1GFNA

Ompf porin deletion (mutant delta 109-114)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
327
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALPYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
total genus 92
structure length 327
sequence length 334
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfnA00
4FOZA 3SYSA 4RJWA 2XE1A 2O4VA 1BT9A 1MPFA 2ZFGA 4FMSA 2Y0LA 5DL6A 3T0SA 1PHOA 4D65A 2Y2XA 3SY7A 3A2SX 4C69X 2ODJA 6PRNA 4RJXA 5DL7A 4D5UA 3O0EA 4JFBA 3K19A 3UU2A 5FVNA 5JDPA 3JTYA 2FGQX 2FGRA 2XE3A 3PORA 4GCQA 3VY8X 3HW9A 4LSHA 3FYXA 3NSGA 4FRXA 2K4TA 1GFQA 1PRNA 3T20A 5DL5A 3POQA 2PORA 4AUIA 8PRNA 3SYBA 1HXXA 2J1NA 1HXTA 4KR8A 3EMNX 4KR4A 3PRNA 1GFOA 4KRAA 3SZDA 4FSPA 1HXUA 1GFMA 2ZLDA 3SY9A 2XG6A 1E54A 1BH3A 3VZTX 2XE5A 4BUMX 2XE2A 4LSEA 2QTKA 5DL8A 1OPFA 2Y0HA 3VZUX 3VY9X 3UPGA 4GCPA 2PRNA 1GFNA 4LSIA 3SZVA 3WI5A 4GCSA 1H6S1 1GFPA 3WI4A 2OMFA 1OSMA 3VZWX 7PRNA 3T24A 3HWBA 4D64A 4FT6A 5PRNA 2J4UP 3POXA 4LSFA 3POUA 4FRTA 2Y0KA 4FSOA
chains in the Genus database with same CATH superfamily
4FOZA 1ZHTA 2JMMA 4FZNA 2WJQA 3SYSA 4B61A 4RJWA 2XMXA 2XE1A 2O4VA 3PGUA 1BT9A 1MPFA 2R4OA 2IWVA 2ZFGA 4FMSA 2KZ7B 2Y0LA 3LK2B 5H2FO 2IWWA 5DL6A 2LHFA 3AA1A 3T0SA 3AA1B 1PHOA 3AA0A 4D65A 3TZGA 3BS0A 2X27X 3VE1A 4O4XA 2Y2XA 3SY7A 2X9KA 1T16A 2ERVA 3A2SX 4RLBA 2AXTO 2ODJA 3UAQA 6PRNA 4FESA 1QJ9A 4RJXA 5AFUK 3JCUO 5DL7A 4D5UA 3O0EA 4JFBA 2JQYA 3AAEB 3KVDD 4FZMA 4O4UA 1MM5A 3K19A 3WU2O 1YS5A 3UU2A 4AYEC 5FVNA 5JDPA 1ZHXA 3JTYA 2MHLA 3LK3A 5T5FA 5GTHO 4N75A 1MM4A 2FGQX 5EE2A 2KXPB 2FGRA 1ORMA 2XE3A 3PORA 4GCQA 3VY8X 4AYMC 1ZHZA 3BRZA 3HW9A 2YNKA 4LSHA 3AAAB 5G3AA 3QRAA 1QJ8A 3FYXA 3NSGA 4U9CA 4FRXA 3LK41 4O49A 3LK3B 3A0HO 2LFUA 3DA3A 4K3CA 4O3YA 3HOEA 3DWNA 2K4TA 2KXPA 1GFQA 1PRNA 4QQ1A 2R4NA 3LK42 3RBHA 3AAAA 2W80C 3T20A 4FQEA 4PUXA 5DL5A 4C4VA 5G39A 2R89A 2M07A 2PORA 3POQA 4AUIA 8PRNA 4G76A 3SYBA 4GF4A 1HXXA 4O3XB 4AZLA 2J1NA 2R8AA 2F1CX 2KZ7A 2KC0A 3LK2A 3PQSA 3DWOX 3PGRA 1HXTA 1IZNB 2N2LA 1ZHYA 4KR8A 5GV0A 3EMNX 4C4VB 4KR4A 4N58A 4C00A 3HOLA 3PRNA 1GFOA 4KRAA 2YPVA 1Q9GA 5KAFO 4FSPA 3SZDA 4AFKA 1Q9FA 2W81C 4AKMA 1HXUA 1GFMA 2ZLDA 2WVPA 2XG6A 3SY9A 1E54A 