2AXTO

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 36
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 2axtO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 2axtO02
5E79O 5GTHO 1S5LO 3A0HO 4UB6O 5TISO 3JCUO 4PJ0O 5G38A 4IL6O 5KAFO 2AXTO 5G39A 5G3AA 5GTIO 4UB8O 3KZIO 5B5EO 5B66O 3A0BO 3WU2O 5KAIO 5H2FO
chains in the Genus database with same CATH superfamily
4G76A 2FGRA 5PRNA 4O3WA 1THQA 3AA6B 2R89A 4AYEC 5ADXK 4RJXA 2QTKA 3NSGA 4D64A 1PHOA 1T16A 1BXWA 3G7GA 4KR8A 4O3ZA 4C4VA 2J4UP 1GFMA 3JCUO 1MM5A 2ZLDA 3QRAA 2KXPB 4PJ0O 1BH3A 3K19A 3VZTX 5FVNA 3PGUA 2Y2XA 3DWOX 4O3XB 5G26A 3WI5A 4AYDC 5D5DA 4C4VB 3BRZA 5G3AA 4LSHA 3BS0A 4QQ1A 4UB8O 3SYSA 1E54A 1BT9A 1P4TA 1HXXA 4FZLA 5B5EO 3UU2A 4AFKA 4PR7A 2WVPA 3HOLA 3JTYA 3VZWX 3AA0B 3LK42 1YS5A 2XE2A 2YPVA 4GF4A 4FZNA 2R4OA 3SZVA 2F1CX 4G75A 5E79O 3QRCA 3VY9X 1IZNA 3A0HO 2WJQA 2XE1A 3LK2A 3SYBA 4AYID 5TISO 2R4NA 3PQSA 3VE1A 6PRNA 2JMMA 3A2SX 3AAEB 4LSEA 2JQYA 4N75A 1QJPA 2KC0A 4AYNA 4B61A 1T1LA 4GCQA 4FZMA 2KZ7A 2PRNA 4O3YA 4FOZA 4FSPA 2N2MA 2XTQA 3AA1A 2ERVA 2FGQX 3PORA 3LK3A 2F1TA 3O0EA 4D5UA 5DL8A 4AKRA 3HOEA 3KVDD 3SZDA 1QJ8A 1ZHYA 2K0LA 2KZ7B 2Y7SA 3HW9A 5ADXL 4FESA 4E1SA 3LK3B 3AAAA 3T24A 4N59A 2GE4A 3A0BO 4RJWA 3VY8X 5JDPA 1GFPA 1ZHZA 1MPFA 2WJRA 3WU2O 4C69X 5KAIO 2MNHA 2O4VA 3NJTA 4JCHA 2X9KA 5T5FA 3WI4A 1S5LO 4AKMA 3BRYA 4E1TA 5GTHO 3EMNX 4FMSA 4KRAA 1MM4A 4XNLA 1GFOA 2ZFGA 3PQUA 3POUA 4GHBA 1QJ9A 5DL6A 4C00A 5G38A 4LSFA 4D65A 2KDYA 4N74A 4CTDA 5IYUA 1G90A 5KAFO 2F1VA 1IZNB 2AXTO 3T0SA 3RBHA 3SY7A 2XG6A 3LK2B 2N2LA 2OMFA 4GCSA 5DL5A 5G39A 3GP6A 2PORA 3V8UA 3TZGA 4Z3TA 4U9CA 5AFUL 3DA3A 1ZHTA 2XTRA 3KZIO 4GCPA 1OPFA 2XE3A 2IWVA 4AZLA 3DWNA 3DZMA 3POQA 3AA1B 5EE2A 4AUIA 2K4TA 5B66O 2LFUA 3PGSA 4FQEA 4PUXA 4XNKA 4AYMC 4N58A 1ZHXA 3VZUX 1GFNA 4RLCA 4AKRB 2KXPA 2W80C 3POXA 2M07A 2R4PA 3PRNA 2R88A 4RLBA 2Y0HA 3T20A 4KR4A 3AAAB 4UB6O 2W81C 2M06A 3PGRA 4FRXA 4LSIA 3AA7A 3VE2A 2MHLA 2XMXA 1H6S1 2Y0KA 4O49A 4RL9A 3C5OA 4IL6O 1ORMA 1PRNA 2R8AA 2IWWA 2ODJA 2R4LA 4FT6A 4BUMX 1HXUA 3HWBA 3UAQA 4F4BA 1OSMA 3AA7B 3UPGA 2YNKA 1Q9FA 4FUVA 4JFBA 3AA0A 1GFQA 1ZHWA 4FRTA 4K3CA 5GTIO 2X27X 4O4UA 8PRNA 4FSOA 3PF1A 7PRNA 4O4XA 1Q9GA 3AA6A 3DA4A 3LK41 4K3BA 5DL7A 3SY9A 2J1NA 1HXTA 2LHFA 3AAEA 5AFUK 2XE5A 3FYXA 5GV0A 5H2FO 2Y0LA
