2AXTO

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 36
structure length 242
sequence length 242
chains with identical sequence o
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 2axtO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 2axtO02
5GTHO 2AXTO 5G39A 4IL6O 5H2FO 1S5LO 5TISO 4UB6O 3WU2O 5G3AA 3KZIO 5E79O 5G38A 4PJ0O 3A0HO 4UB8O 5KAFO 3JCUO 5B5EO 5B66O 5KAIO 5GTIO 3A0BO
chains in the Genus database with same CATH superfamily
3VE1A 3SYBA 1Q9FA 4B61A 3POXA 4O49A 3AA6A 2LFUA 3LK42 1MM4A 4QQ1A 5ADXL 3PORA 5G39A 3AA7B 4LSHA 2Y0LA 3HOLA 1BH3A 3T0SA 1T1LA 2K0LA 2Y0HA 3EMNX 5TISO 7PRNA 2WJQA 4F4BA 2Y7SA 2ZLDA 3LK2B 3AA0A 1QJ8A 2YPVA 3WU2O 4D64A 4Z3TA 5JDPA 4G75A 5G3AA 3PRNA 5DL6A 4KRAA 5PRNA 3LK3B 3AA7A 3SY7A 5KAFO 4UB8O 1E54A 3JCUO 3UU2A 2M07A 2R4LA 1H6S1 4N59A 3VY9X 3QRCA 5ADXK 3NSGA 3PQUA 2R89A 3LK2A 3DWOX 3VE2A 3DA4A 2PORA 1ZHXA 4GCQA 2PRNA 2J1NA 1P4TA 4PR7A 3SZVA 2O4VA 3A0BO 4K3CA 1Q9GA 3DZMA 3QRAA 4FT6A 3VZUX 4E1TA 2R8AA 3LK3A 3DWNA 4FUVA 2X27X 4N74A 3V8UA 4BUMX 3GP6A 3DA3A 3BRYA 3POUA 4N58A 2R4OA 4AYMC 2R88A 2XG6A 2KDYA 2JQYA 3BS0A 3VZTX 4AZLA 4O3WA 3AAEB 6PRNA 2Y2XA 1ZHZA 4FSPA 3C5OA 2GE4A 3WI4A 2N2MA 4K3BA 3KZIO 5G26A 2XTRA 4PJ0O 4U9CA 2MNHA 4RLBA 4LSFA 1MPFA 4RJWA 4FSOA 4AKRB 2KC0A 4FESA 4AYID 4FMSA 2XMXA 4AYNA 4RJXA 3T20A 2FGRA 2LHFA 4E1SA 3AAEA 2F1TA 4AKMA 1GFPA 1GFMA 1HXUA 5KAIO 5B66O 3FYXA 3POQA 2OMFA 1G90A 4O4UA 2WJRA 2J4UP 1OPFA 2FGQX 2XE3A 4LSIA 1HXTA 4G76A 2ZFGA 4AKRA 2R4PA 4RLCA 2XE5A 4RL9A 4IL6O 4KR8A 2M06A 3AA1B 3PGUA 5AFUL 1S5LO 3PGRA 5DL7A 3VZWX 1BXWA 2Y0KA 4UB6O 3NJTA 1ORMA 2N2LA 4FZLA 5FVNA 4LSEA 2F1VA 5E79O 1MM5A 4C00A 1YS5A 3JTYA 2ERVA 2XE2A 3LK41 3AA1A 3PQSA 3PGSA 5D5DA 2QTKA 4O3XB 1PHOA 3A2SX 2MHLA 4AYDC 5GV0A 2IWWA 5B5EO 4FOZA 4GHBA 2IWVA 2XTQA 2KXPB 3AAAB 4GCPA 2KZ7B 4FZNA 1ZHYA 4O4XA 3BRZA 4XNKA 5GTIO 4AYEC 8PRNA 4XNLA 5EE2A 2JMMA 3RBHA 5GTHO 2WVPA 2AXTO 3HWBA 4FQEA 1PRNA 1T16A 4D65A 4AUIA 1IZNB 4O3YA 4KR4A 2R4NA 3SZDA 5H2FO 5DL5A 4N75A 3VY8X 3AAAA 2KXPA 2ODJA 1GFNA 