2AXTO

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 36
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 2axtO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 2axtO02
3KZIO 5B66O 3A0BO 1S5LO 5GTHO 4UB6O 5TISO 5KAIO 5G3AA 3JCUO 3A0HO 4IL6O 5GTIO 5G38A 5E79O 4UB8O 4PJ0O 5KAFO 5H2FO 5B5EO 2AXTO 3WU2O 5G39A
chains in the Genus database with same CATH superfamily
3V8UA 2N2MA 1IZNA 2F1CX 2M07A 1Q9FA 5EE2A 1S5LO 3HOEA 4D5UA 2XE5A 1PRNA 2JMMA 2R89A 4FT6A 4GCSA 3POXA 3WI5A 4KR8A 1MPFA 3GP6A 3K19A 3JCUO 3LK3B 2R8AA 1OSMA 4E1TA 1QJ8A 1H6S1 3AAEA 3DA4A 4C4VA 2W80C 1GFQA 2PORA 1GFNA 2N2LA 4RJWA 2ZLDA 5AFUL 4U9CA 3AAAA 2Y0HA 3AA0B 2W81C 3POQA 1HXUA 4K3CA 3PF1A 5E79O 5GTIO 3AA6B 3G7GA 4XNLA 4O3ZA 1T16A 3AA7B 2LFUA 3SYSA 2R4PA 1GFMA 4GCPA 5B5EO 3T20A 4N74A 5PRNA 2XE1A 4N75A 3SYBA 4AYEC 2XE2A 5B66O 4LSHA 4AYNA 5DL5A 3C5OA 4PR7A 3VE2A 3VY8X 2JQYA 5TISO 4O3XB 2M06A 3T24A 4AYMC 1PHOA 4F4BA 5JDPA 5T5FA 2FGRA 1GFOA 1QJ9A 4AYID 3BRZA 1BT9A 3SZVA 4O4UA 3BS0A 4AUIA 1THQA 3AA0A 3PGSA 4N58A 3AA6A 4O3YA 2IWWA 2R4LA 4LSEA 1E54A 3AA7A 3DA3A 3O0EA 2MHLA 4O3WA 5GV0A 3BRYA 4C00A 2MNHA 4AKRB 4CTDA 1QJPA 4XNKA 2Y0KA 4KR4A 2XMXA 4Z3TA 3UU2A 5H2FO 4FOZA 5AFUK 2R4OA 1BH3A 1Q9GA 2GE4A 3DWNA 5D5DA 4GHBA 2R88A 4JCHA 2F1TA 2F1VA 2ODJA 4RJXA 2YNKA 4FSOA 3VZUX 2KC0A 3A0BO 4PUXA 5ADXL 3PGUA 2ZFGA 3VE1A 4AYDC 3HWBA 5KAIO 3NSGA 4KRAA 3POUA 2Y2XA 4FRXA 4FUVA 4GCQA 2J1NA 2QTKA 2X27X 3QRAA 4AFKA 3WI4A 1ZHWA 2KZ7B 3DWOX 3EMNX 4QQ1A 2WJQA 3SY7A 3TZGA 3DZMA 4AKRA 3UPGA 2XTQA 1HXTA 3VZWX 2PRNA 2KDYA 5DL8A 2IWVA 3AA1B 4LSIA 1GFPA 4G75A 4FZNA 2KXPA 4B61A 2WJRA 5G26A 2X9KA 2YPVA 5DL6A 2ERVA 4O49A 3UAQA 4BUMX 4PJ0O 3VZTX 3HOLA 3QRCA 4N59A 1ORMA 4AKMA 2J4UP 2OMFA 3LK2B 4O4XA 2KXPB 3PQUA 2FGQX 1ZHZA 1T1LA 2K4TA 3KVDD 2K0LA 3LK41 4RL9A 5G39A 3RBHA 4AZLA 4E1SA 2Y0LA 1HXXA 1ZHYA 3JTYA 3KZIO 4D64A 3FYXA 2O4VA 1P4TA 2XG6A 2XTRA 5GTHO 2KZ7A 1ZHXA 3HW9A 3NJTA 4UB6O 4FZMA 4FRTA 4LSFA 5G3AA 2WVPA 4D65A 1OPFA 1IZNB 4K3BA 3AA1A 5ADXK 3VY9X 3A0HO 3PORA 3SZDA 1BXWA 4JFBA 3LK42 4RLBA 4C69X 3T0SA 4IL6O 3PRNA 4GF4A 5FVNA 3A2SX 3AAEB 4FSPA 4G76A 2XE3A 3PQSA 1ZHTA 3LK2A 4FZLA 5DL7A 5G38A 4C4VB 3PGRA 1MM4A 1YS5A 4UB8O 8PRNA 4FMSA 2LHFA 5KAFO 5IYUA 3SY9A 2Y7SA 1G90A 3AAAB 3LK3A 1MM5A 4FESA 4FQEA 2R4NA 7PRNA 6PRNA 4RLCA 2AXTO 3WU2O