chains in the Genus database with same CATH topology
5E79O 5GTHO 1S5LO 3A0HO 4UB6O 5TISO 3JCUO 4PJ0O 5G38A 4IL6O 5KAFO 2AXTO 5G39A 5G3AA 5GTIO 4UB8O 3KZIO 5B5EO 5B66O 3A0BO 3WU2O 5KAIO 5H2FO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 O;  5GTH O;  1S5L O;  3A0H O;  4UB6 O;  5TIS O;  3JCU O;  4PJ0 O;  5G38 A;  4IL6 O;  5KAF O;  2AXT O;  5G39 A;  5G3A A;  5GTI O;  4UB8 O;  3KZI O;  5B5E O;  5B66 O;  3A0B O;  3WU2 O;  5KAI O;  5H2F O; 
#chains in the Genus database with same CATH topology
 4G76 A;  2FGR A;  5PRN A;  4O3W A;  1THQ A;  3AA6 B;  2R89 A;  4AYE C;  5ADX K;  4RJX A;  2QTK A;  3NSG A;  4D64 A;  1PHO A;  1T16 A;  1BXW A;  3G7G A;  4KR8 A;  4O3Z A;  4C4V A;  2J4U P;  1GFM A;  3JCU O;  1MM5 A;  2ZLD A;  3QRA A;  2KXP B;  4PJ0 O;  1BH3 A;  3K19 A;  3VZT X;  5FVN A;  3PGU A;  2Y2X A;  3DWO X;  4O3X B;  5G26 A;  3WI5 A;  4AYD C;  5D5D A;  4C4V B;  3BRZ A;  5G3A A;  4LSH A;  3BS0 A;  4QQ1 A;  4UB8 O;  3SYS A;  1E54 A;  1BT9 A;  1P4T A;  1HXX A;  4FZL A;  5B5E O;  3UU2 A;  4AFK A;  4PR7 A;  2WVP A;  3HOL A;  3JTY A;  3VZW X;  3AA0 B;  3LK4 2;  1YS5 A;  2XE2 A;  2YPV A;  4GF4 A;  4FZN A;  2R4O A;  3SZV A;  2F1C X;  4G75 A;  5E79 O;  3QRC A;  3VY9 X;  1IZN A;  3A0H O;  2WJQ A;  2XE1 A;  3LK2 A;  3SYB A;  4AYI D;  5TIS O;  2R4N A;  3PQS A;  3VE1 A;  6PRN A;  2JMM A;  3A2S X;  3AAE B;  4LSE A;  2JQY A;  4N75 A;  1QJP A;  2KC0 A;  4AYN A;  4B61 A;  1T1L A;  4GCQ A;  4FZM A;  2KZ7 A;  2PRN A;  4O3Y A;  4FOZ A;  4FSP A;  2N2M A;  2XTQ A;  3AA1 A;  2ERV A;  2FGQ X;  3POR A;  3LK3 A;  2F1T A;  3O0E A;  4D5U A;  5DL8 A;  4AKR A;  3HOE A;  3KVD D;  3SZD A;  1QJ8 A;  1ZHY A;  2K0L A;  2KZ7 B;  2Y7S A;  3HW9 A;  5ADX