2R4LA 4UB6O 1IZNA 1BH3A 3VZTX 2XE5A 3AA6B 4GHBA 3AA0B 2F1TA 5GTIO 4FZLA 5TISO 4FUVA 4F4BA 3DZMA 4RLCA 4BUMX 3UPGA 5AFUL 1T1LA 2XE2A 4LSEA 2QTKA 5G38A 3VE2A 3GP6A 1ZHWA 3BRYA 4E1SA 5DL8A 3PQUA 4RL9A 4XNLA 1THQA 2N2MA 4IL6O 1BXWA 2XTQA 4AYDC 1OPFA 5KAIO 2Y0HA 3AA7A 4UB8O 2F1VA 5D5DA 3VZUX 4JCHA 4O3ZA 3VY9X 2PRNA 2KDYA 2WJRA 4GCPA 1GFNA 4E1TA 3A0BO 3AAEA 5E79O 4AYNA 3KZIO 5IYUA 4LSIA 2GE4A 1G90A 3C5OA 3SZVA 3WI5A 3G7GA 3NJTA 4N74A 4GCSA 1QJPA 5B66O 4AYID 1P4TA 3AA7B 2K0LA 1H6S1 4O3WA 5G26A 4K3BA 1GFPA 3WI4A 2XTRA 3V8UA 5ADXK 2OMFA 2Y7SA 4PR7A 1OSMA 2MNHA 4PJ0O 2R4PA 4C69X 3VZWX 7PRNA 3T24A 4CTDA 2M06A 2R88A 3HWBA 4XNKA 4D64A 3QRCA 4G75A 4AKRB 1S5LO 4FT6A 5PRNA 4AKRA 2J4UP 3POXA 5ADXL 4LSFA 3POUA 3AA6A 4FRTA 2Y0KA 3PGSA 3PF1A 3DA4A 4Z3TA 4N59A 4FSOA 5B5EO
chains in the Genus database with same CATH topology
4FOZA 1ZHTA 2JMMA 4FZNA 3SYSA 4B61A 4RJWA 2XMXA 2XE1A 2O4VA 1BT9A 1MPFA 2ZFGA 4FMSA 2KZ7B 2Y0LA 3LK2B 5DL6A 2LHFA 3AA1A 3T0SA 3AA1B 1PHOA 3AA0A 4D65A 3TZGA 2X27X 3VE1A 4O4XA 2Y2XA 3SY7A 3A2SX 2ERVA 4RLBA 3UAQA 4AYMC 4C69X 2ODJA 6PRNA 4FESA 1QJ9A 4RJXA 5DL7A 4D5UA 3O0EA 4JFBA 3AAEB 3KVDD 4FZMA 4O4UA 1MM5A 3K19A 4AYEC 1YS5A 3UU2A 5FVNA 5JDPA 1ZHXA 3JTYA 2MHLA 3LK3A 5T5FA 1MM4A 2FGQX 5EE2A 2KXPB 2FGRA 1ORMA 2XE3A 3PORA 4GCQA 3VY8X 1ZHZA 3HW9A 2YNKA 4LSHA 3AAAB 3QRAA 1QJ8A 3FYXA 3NSGA 4U9CA 4FRXA 3LK41 4O49A 3LK3B 3DA3A 2LFUA 4O3YA 3HOEA 2K4TA 2KXPA 1GFQA 1PRNA 4QQ1A 3LK42 3RBHA 3AAAA 2W80C 3T20A 4PUXA 5DL5A 2M07A 2PORA 3POQA 4AUIA 8PRNA 4G76A 3SYBA 4GF4A 1HXXA 4O3XB 4AZLA 2J1NA 2KZ7A 2KC0A 3LK2A 3PQSA 1HXTA 1IZNB 2N2LA 1ZHYA 4KR8A 5GV0A 3EMNX 4KR4A 4N58A 3HOLA 3PRNA 1GFOA 4KRAA 2YPVA 1Q9GA 3SZDA 4FSPA 4AFKA 1Q9FA 2W81C 4AKMA 1HXUA 1GFMA 2ZLDA 3SY9A 2XG6A 1E54A 1IZNA 1BH3A 3VZTX 2XE5A 3AA6B 4GHBA 3AA0B 2F1TA 4FZLA 4FUVA 4F4BA 4RLCA 4BUMX 3UPGA 5AFUL 2XE2A 4LSEA 2QTKA 3VE2A 3GP6A 1ZHWA 4E1SA 5DL8A 3PQUA 4RL9A 4XNLA 1THQA 2N2MA 1BXWA 2XTQA 4AYDC 1OPFA 2Y0HA 3AA7A 2F1VA 5D5DA 3VZUX 4JCHA 4O3ZA 3VY9X 2PRNA 2KDYA 4GCPA 4E1TA 1GFNA 5AFUK 3AAEA 4AYNA 5IYUA 4LSIA 2GE4A 1G90A 3C5OA 3SZVA 3WI5A 3G7GA 4GCSA 1QJPA 4AYID 1P4TA 3AA7B 2K0LA 1H6S1 4O3WA 5G26A 1GFPA 3WI4A 2XTRA 3V8UA 