chains in the Genus database with same CATH topology
3KZIO 5B66O 3A0BO 1S5LO 5GTHO 4UB6O 5TISO 5KAIO 5G3AA 3JCUO 3A0HO 4IL6O 5GTIO 5G38A 5E79O 4UB8O 4PJ0O 5KAFO 5H2FO 5B5EO 2AXTO 3WU2O 5G39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI O;  5B66 O;  3A0B O;  1S5L O;  5GTH O;  4UB6 O;  5TIS O;  5KAI O;  5G3A A;  3JCU O;  3A0H O;  4IL6 O;  5GTI O;  5G38 A;  5E79 O;  4UB8 O;  4PJ0 O;  5KAF O;  5H2F O;  5B5E O;  2AXT O;  3WU2 O;  5G39 A; 
#chains in the Genus database with same CATH topology
 3V8U A;  2N2M A;  1IZN A;  2F1C X;  2M07 A;  1Q9F A;  5EE2 A;  1S5L O;  3HOE A;  4D5U A;  2XE5 A;  1PRN A;  2JMM A;  2R89 A;  4FT6 A;  4GCS A;  3POX A;  3WI5 A;  4KR8 A;  1MPF A;  3GP6 A;  3K19 A;  3JCU O;  3LK3 B;  2R8A A;  1OSM A;  4E1T A;  1QJ8 A;  1H6S 1;  3AAE A;  3DA4 A;  4C4V A;  2W80 C;  1GFQ A;  2POR A;  1GFN A;  2N2L A;  4RJW A;  2ZLD A;  5AFU L;  4U9C A;  3AAA A;  2Y0H A;  3AA0 B;  2W81 C;  3POQ A;  1HXU A;  4K3C A;  3PF1 A;  5E79 O;  5GTI O;  3AA6 B;  3G7G A;  4XNL A;  4O3Z A;  1T16 A;  3AA7 B;  2LFU A;  3SYS A;  2R4P A;  1GFM A;  4GCP A;  5B5E O;  3T20 A;  4N74 A;  5PRN A;  2XE1 A;  4N75 A;  3SYB A;  4AYE C;  2XE2 A;  5B66 O;  4LSH A;  4AYN A;  5DL5 A;  3C5O A;  4PR7 A;  3VE2 A;  3VY8 X;  2JQY A;  5TIS O;  4O3X B;  2M06 A;  3T24 A;  4AYM C;  1PHO A;  4F4B A;  5JDP A;  5T5F A;  2FGR A;  1GFO A;  1QJ9 A;  4AYI D;  3BRZ A;  1BT9 A;  3SZV A;  4O4U A;  3BS0 A;  4AUI A;  1THQ A;  3AA0 A;  3PGS A;  4N58 A;  3AA6 A;  4O3Y A;  2IWW A;  2R4L A;  4LSE A;  1E54 A;  3AA7 A;  3DA3 A;  3O0E A;  2MHL A;  4O3W A;  5GV0 A;  3BRY A;  4C00 A;  2MNH A;  4AKR B;  4CTD A;  1QJP A;  4XNK A;  2Y0K A;  4KR4 A;  2XMX A;  4Z3T A;  