU A;  1Q9F A;  2KDY A;  4FSO A;  4TV9 E;  2BVM A;  4H9Q C;  1D1A A;  2Q9Q A;  4E1S A;  3AA0 B;  2UXN B;  4FZM A;  4PUX A;  2KWH A;  3IHR A;  5JQG E;  2XAQ B;  2UXX B;  3HWB A;  1EZ3 A;  4XAX B;  3CX7 B;  3N9O A;  1ZHW A;  2JRK A;  3POQ A;  2KMF A;  3V8U A;  5JVD E;  5JRC A;  4KRA A;  4LSI A;  3ZJ2 A;  4O49 A;  3WI5 A;  1MM5 A;  2LSK A;  3N9M A;  2E9X A;  2LE8 A;  5LNK A;  1MIW A;  5ADX L;  1MIY A;  5JDQ A;  7PRN A;  1CUN A;  2N2N A;  3ZMT B;  4PFO A;  4AKL A;  2XQY A;  1GFO A;  4H9O C;  2N2M A;  3PQU A;  3TKL B;  4MAL A;  2W62 A;  2MBG A;  3RRW A;  3AVR A;  4QKN A;  5LGU B;  2ZFG A;  3POX A;  3VKH A;  4FRX A;  2CEA A;  3VE2 A;  4Z8X A;  4KR8 A;  3FYX A;  3LK4 2;  4HE8 A;  4XNL A;  4AYI D;  2P9B A;  3I1A A;  5FXV A;  2O4V A;  3NZQ A;  5CA1 E;  4FES A;  3LK3 A;  2L3L A;  3UAQ A;  2WSS V;  2X66 A;  3MA9 A;  3J9X 1;  1OXZ A;  5E0O A;  4AYD C;  1FMV A;  2RA1 A;  2YEV C;  3F2E A;  2D2S A;  1BR4 A;  2XE5 A;  2XTQ A;  3KBT A;  4UEM A;  4UEL A;  2XE2 A;  3AA1 A;  3O0E A;  2DCF A;  2NP9 A;  5DQV A;  4H9S E;  4CI2 B;  3ZC1 A;  3KVB A;  2N2L A;  2BZB A;  1LVF A;  3F57 A;  2LSJ A;  2LSG A;  1QJ8 A;  2NW8 A;  3BQL A;  3OJA A;  2Y7S A;  2HPJ A;  4Z3T A;  1PRN A;  1HG2 A;  5HXC A;  5A1L A;  5J2U E;  4N58 A;  3ANW B;  4UF0 A;  2B1E A;  4EYU A;  3C98 B;  1BR0 A;  1S35 A;  3MAC A;  3UTK A;  3SYS A;  1FMW A;  3RC3 A;  6PRN A;  3PUS A;  2EHO D;  2NTY A;  2M67 A;  5HWX A;  4PJN A;  4EZH A;  4ZI7 E;  3LG7 A;  1US7 B;  3V5S A;  2LEH A;  4IE6 A;  5HXE A;  2OA5 A;  3CKD A;  3SS1 A;  3OKQ A;  1Q9G A;  2MHL A;  2X51 A;  4QXB B;  4NUU A;  4D5U A;  2E9X B;  3N2G E;  4G75 A;  4N59 A;  2JQQ A;  1VOM A;  2VKO A;  4RLC A;  1OSM A;  4HGA A;  5LA6 E;  2QA7 A;  2M06 A;  4ZHQ E;  2ES0 A;  4JFB A;  4I55 E;  2KLQ A;  3QRA A;  1KNZ A;  2LSY A;  3T0S A;  1HG5 A;  1YD8 G;  2LHR A;  2ZM8 A;  5AFU L;  1V9D A;  2EHO C;  2XAH B;  2EHO B;  1HXT A;  2XTR A;  4JEU B;  5FVN A;  3PU8 A;  4E7Z A;  3LK3 B;  1G90 A;  3E08 A;  3E0Z A;  4YHJ A;  3RKO A;  3FBZ A;  2WAU A;  2XTL A;  2VL8 A;  4DO0 A;  3ZCI A;  3AA1 B;  3LBX B;  2X0L B;  4B6X A;  4UIG A;  4RJW A;  5LGN B;  3AA0 A;  4UV8 B;  4QX7 B;  2W81 C;  4O4L E;  2KC0 A;  1Y64 B;  3U78 A;  1BH3 A;  2A2F X;  2X68 A;  4CZZ B;  1UCU A;  3B57 A;  5HAX A;  4EZ4 A;  1GFQ A;  3VKG A;  3L09 A;  5EZY E;  1O3X A;  3CQG B;  1GFN A;  2C5I T;  2CM0 A;  2KT9 A;  4EYY R;  4FT6 A;  2WWU A;  5FY1 A;  4P0A A;  4YJ2 E;  2HH7 A;  3UT5 E;  4BA9 A;  4OYJ A;  3VY8 X;  1QSD A;  5BMV E;  4MHC A;  4TV8 E;  1ZHX A;  1T98 A;  4U9C A;  1MPF A;  2D5U A;  2WBL A;  3CX8 