5ADXK 2OMFA 2Y7SA 1OSMA 2MNHA 3VZWX 7PRNA 3T24A 2M06A 3HWBA 4XNKA 4D64A 3QRCA 4G75A 4AKRB 4FT6A 5PRNA 4AKRA 2J4UP 3POXA 5ADXL 4LSFA 3POUA 3AA6A 4FRTA 2Y0KA 3DA4A 4Z3TA 4N59A 4FSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOZ A;  3SYS A;  4RJW A;  2XE1 A;  2O4V A;  1BT9 A;  1MPF A;  2ZFG A;  4FMS A;  2Y0L A;  5DL6 A;  3T0S A;  1PHO A;  4D65 A;  2Y2X A;  3SY7 A;  3A2S X;  4C69 X;  2ODJ A;  6PRN A;  4RJX A;  5DL7 A;  4D5U A;  3O0E A;  4JFB A;  3K19 A;  3UU2 A;  5FVN A;  5JDP A;  3JTY A;  2FGQ X;  2FGR A;  2XE3 A;  3POR A;  4GCQ A;  3VY8 X;  3HW9 A;  4LSH A;  3FYX A;  3NSG A;  4FRX A;  2K4T A;  1GFQ A;  1PRN A;  3T20 A;  5DL5 A;  3POQ A;  2POR A;  4AUI A;  8PRN A;  3SYB A;  1HXX A;  2J1N A;  1HXT A;  4KR8 A;  3EMN X;  4KR4 A;  3PRN A;  1GFO A;  4KRA A;  3SZD A;  4FSP A;  1HXU A;  1GFM A;  2ZLD A;  3SY9 A;  2XG6 A;  1E54 A;  1BH3 A;  3VZT X;  2XE5 A;  4BUM X;  2XE2 A;  4LSE A;  2QTK A;  5DL8 A;  1OPF A;  2Y0H A;  3VZU X;  3VY9 X;  3UPG A;  4GCP A;  2PRN A;  1GFN A;  4LSI A;  3SZV A;  3WI5 A;  4GCS A;  1H6S 1;  1GFP A;  3WI4 A;  2OMF A;  1OSM A;  3VZW X;  7PRN A;  3T24 A;  3HWB A;  4D64 A;  4FT6 A;  5PRN A;  2J4U P;  3POX A;  4LSF A;  3POU A;  4FRT A;  2Y0K A;  4FSO A; 
#chains in the Genus database with same CATH topology
 4FOZ A;  1ZHT A;  2JMM A;  4FZN A;  2WJQ A;  3SYS A;  4B61 A;  4RJW A;  2XMX A;  2XE1 A;  2O4V A;  3PGU A;  1BT9 A;  1MPF A;  2R4O A;  2IWV A;  2ZFG A;  4FMS A;  2KZ7 B;  2Y0L A;  3LK2 B;  5H2F O;  2IWW A;  5DL6 A;  2LHF A;  3AA1 A;  3T0S A;  3AA1 B;  1PHO A;  3AA0 A;  4D65 A;  3TZG A;  3BS0 A;  2X27 X;  3VE1 A;  4O4X A;  2Y2X A;  3SY7 A;  2X9K A;  1T16 A;  2ERV A;  3A2S X;  4RLB A;  2AXT O;  2ODJ A;  3UAQ A;  6PRN A;  4FES A;  1QJ9 A;  4RJX A;  5AFU K;  3JCU O;  5DL7 A;  4D5U A;  3O0E A;  4JFB A;  2JQY A;  3AAE B;  3KVD D;  4FZM A;  4O4U A;  1MM5 A;  3K19 A;  3WU2 O;  1YS5 A;  3UU2 A;  4AYE C;  5FVN A;  5JDP A;  1ZHX A;  3JTY A;  2MHL A;  3LK3 A;  5T5F A;  5GTH O;  4N75 A;  1MM4 A;  2FGQ X;  5EE2 A;  2KXP B;  2FGR A;  1ORM A;  2XE3 A;  3POR A;  4GCQ A;  3VY8 X;  4AYM C;  1ZHZ A;  3BRZ A;  3HW9 A;  2YNK A;  4LSH A;  3AAA B;  5G3A A;  3QRA