3UU2 A;  5H2F O;  4FOZ A;  5AFU K;  2R4O A;  1BH3 A;  1Q9G A;  2GE4 A;  3DWN A;  5D5D A;  4GHB A;  2R88 A;  4JCH A;  2F1T A;  2F1V A;  2ODJ A;  4RJX A;  2YNK A;  4FSO A;  3VZU X;  2KC0 A;  3A0B O;  4PUX A;  5ADX L;  3PGU A;  2ZFG A;  3VE1 A;  4AYD C;  3HWB A;  5KAI O;  3NSG A;  4KRA A;  3POU A;  2Y2X A;  4FRX A;  4FUV A;  4GCQ A;  2J1N A;  2QTK A;  2X27 X;  3QRA A;  4AFK A;  3WI4 A;  1ZHW A;  2KZ7 B;  3DWO X;  3EMN X;  4QQ1 A;  2WJQ A;  3SY7 A;  3TZG A;  3DZM A;  4AKR A;  3UPG A;  2XTQ A;  1HXT A;  3VZW X;  2PRN A;  2KDY A;  5DL8 A;  2IWV A;  3AA1 B;  4LSI A;  1GFP A;  4G75 A;  4FZN A;  2KXP A;  4B61 A;  2WJR A;  5G26 A;  2X9K A;  2YPV A;  5DL6 A;  2ERV A;  4O49 A;  3UAQ A;  4BUM X;  4PJ0 O;  3VZT X;  3HOL A;  3QRC A;  4N59 A;  1ORM A;  4AKM A;  2J4U P;  2OMF A;  3LK2 B;  4O4X A;  2KXP B;  3PQU A;  2FGQ X;  1ZHZ A;  1T1L A;  2K4T A;  3KVD D;  2K0L A;  3LK4 1;  4RL9 A;  5G39 A;  3RBH A;  4AZL A;  4E1S A;  2Y0L A;  1HXX A;  1ZHY A;  3JTY A;  3KZI O;  4D64 A;  3FYX A;  2O4V A;  1P4T A;  2XG6 A;  2XTR A;  5GTH O;  2KZ7 A;  1ZHX A;  3HW9 A;  3NJT A;  4UB6 O;  4FZM A;  4FRT A;  4LSF A;  5G3A A;  2WVP A;  4D65 A;  1OPF A;  1IZN B;  4K3B A;  3AA1 A;  5ADX K;  3VY9 X;  3A0H O;  3POR A;  3SZD A;  1BXW A;  4JFB A;  3LK4 2;  4RLB A;  4C69 X;  3T0S A;  4IL6 O;  3PRN A;  4GF4 A;  5FVN A;  3A2S X;  3AAE B;  4FSP A;  4G76 A;  2XE3 A;  3PQS A;  1ZHT A;  3LK2 A;  4FZL A;  5DL7 A;  5G38 A;  4C4V B;  3PGR A;  1MM4 A;  1YS5 A;  4UB8 O;  8PRN A;  4FMS A;  2LHF A;  5KAF O;  5IYU A;  3SY9 A;  2Y7S A;  1G90 A;  3AAA B;  3LK3 A;  1MM5 A;  4FES A;  4FQE A;  2R4N A;  7PRN A;  6PRN A;  4RLC A;  2AXT O;  3WU2 O; 
#chains in the Genus database with same CATH homology
 3KZI O;  5B66 O;  3A0B O;  1S5L O;  5GTH O;  4UB6 O;  5TIS O;  5KAI O;  5G3A A;  3JCU O;  3A0H O;  4IL6 O;  5GTI O;  5G38 A;  5E79 O;  4UB8 O;  4PJ0 O;  5KAF O;  5H2F O;  5B5E O;  2AXT O;  3WU2 O;  5G39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...