2AXTO

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 36
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 2axtO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 2axtO02
5GTHO 4UB8O 4UB6O 3A0HO 3A0BO 5H2FO 5KAFO 5G38A 5B66O 5B5EO 5TISO 2AXTO 3KZIO 3JCUO 5GTIO 5G39A 3WU2O 4PJ0O 5KAIO 1S5LO 4IL6O 5G3AA 5E79O
chains in the Genus database with same CATH superfamily
3SYSA 3T0SA 4C4VA 2MHLA 2XE1A 3V8UA 3QRAA 2WJQA 4JCHA 4AYDC 5GTHO 3WI5A 4Z3TA 2LFUA 4N75A 5KAFO 7PRNA 3PGSA 4C4VB 2QTKA 5ADXL 2M06A 2N2LA 2XE3A 1BT9A 2KXPA 3UU2A 3VE1A 3AA0B 3POQA 4XNLA 1HXUA 2R4PA 3GP6A 4LSHA 4K3CA 4E1SA 5G26A 1THQA 3VZWX 1GFNA 1HXTA 3AA6B 4AYNA 4AFKA 3LK2B 4O3ZA 4FMSA 5KAIO 2IWVA 3SZDA 1MM5A 3PGRA 5DL8A 1Q9GA 2R89A 3AA7A 1PRNA 3FYXA 4G75A 2R88A 4O4UA 1PHOA 5EE2A 3PQUA 4KR4A 3TZGA 4FT6A 5G3AA 4LSIA 5PRNA 4AKRB 2XMXA 3DA3A 2XE2A 3NSGA 3AAEA 3PORA 1OPFA 2XG6A 2J1NA 4N59A 4RLBA 2K4TA 2FGRA 3A0HO 4FSPA 4FUVA 5H2FO 2FGQX 3HWBA 2F1TA 2ERVA 3QRCA 5D5DA 4AZLA 3SZVA 1ZHZA 2ZLDA 2YPVA 8PRNA 4D64A 3AA1A 5TISO 3AA6A 4RL9A 4AUIA 3AAEB 3KZIO 4AYEC 4XNKA 5GTIO 3T24A 2LHFA 2GE4A 1T1LA 4G76A 3RBHA 3UAQA 4GCPA 3AA1B 5DL5A 5G39A 3HW9A 3WU2O 3T20A 2X27X 4GCQA 4FSOA 4RJWA 2O4VA 3UPGA 5AFUL 2R4OA 1Q9FA 4LSFA 4RJXA 1H6S1 2Y0LA 1P4TA 2Y7SA 4O4XA 3VE2A 1ZHTA 4FQEA 5DL7A 2KXPB 4QQ1A 4FRTA 4B61A 2J4UP 2ZFGA 3AA7B 1ZHWA 3DA4A 2F1CX 4FZMA 4K3BA 3BRZA 4AYID 4KRAA 4O3YA 3VY9X 1ORMA 2R4LA 3BRYA 3POXA 4O49A 1ZHXA 5FVNA 4UB8O 3A0BO 2KC0A 6PRNA 3VY8X 1QJ9A 3LK3B 5B66O 5GV0A 1OSMA 2W80C 2Y0HA 3LK41 4U9CA 3K19A 4LSEA 4N58A 4PR7A 3SYBA 4D5UA 5T5FA 5B5EO 3POUA 1GFPA 2WVPA 3HOEA 4F4BA 3SY7A 2XE5A 2JMMA 3DWOX 1IZNA 2Y0KA 1GFQA 3DZMA 1ZHYA 3PGUA 3DWNA 3O0EA 1IZNB 3VZUX 2R8AA 4O3XB 4PJ0O 1HXXA 4FOZA 1S5LO 3A2SX 1BXWA 2IWWA 4JFBA 4RLCA 4BUMX 4FESA 5IYUA 2YNKA 1G90A 3C5OA 3G7GA 2WJRA 4GF4A 2ODJA 3PF1A 5AFUK 4CTDA 3PRNA 4AYMC 3LK42 2M07A 2KZ7A 5ADXK 1MPFA 3SY9A 2JQYA 3AAAB 4UB6O 4KR8A 1QJ8A 2X9KA 1YS5A 4D65A 2K0LA 4E1TA 5DL6A 2PRNA 4GHBA 4O3WA 5G38A 3VZTX 3JTYA 4FRXA 3EMNX 2OMFA 3WI4A 4AKMA 3PQSA 1E54A 2AXTO 2F1VA 2KDYA 1T16A 4GCSA 3JCUO 4PUXA 2R4NA 4FZNA 1QJPA 2N2MA 3LK2A 3NJTA 2W81C 3AA0A 2Y2XA 2KZ7B 3HOLA 4FZLA 2PORA 2XTRA 4C00A 5JDPA 2MNHA 4AKRA 3LK3A 3BS0A 4C69X 1BH3A 1GFMA 1MM4A 4IL6O 4N74A 3AAAA 1GFOA 5E79O 3KVDD 2XTQA