A;  1QJ8 A;  3FYX A;  3NSG A;  4U9C A;  4FRX A;  3LK4 1;  4O49 A;  3LK3 B;  3A0H O;  2LFU A;  3DA3 A;  4K3C A;  4O3Y A;  3HOE A;  3DWN A;  2K4T A;  2KXP A;  1GFQ A;  1PRN A;  4QQ1 A;  2R4N A;  3LK4 2;  3RBH A;  3AAA A;  2W80 C;  3T20 A;  4FQE A;  4PUX A;  5DL5 A;  4C4V A;  5G39 A;  2R89 A;  2M07 A;  2POR A;  3POQ A;  4AUI A;  8PRN A;  4G76 A;  3SYB A;  4GF4 A;  1HXX A;  4O3X B;  4AZL A;  2J1N A;  2R8A A;  2F1C X;  2KZ7 A;  2KC0 A;  3LK2 A;  3PQS A;  3DWO X;  3PGR A;  1HXT A;  1IZN B;  2N2L A;  1ZHY A;  4KR8 A;  5GV0 A;  3EMN X;  4C4V B;  4KR4 A;  4N58 A;  4C00 A;  3HOL A;  3PRN A;  1GFO A;  4KRA A;  2YPV A;  1Q9G A;  5KAF O;  4FSP A;  3SZD A;  4AFK A;  1Q9F A;  2W81 C;  4AKM A;  1HXU A;  1GFM A;  2ZLD A;  2WVP A;  2XG6 A;  3SY9 A;  1E54 A;  2R4L A;  4UB6 O;  1IZN A;  1BH3 A;  3VZT X;  2XE5 A;  3AA6 B;  4GHB A;  3AA0 B;  2F1T A;  5GTI O;  4FZL A;  5TIS O;  4FUV A;  4F4B A;  3DZM A;  4RLC A;  4BUM X;  3UPG A;  5AFU L;  1T1L A;  2XE2 A;  4LSE A;  2QTK A;  5G38 A;  3VE2 A;  3GP6 A;  1ZHW A;  3BRY A;  4E1S A;  5DL8 A;  3PQU A;  4RL9 A;  4XNL A;  1THQ A;  2N2M A;  4IL6 O;  1BXW A;  2XTQ A;  4AYD C;  1OPF A;  5KAI O;  2Y0H A;  3AA7 A;  4UB8 O;  2F1V A;  5D5D A;  3VZU X;  4JCH A;  4O3Z A;  3VY9 X;  2PRN A;  2KDY A;  2WJR A;  4GCP A;  1GFN A;  4E1T A;  3A0B O;  3AAE A;  5E79 O;  4AYN A;  3KZI O;  5IYU A;  4LSI A;  2GE4 A;  1G90 A;  3C5O A;  3SZV A;  3WI5 A;  3G7G A;  3NJT A;  4N74 A;  4GCS A;  1QJP A;  5B66 O;  4AYI D;  1P4T A;  3AA7 B;  2K0L A;  1H6S 1;  4O3W A;  5G26 A;  4K3B A;  1GFP A;  3WI4 A;  2XTR A;  3V8U A;  5ADX K;  2OMF A;  2Y7S A;  4PR7 A;  1OSM A;  2MNH A;  4PJ0 O;  2R4P A;  4C69 X;  3VZW X;  7PRN A;  3T24 A;  4CTD A;  2M06 A;  2R88 A;  3HWB A;  4XNK A;  4D64 A;  3QRC A;  4G75 A;  4AKR B;  1S5L O;  4FT6 A;  5PRN A;  4AKR A;  2J4U P;  3POX A;  5ADX L;  4LSF A;  3POU A;  3AA6 A;  4FRT A;  2Y0K A;  3PGS A;  3PF1 A;  3DA4 A;  4Z3T A;  4N59 A;  4FSO A;  5B5E O; 
#chains in the Genus database with same CATH homology