2KZ7A 2YNKA 3UAQA 1THQA 4C4VB 3SYSA 2W81C 4CTDA 5IYUA 5DL8A 3SY9A 2K4TA 3K19A 3PF1A 2XE1A 4FRXA 4JFBA 3T24A 3TZGA 4C69X 1BT9A 2F1CX 4FRTA 1GFQA 4GCSA 5T5FA 3WI5A 4FZMA 5G38A 3HW9A 2X9KA 4PUXA 3G7GA 1IZNA 1QJPA 3A0HO 3KVDD 3O0EA 3AA6B 1ZHWA 4GF4A 3HOEA 3UPGA 1HXXA 4C4VA 1OSMA 4JCHA 4O3ZA 4D5UA 2W80C 1GFOA 1ZHTA 5AFUK 1QJ9A 4AFKA 3AA0B
chains in the Genus database with same CATH topology
5GTHO 2AXTO 5G39A 4IL6O 5H2FO 1S5LO 5TISO 4UB6O 3WU2O 5G3AA 3KZIO 5E79O 5G38A 4PJ0O 3A0HO 4UB8O 5KAFO 3JCUO 5B5EO 5B66O 5KAIO 5GTIO 3A0BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  2AXT O;  5G39 A;  4IL6 O;  5H2F O;  1S5L O;  5TIS O;  4UB6 O;  3WU2 O;  5G3A A;  3KZI O;  5E79 O;  5G38 A;  4PJ0 O;  3A0H O;  4UB8 O;  5KAF O;  3JCU O;  5B5E O;  5B66 O;  5KAI O;  5GTI O;  3A0B O; 
#chains in the Genus database with same CATH topology
 3VE1 A;  3SYB A;  1Q9F A;  4B61 A;  3POX A;  4O49 A;  3AA6 A;  2LFU A;  3LK4 2;  1MM4 A;  4QQ1 A;  5ADX L;  3POR A;  5G39 A;  3AA7 B;  4LSH A;  2Y0L A;  3HOL A;  1BH3 A;  3T0S A;  1T1L A;  2K0L A;  2Y0H A;  3EMN X;  5TIS O;  7PRN A;  2WJQ A;  4F4B A;  2Y7S A;  2ZLD A;  3LK2 B;  3AA0 A;  1QJ8 A;  2YPV A;  3WU2 O;  4D64 A;  4Z3T A;  5JDP A;  4G75 A;  5G3A A;  3PRN A;  5DL6 A;  4KRA A;  5PRN A;  3LK3 B;  3AA7 A;  3SY7 A;  5KAF O;  4UB8 O;  1E54 A;  3JCU O;  3UU2 A;  2M07 A;  2R4L A;  1H6S 1;  4N59 A;  3VY9 X;  3QRC A;  5ADX K;  3NSG A;  3PQU A;  2R89 A;  3LK2 A;  3DWO X;  3VE2 A;  3DA4 A;  2POR A;  1ZHX A;  4GCQ A;  2PRN A;  2J1N A;  1P4T A;  4PR7 A;  3SZV A;  2O4V A;  3A0B O;  4K3C A;  1Q9G A;  3DZM A;  3QRA A;  4FT6 A;  3VZU X;  4E1T A;  2R8A A;  3LK3 A;  3DWN A;  4FUV A;  2X27 X;  4N74 A;  3V8U A;  4BUM X;  3GP6 A;  3DA3 A;  3BRY A;  3POU A;  4N58 A;  2R4O A;  4AYM C;  2R88 A;  2XG6 A;  2KDY A;  2JQY A;  3BS0 A;  3VZT X;  4AZL A;  4O3W A;  3AAE B;  6PRN A;  2Y2X A;  1ZHZ A;  4FSP A;  3C5O A;  2GE4 A;  3WI4 A;  2N2M A;  4K3B A;  3KZI O;  5G26 A;  2XTR A;  4PJ0 O;  4U9C A;  2MNH A;  4RLB A;  4LSF