B;  3UFE A;  2X9H A;  2J1N A;  2NTX A;  2J1D G;  1LVK A;  3ESL A;  3UUX B;  2Y8D A;  4AKH A;  2KND A;  5DL5 A;  3FHN A;  3N2K E;  3MKD A;  3HOE A;  3LJC A;  3QC9 A;  1IJ5 A;  3VZT X;  1WR6 A;  2K0L A;  3CQC B;  3PUQ A;  4ZS3 A;  1D1C A;  3R84 B;  4G63 A;  2A3D A;  2CMR A;  4P09 A;  3UUM A;  4B61 A;  5JDH A;  4AKM A;  3I9Y A;  3JC6 D;  3AAA B;  2X9W A;  4X20 E;  2W0G A;  3AAE B;  1Z0P A;  3E22 E;  1YW0 A;  2IW5 B;  5EK2 A;  3PTR B;  3EMN X;  1ZHZ A;  4L9I A;  2YU1 A;  2CLY C;  3ANW A;  3BQI A;  3Q5X A;  2ERV A;  4GIW A;  1MMA A;  2JPF A;  3NRX A;  5L3F B;  2LOP A;  5JDN A;  4PW8 A;  3PRN A;  5ADX K;  5LYJ E;  1PHO A;  1H6S 1;  1ZHY A;  4LSH A;  2K24 A;  1D1B A;  4ILU A;  3KV6 A;  3ZMU B;  2NOX A;  2NW7 A;  5LJM A;  4FZN A;  3Q2M A;  5DL7 A;  1YKE B;  3JC6 C;  4ADZ A;  3OYZ A;  3PUA A;  5LHG B;  2IC9 A;  4CXX A;  4O4U A;  5KX5 E;  4PFP A;  4ASK A;  3T8O A;  4LSF A;  4J2C A;  5FNV E;  2C5J A;  5H6R B;  4F4B A;  2L8K A;  4DBQ A;  2D0T A;  4ZI2 D;  4D64 A;  4ANJ A;  3UPG A;  3FBL A;  3O9X A;  3ZYK A;  4XNK A;  1ZHT A;  5HXH A;  2EHO A;  3SYB A;  3EUH A;  4CQI A;  3C4W A;  3HKC E;  2GK9 A;  2WMN A;  2Z6E A;  3Q9D A;  1ORM A;  3POR A;  4XBF B;  1VRB A;  5LHH B;  1D0Y A;  4E1T A;  3Q5W A;  4O4X A;  4AYN A;  4EIW A;  4EXT A;  4H9P C;  4F6R C;  3AB3 B;  4AKR B;  4FUV A;  2BVL A;  1G8X A;  3N9N A;  4PK6 A;  1E1H B;  1ZV4 X;  5FYM A;  3MJX A;  4ZI2 C;  4QX8 B;  2CWY A;  3SY7 A;  4L5G A;  1MMD A;  4WNK A;  2VK9 A;  4YLH A;  2MTQ A;  2XE3 A;  3AVS A;  4UVB B;  1ZHC A;  2XMX A;  3N9P A;  4C69 X;  3ETU A;  3KVA A;  4AKG A;  3BK9 A;  4MLK A;  1U4Q A;  5DL6 A;  4I50 E;  4TUY E;  2V7L A;  3CML A;  2LT3 A;  2JMM A;  3GP6 A;  2LHN A;  4K0U A;  3QUJ A;  3ZPO A;  3L3P A;  4QXC B;  2RP4 A;  1WYB A;  4BJM A;  1G73 A;  2ZLY A;  2CXL A;  5AFU K;  5ETW A;  2YU2 A;  4O2B E;  4O4I E;  3WAK A;  2XAS B;  5JDM A;  5LP6 E;  1LKX A;  4KMC A;  3C64 A;  4V1A v;  3N5L A;  3KV9 A;  5GV0 A;  1WYC A;  4QQ1 A;  4O3Z A;  2L9Q A;  3AAI A;  2YIN A;  3AAA A;  2N1G A;  2SPC A;  3PE0 A;  4GHB A;  5IYU A;  5TAO A;  4DND A;  3AAE A;  3O4X E;  2MYS A;  3ONX A;  5L3E B;  2F1V A;  3ZLI A;  2J4U P;  4CI1 B;  4IIJ E;  1MM4 A;  2N9D A;  4DBR A;  5C8Y E;  4AYM C;  5JDP A;  3HI2 A;  4FI5 A;  5KDM C;  2XE1 A;  3POU A;  4QWN B;  3KIN B;  5KMG P;  4H63 H;  2Y0K A;  4UVC B;  3EVY A;  4RJX A;  4L0R A;  4KUM B;  3ZC0 A;  5HYA A;  3RRC A;  2LM9 A;  2W00 A;  5L3C B;  3DA3 A;  3H37 A;  2X67 A;  3RYH E;  2W80 C;  3NBX X;  3ZCJ A;  3UU2 A;  4DMV A;  4E7S A;  4OK0 A;  2VWA A;  3GN5 A;  2W63 A;  2JMH