 4FOZ A;  1ZHT A;  2JMM A;  4FZN A;  3SYS A;  4B61 A;  4RJW A;  2XMX A;  2XE1 A;  2O4V A;  1BT9 A;  1MPF A;  2ZFG A;  4FMS A;  2KZ7 B;  2Y0L A;  3LK2 B;  5DL6 A;  2LHF A;  3AA1 A;  3T0S A;  3AA1 B;  1PHO A;  3AA0 A;  4D65 A;  3TZG A;  2X27 X;  3VE1 A;  4O4X A;  2Y2X A;  3SY7 A;  3A2S X;  2ERV A;  4RLB A;  3UAQ A;  4AYM C;  4C69 X;  2ODJ A;  6PRN A;  4FES A;  1QJ9 A;  4RJX A;  5DL7 A;  4D5U A;  3O0E A;  4JFB A;  3AAE B;  3KVD D;  4FZM A;  4O4U A;  1MM5 A;  3K19 A;  4AYE C;  1YS5 A;  3UU2 A;  5FVN A;  5JDP A;  1ZHX A;  3JTY A;  2MHL A;  3LK3 A;  5T5F A;  1MM4 A;  2FGQ X;  5EE2 A;  2KXP B;  2FGR A;  1ORM A;  2XE3 A;  3POR A;  4GCQ A;  3VY8 X;  1ZHZ A;  3HW9 A;  2YNK A;  4LSH A;  3AAA B;  3QRA A;  1QJ8 A;  3FYX A;  3NSG A;  4U9C A;  4FRX A;  3LK4 1;  4O49 A;  3LK3 B;  3DA3 A;  2LFU A;  4O3Y A;  3HOE A;  2K4T A;  2KXP A;  1GFQ A;  1PRN A;  4QQ1 A;  3LK4 2;  3RBH A;  3AAA A;  2W80 C;  3T20 A;  4PUX A;  5DL5 A;  2M07 A;  2POR A;  3POQ A;  4AUI A;  8PRN A;  4G76 A;  3SYB A;  4GF4 A;  1HXX A;  4O3X B;  4AZL A;  2J1N A;  2KZ7 A;  2KC0 A;  3LK2 A;  3PQS A;  1HXT A;  1IZN B;  2N2L A;  1ZHY A;  4KR8 A;  5GV0 A;  3EMN X;  4KR4 A;  4N58 A;  3HOL A;  3PRN A;  1GFO A;  4KRA A;  2YPV A;  1Q9G A;  3SZD A;  4FSP A;  4AFK A;  1Q9F A;  2W81 C;  4AKM A;  1HXU A;  1GFM A;  2ZLD A;  3SY9 A;  2XG6 A;  1E54 A;  1IZN A;  1BH3 A;  3VZT X;  2XE5 A;  3AA6 B;  4GHB A;  3AA0 B;  2F1T A;  4FZL A;  4FUV A;  4F4B A;  4RLC A;  4BUM X;  3UPG A;  5AFU L;  2XE2 A;  4LSE A;  2QTK A;  3VE2 A;  3GP6 A;  1ZHW A;  4E1S A;  5DL8 A;  3PQU A;  4RL9 A;  4XNL A;  1THQ A;  2N2M A;  1BXW A;  2XTQ A;  4AYD C;  1OPF A;  2Y0H A;  3AA7 A;  2F1V A;  5D5D A;  3VZU X;  4JCH A;  4O3Z A;  3VY9 X;  2PRN A;  2KDY A;  4GCP A;  4E1T A;  1GFN A;  5AFU K;  3AAE A;  4AYN A;  5IYU A;  4LSI A;  2GE4 A;  1G90 A;  3C5O A;  3SZV A;  3WI5 A;  3G7G A;  4GCS A;  1QJP A;  4AYI D;  1P4T A;  3AA7 B;  2K0L A;  1H6S 1;  4O3W A;  5G26 A;  1GFP A;  3WI4 A;  2XTR A;  3V8U A;  5ADX K;  2OMF A;  2Y7S A;  1OSM A;  2MNH A;  3VZW X;  7PRN A;  3T24 A;  2M06 A;  3HWB A;  4XNK A;  4D64 A;  3QRC A;  4G75 A;  4AKR B;  4FT6 A;  5PRN A;  4AKR A;  2J4U P;  3POX A;  5ADX L;  4LSF A;  3POU A;  3AA6 A;  4FRT A;  2Y0K A;  3DA4 A;  4Z3T A;  4N59 A;  4FSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...