L;  4FES A;  4E1S A;  3LK3 B;  3AAA A;  3T24 A;  4N59 A;  2GE4 A;  3A0B O;  4RJW A;  3VY8 X;  5JDP A;  1GFP A;  1ZHZ A;  1MPF A;  2WJR A;  3WU2 O;  4C69 X;  5KAI O;  2MNH A;  2O4V A;  3NJT A;  4JCH A;  2X9K A;  5T5F A;  3WI4 A;  1S5L O;  4AKM A;  3BRY A;  4E1T A;  5GTH O;  3EMN X;  4FMS A;  4KRA A;  1MM4 A;  4XNL A;  1GFO A;  2ZFG A;  3PQU A;  3POU A;  4GHB A;  1QJ9 A;  5DL6 A;  4C00 A;  5G38 A;  4LSF A;  4D65 A;  2KDY A;  4N74 A;  4CTD A;  5IYU A;  1G90 A;  5KAF O;  2F1V A;  1IZN B;  2AXT O;  3T0S A;  3RBH A;  3SY7 A;  2XG6 A;  3LK2 B;  2N2L A;  2OMF A;  4GCS A;  5DL5 A;  5G39 A;  3GP6 A;  2POR A;  3V8U A;  3TZG A;  4Z3T A;  4U9C A;  5AFU L;  3DA3 A;  1ZHT A;  2XTR A;  3KZI O;  4GCP A;  1OPF A;  2XE3 A;  2IWV A;  4AZL A;  3DWN A;  3DZM A;  3POQ A;  3AA1 B;  5EE2 A;  4AUI A;  2K4T A;  5B66 O;  2LFU A;  3PGS A;  4FQE A;  4PUX A;  4XNK A;  4AYM C;  4N58 A;  1ZHX A;  3VZU X;  1GFN A;  4RLC A;  4AKR B;  2KXP A;  2W80 C;  3POX A;  2M07 A;  2R4P A;  3PRN A;  2R88 A;  4RLB A;  2Y0H A;  3T20 A;  4KR4 A;  3AAA B;  4UB6 O;  2W81 C;  2M06 A;  3PGR A;  4FRX A;  4LSI A;  3AA7 A;  3VE2 A;  2MHL A;  2XMX A;  1H6S 1;  2Y0K A;  4O49 A;  4RL9 A;  3C5O A;  4IL6 O;  1ORM A;  1PRN A;  2R8A A;  2IWW A;  2ODJ A;  2R4L A;  4FT6 A;  4BUM X;  1HXU A;  3HWB A;  3UAQ A;  4F4B A;  1OSM A;  3AA7 B;  3UPG A;  2YNK A;  1Q9F A;  4FUV A;  4JFB A;  3AA0 A;  1GFQ A;  1ZHW A;  4FRT A;  4K3C A;  5GTI O;  2X27 X;  4O4U A;  8PRN A;  4FSO A;  3PF1 A;  7PRN A;  4O4X A;  1Q9G A;  3AA6 A;  3DA4 A;  3LK4 1;  4K3B A;  5DL7 A;  3SY9 A;  2J1N A;  1HXT A;  2LHF A;  3AAE A;  5AFU K;  2XE5 A;  3FYX A;  5GV0 A;  5H2F O;  2Y0L A; 
#chains in the Genus database with same CATH homology
 5E79 O;  5GTH O;  1S5L O;  3A0H O;  4UB6 O;  5TIS O;  3JCU O;  4PJ0 O;  5G38 A;  4IL6 O;  5KAF O;  2AXT O;  5G39 A;  5G3A A;  5GTI O;  4UB8 O;  3KZI O;  5B5E O;  5B66 O;  3A0B O;  3WU2 O;  5KAI O;  5H2F O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...