A;  4FJO A;  4H63 V;  4A56 A;  1B7T A;  4NUV A;  2G0U A;  3I0O A;  2KXP A;  3QRC A;  3RPU A;  8PRN A;  3RYC E;  2KZ7 B;  2V26 A;  4ZOL E;  2H7O A;  4GK0 E;  1D0X A;  2ZM0 A;  2XHE B;  4PK5 A;  2V7J A;  4YFS A;  5M4Y A;  3AA6 A;  3VZW X;  3MK7 C;  4GYR A;  2E8I A;  1HFA A;  1MNE A;  2WMO A;  3CWZ B;  4X1I E;  4PJM A;  5LHI B;  4AUI A;  1WLX A;  2CWO A;  3CX6 B;  3RX6 A;  1S94 A;  2LOS A;  2KIN B;  5IHY A;  1IZN B;  4HN9 A;  4AQF C;  3GMI A;  3D0T A;  3DP7 A;  3MXZ A;  3SOL A;  2CA5 A;  3FB2 A;  4C91 A;  4AXP A;  3HR0 A;  3S4U A;  2YK0 A;  4TZ4 C;  3ZN1 B;  1MMG A;  3C4X A;  2FGQ X;  2V7M A;  4AKR A;  1HXU A;  3VZU X;  4ZS2 A;  4IDZ A;  4FSP A;  2K9A A;  4OYK A;  3ZEF B;  3HOL A;  4IE4 A;  4DMW A;  2YPV A;  2JMK A;  5LCY A;  5LBM A;  2CLY B;  2Y0L A;  3PUR A;  2BDE A;  3JTY A;  2JJ9 A;  3HL6 A;  1BR2 A;  4X1Y E;  5LG4 A;  2VAS A;  2X27 X;  2X9Y A;  2V7K A;  2DI4 A;  3KFW X;  3DTO A;  2DHR A;  2LFU A;  4ZI3 D;  1X79 A;  3HA4 A;  5EK4 A;  1AJ3 A;  3ZMS B;  1NAF A;  3K3Q C;  4IE0 A;  2X9X A;  3GN5 B;  2F1T A;  1ZEE A;  4AZL A;  4GCQ A;  3P8C D;  5L3D B;  1GFM A;  3KV5 A;  3LK4 1;  5DQW A;  2KXP B;  5FXZ A;  3T24 A;  3BQK A;  4RLB A;  4BAY B;  4EAH A;  2K4T A;  4DVD A;  5L3G B;  4I4T E;  3ZMV B;  2LHF A;  3EDV A;  2XAF B;  1FIO A;  4PK4 A;  2POR A;  3VY9 X;  3AA6 B;  4N78 D;  4MBQ A;  3TZG A;  3N9L A;  1E54 A;  4WBN E;  2ODV A;  2FGR A;  5FMN A;  3RBH A;  1ZKE A;  3ZMZ B;  3PQS A;  3PUG A;  3KDS E;  3ZYL A;  3I0Q A;  4ZI3 C;  3U3I A;  4MFR A;  2VKH A;  5HXS A;  4HFV A;  3WI3 A;  2LSI A;  4OHF A;  2H7V C;  2PRN A;  4P0B A;  5EK3 A;  3ETV A;  4KP3 C;  3G7G A;  3KVD D;  1SA0 E;  1BR1 A;  2VKJ A;  4GK5 E;  4O4H E;  4EOZ B;  2XG6 A;  3PU3 A;  2XAG B;  3LFM A;  1SHZ C;  3H3A A;  3LK2 B;  4G2A A;  3SZV A;  5HWY A;  2K5B B;  3HKE E;  3C50 A;  4AKI A;  2Y2X A;  2CXD A;  5JR9 C;  5JR9 B;  2Y6X A;  3P7I A;  5JRE A;  3N2O A;  4AYE C;  2M07 A;  5JDG A;  2DWG A;  2VB6 A;  3GWH A;  4JUY A;  4IE5 A;  2ZM2 A;  4PJL A;  3R6N A;  2I59 A;  1HX8 A;  5LXT E;  2KZ7 A;  3SY9 A;  4AFK A;  4WW0 A;  2Q9Q D;  3O1I A;  3ZYM A;  5J1G A;  4I43 B;  5FXX A;  3RC8 A;  2W61 A;  5F8P A;  1YS5 A;  3SZD A;  4QHO A;  1QJP A;  3AA7 B;  3MZK B;  4PNI A;  4GYS A;  2MNH A;  2K48 A;  3NSG A;  3O1H A;  1MIV A;  4M1P A;  1HCI A;  5FP3 A;  4O3Y A;  5JH7 E;  2E9X D;  1IZN A;  3OYX A;  2Y0H A;  2ZMA A;  4H9N C;  4AQF A;  3CPZ A;  3HKD E;  4WBO A;  1MND A;  1OPF A;  4ISS A;  1NWM X;  5T5F A;  4D65 A;  1LRZ A;  3IF8 B;  4O8S A;  3EDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...