A;  1MPF A;  4RJW A;  4FSO A;  4AKR B;  2KC0 A;  4FES A;  4AYI D;  4FMS A;  2XMX A;  4AYN A;  4RJX A;  3T20 A;  2FGR A;  2LHF A;  4E1S A;  3AAE A;  2F1T A;  4AKM A;  1GFP A;  1GFM A;  1HXU A;  5KAI O;  5B66 O;  3FYX A;  3POQ A;  2OMF A;  1G90 A;  4O4U A;  2WJR A;  2J4U P;  1OPF A;  2FGQ X;  2XE3 A;  4LSI A;  1HXT A;  4G76 A;  2ZFG A;  4AKR A;  2R4P A;  4RLC A;  2XE5 A;  4RL9 A;  4IL6 O;  4KR8 A;  2M06 A;  3AA1 B;  3PGU A;  5AFU L;  1S5L O;  3PGR A;  5DL7 A;  3VZW X;  1BXW A;  2Y0K A;  4UB6 O;  3NJT A;  1ORM A;  2N2L A;  4FZL A;  5FVN A;  4LSE A;  2F1V A;  5E79 O;  1MM5 A;  4C00 A;  1YS5 A;  3JTY A;  2ERV A;  2XE2 A;  3LK4 1;  3AA1 A;  3PQS A;  3PGS A;  5D5D A;  2QTK A;  4O3X B;  1PHO A;  3A2S X;  2MHL A;  4AYD C;  5GV0 A;  2IWW A;  5B5E O;  4FOZ A;  4GHB A;  2IWV A;  2XTQ A;  2KXP B;  3AAA B;  4GCP A;  2KZ7 B;  4FZN A;  1ZHY A;  4O4X A;  3BRZ A;  4XNK A;  5GTI O;  4AYE C;  8PRN A;  4XNL A;  5EE2 A;  2JMM A;  3RBH A;  5GTH O;  2WVP A;  2AXT O;  3HWB A;  4FQE A;  1PRN A;  1T16 A;  4D65 A;  4AUI A;  1IZN B;  4O3Y A;  4KR4 A;  2R4N A;  3SZD A;  5H2F O;  5DL5 A;  4N75 A;  3VY8 X;  3AAA A;  2KXP A;  2ODJ A;  1GFN A;  2KZ7 A;  2YNK A;  3UAQ A;  1THQ A;  4C4V B;  3SYS A;  2W81 C;  4CTD A;  5IYU A;  5DL8 A;  3SY9 A;  2K4T A;  3K19 A;  3PF1 A;  2XE1 A;  4FRX A;  4JFB A;  3T24 A;  3TZG A;  4C69 X;  1BT9 A;  2F1C X;  4FRT A;  1GFQ A;  4GCS A;  5T5F A;  3WI5 A;  4FZM A;  5G38 A;  3HW9 A;  2X9K A;  4PUX A;  3G7G A;  1IZN A;  1QJP A;  3A0H O;  3KVD D;  3O0E A;  3AA6 B;  1ZHW A;  4GF4 A;  3HOE A;  3UPG A;  1HXX A;  4C4V A;  1OSM A;  4JCH A;  4O3Z A;  4D5U A;  2W80 C;  1GFO A;  1ZHT A;  5AFU K;  1QJ9 A;  4AFK A;  3AA0 B; 
#chains in the Genus database with same CATH homology
 5GTH O;  2AXT O;  5G39 A;  4IL6 O;  5H2F O;  1S5L O;  5TIS O;  4UB6 O;  3WU2 O;  5G3A A;  3KZI O;  5E79 O;  5G38 A;  4PJ0 O;  3A0H O;  4UB8 O;  5KAF O;  3JCU O;  5B5E O;  5B66 O;  5KAI O;  5GTI O;  3A0B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...