chains in the Genus database with same CATH topology
5GTHO 4UB8O 4UB6O 3A0HO 3A0BO 5H2FO 5KAFO 5G38A 5B66O 5B5EO 5TISO 2AXTO 3KZIO 3JCUO 5GTIO 5G39A 3WU2O 4PJ0O 5KAIO 1S5LO 4IL6O 5G3AA 5E79O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  4UB8 O;  4UB6 O;  3A0H O;  3A0B O;  5H2F O;  5KAF O;  5G38 A;  5B66 O;  5B5E O;  5TIS O;  2AXT O;  3KZI O;  3JCU O;  5GTI O;  5G39 A;  3WU2 O;  4PJ0 O;  5KAI O;  1S5L O;  4IL6 O;  5G3A A;  5E79 O; 
#chains in the Genus database with same CATH topology
 3SYS A;  3T0S A;  4C4V A;  2MHL A;  2XE1 A;  3V8U A;  3QRA A;  2WJQ A;  4JCH A;  4AYD C;  5GTH O;  3WI5 A;  4Z3T A;  2LFU A;  4N75 A;  5KAF O;  7PRN A;  3PGS A;  4C4V B;  2QTK A;  5ADX L;  2M06 A;  2N2L A;  2XE3 A;  1BT9 A;  2KXP A;  3UU2 A;  3VE1 A;  3AA0 B;  3POQ A;  4XNL A;  1HXU A;  2R4P A;  3GP6 A;  4LSH A;  4K3C A;  4E1S A;  5G26 A;  1THQ A;  3VZW X;  1GFN A;  1HXT A;  3AA6 B;  4AYN A;  4AFK A;  3LK2 B;  4O3Z A;  4FMS A;  5KAI O;  2IWV A;  3SZD A;  1MM5 A;  3PGR A;  5DL8 A;  1Q9G A;  2R89 A;  3AA7 A;  1PRN A;  3FYX A;  4G75 A;  2R88 A;  4O4U A;  1PHO A;  5EE2 A;  3PQU A;  4KR4 A;  3TZG A;  4FT6 A;  5G3A A;  4LSI A;  5PRN A;  4AKR B;  2XMX A;  3DA3 A;  2XE2 A;  3NSG A;  3AAE A;  3POR A;  1OPF A;  2XG6 A;  2J1N A;  4N59 A;  4RLB A;  2K4T A;  2FGR A;  3A0H O;  4FSP A;  4FUV A;  5H2F O;  2FGQ X;  3HWB A;  2F1T A;  2ERV A;  3QRC A;  5D5D A;  4AZL A;  3SZV A;  1ZHZ A;  2ZLD A;  2YPV A;  8PRN A;  4D64 A;  3AA1 A;  5TIS O;  3AA6 A;  4RL9 A;  4AUI A;  3AAE B;  3KZI O;  4AYE C;  4XNK A;  5GTI O;  3T24 A;  2LHF A;  2GE4 A;  1T1L A;  4G76 A;  3RBH A;  3UAQ A;  4GCP A;  3AA1 B;  5DL5 A;  5G39 A;  3HW9 A;  3WU2 O;  3T20 A;  2X27 X;  4GCQ A;  4FSO A;  4RJW A;  2O4V A;  3UPG A;  5AFU L;  2R4O A;  1Q9F A;  4LSF A;  4RJX A;  1H6S 1;  2Y0L A;  1P4T A;  2Y7S A;  4O4X A;  3VE2 A;  1ZHT A;  4FQE A;  5DL7 A;  2KXP B;  4QQ1 A;  4FRT A;  4B61 A;  2J4U P;  2ZFG A;  3AA7 B;  1ZHW A;  3DA4 A;  2F1C X;  4FZM A;  4K3B A;  3BRZ A;  4AYI D;  4KRA A;  4O3Y A;  3VY9 X;  1ORM A;  2R4L A;  3BRY A;  3POX A;  4O49 A;  1ZHX A;  5FVN A;  4UB8 O;  3A0B O;  2KC0 A;  6PRN A;  3VY8 X;  1QJ9 A;  3LK3 B;  5B66 O;  5GV0 A;  1OSM A;  2W80 C;  2Y0H A;  3LK4 1;  4U9C A;  3K19 A;  4LSE A;  4N58 A;  4PR7 A;  3SYB A;  4D5U A;  5T5F A;  5B5E O;  3POU A;  1GFP A;  2WVP A;  3HOE A;  4F4B A;  3SY7 A;  2XE5 A;  2JMM A;  3DWO X;  1IZN A;  2Y0K A;  1GFQ A;  3DZM A;  1ZHY A;  3PGU A;  3DWN A;  3O0E A;  1IZN B;  3VZU X;  2R8A A;  4O3X B;  4PJ0 O;  1HXX A;  4FOZ A;  1S5L O;  3A2S X;  1BXW A;  2IWW A;  4JFB A;  4RLC A;  4BUM X;  4FES A;  5IYU A;  2YNK A;  1G90 A;  3C5O A;  3G7G A;  2WJR A;  4GF4 A;  2ODJ A;  3PF1 A;  5AFU K;  4CTD A;  3PRN A;  4AYM C;  3LK4 2;  2M07 A;  2KZ7 A;  5ADX K;  1MPF A;  3SY9 A;  2JQY A;  3AAA B;  4UB6 O;  4KR8 A;  1QJ8 A;  2X9K A;  1YS5 A;  4D65 A;  2K0L A;  4E1T A;  5DL6 A;  2PRN A;  4GHB A;  4O3W A;  5G38 A;  3VZT X;  3JTY A;  4FRX A;  3EMN X;  2OMF A;  3WI4 A;  4AKM A;  3PQS A;  1E54 A;  2AXT O;  2F1V A;  2KDY A;  1T16 A;  4GCS A;  3JCU O;  4PUX A;  2R4N A;  4FZN A;  1QJP A;  2N2M A;  3LK2 A;  3NJT A;  2W81 C;  3AA0 A;  2Y2X A;  2KZ7 B;  3HOL A;  4FZL A;  2POR A;  2XTR A;  4C00 A;  5JDP A;  2MNH A;  4AKR A;  3LK3 A;  3BS0 A;  4C69 X;  1BH3 A;  1GFM A;  1MM4 A;  4IL6 O;  4N74 A;  3AAA A;  1GFO A;  5E79 O;  3KVD D;  2XTQ A; 
#chains in the Genus database with same CATH homology
 5GTH O;  4UB8 O;  4UB6 O;  3A0H O;  3A0B O;  5H2F O;  5KAF O;  5G38 A;  5B66 O;  5B5E O;  5TIS O;  2AXT O;  3KZI O;  3JCU O;  5GTI O;  5G39 A;  3WU2 O;  4PJ0 O;  5KAI O;  1S5L O;  4IL6 O;  5G3A A;  5E79 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...