1GFNA

Ompf porin deletion (mutant delta 109-114)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
327
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALPYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
total genus 92
structure length 327
sequence length 334
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfnA00
2K4TA 3POXA 4LSFA 1GFQA 3UU2A 1GFMA 4D65A 3A2SX 3K19A 3WI4A 4GCPA 2Y0HA 4FT6A 2FGRA 2O4VA 4GCSA 4D64A 2ODJA 2PRNA 3JTYA 4FRXA 4D5UA 2XE3A 2Y2XA 2FGQX 1HXXA 5DL5A 4FRTA 3PORA 5JDPA 3VY9X 3VZWX 1GFPA 1H6S1 4LSHA 3SYBA 3NSGA 4RJWA 4FSOA 5DL6A 1E54A 3SZDA 3T24A 5DL8A 1HXUA 3PRNA 2XE1A 3WI5A 3UPGA 3VZTX 4GCQA 2OMFA 3FYXA 3SY7A 1BH3A 1BT9A 4LSIA 1PHOA 4BUMX 4KR4A 3SZVA 4C69X 3O0EA 1HXTA 2XE5A 2ZLDA 2XG6A 2Y0KA 3EMNX 4FSPA 7PRNA 1MPFA 2J4UP 4JFBA 4AUIA 3POQA 3T20A 3HW9A 1OSMA 3POUA 4LSEA 2QTKA 1GFNA 2J1NA 3VY8X 5PRNA 2XE2A 2Y0LA 4RJXA 8PRNA 3T0SA 1PRNA 3SY9A 5FVNA 3VZUX 3HWBA 1GFOA 2PORA 3SYSA 6PRNA 2ZFGA 4KRAA 5DL7A 4FOZA 1OPFA 4FMSA 4KR8A
chains in the Genus database with same CATH superfamily
1ORMA 1ZHZA 3BRYA 3PF1A 5GV0A 2K4TA 5D5DA 3PGRA 3AA6B 4O4UA 3POXA 4LSFA 1GFQA 1MM5A 1GFMA 2JMMA 3UU2A 4D65A 3AAAA 3A2SX 1G90A 3K19A 3WI4A 3QRCA 4C00A 3KZIO 3DA4A 5AFUL 3BS0A 3LK3B 4GCPA 8PRNA 1T1LA 3AA1A 4AYEC 5AFUK 5IYUA 1P4TA 4O3WA 4XNKA 2N2MA 2Y0HA 4FT6A 4E1TA 2AXTO 3T0SA 2FGRA 3AAAB 5E79O 2O4VA 4QQ1A 4PR7A 4O4XA 4GCSA 3UAQA 4D64A 2ODJA 3AA1B 2PRNA 3JTYA 4FRXA 4AFKA 4E1SA 5G39A 3PGSA 1QJ9A 4D5UA 2XE3A 2Y2XA 2FGQX 4UB8O 1HXXA 5DL5A 3AA7A 3HOEA 2YPVA 3NJTA 4FRTA 1IZNA 4G75A 3PORA 4AYID 1THQA 2X27X 3AA0B 5JDPA 4FUVA 4FZMA 4FQEA 4PJ0O 2XTQA 3GP6A 3PGUA 3VY9X 3VZWX 1GFPA 1H6S1 1T16A 3DWNA 4LSHA 2XMXA 5EE2A 5B5EO 3QRAA 3AA7B 3G7GA 4K3BA 4N58A 4RLBA 3NSGA 3SYBA 5GTIO 1IZNB 2KZ7A 3TZGA 4AKMA 2R88A 4RJWA 5TISO 5ADXL 4FZNA 4FSOA 4AYMC 2MNHA 3LK2A 1E54A 2ERVA 3AA0A 3KVDD 5DL6A 3SZDA 3T24A 5DL8A 4AYDC 1HXUA 3DWOX 3LK41 3PRNA 4C69X 2KZ7B 4G76A 2R8AA 2XE1A 5G26A 3WI5A 1ZHYA 2LFUA 4O3ZA 3UPGA 3VZTX 4GCQA 2R4PA 2M07A 2W81C 2YNKA 3LK2B 5KAIO 2OMFA 2KDYA 3FYXA 3SY7A 1MM4A 4FESA 2M06A 4B61A 5H2FO 1BH3A 1BT9A 3JCUO 4LSIA 4Z3TA 3C5OA 3VE2A 1PHOA 4BUMX 4U9CA 3PQUA 2F1CX 4KR4A 3SZVA 3DA3A 1Q9FA 3PQSA 5T5FA 3V8UA 2K0LA 3O0EA 1HXTA 2XE5A 3VE1A 2ZLDA 2XG6A 2Y0KA 3AAEA 4CTDA 3A0HO 3EMNX 4FSPA 4RL9A 7PRNA 2Y7SA 3A0BO 4PUXA 2LHFA 3WU2O 1MPFA 2J4UP 4O49A 4XNLA 4AYNA 5ADXK 2R4LA 4AKRB 1YS5A 2WJRA 2IWVA 2KC0A 4JFBA 4K3CA 3RBHA 2IWWA 4AUIA 3POQA 1BXWA 3AAEB 4N75A 3HW9A 4O3XB 1OSMA 4AZLA 4C4VA 3POUA 4FZLA 3T20A 2W80C 4LSEA 2XTRA 4GF4A 2WJQA 2QTKA 1ZHTA 1QJ8A 1GFNA 2J1NA 4UB6O 1S5LO 3VY8X 4F4BA 2F1TA 3DZMA 2R89A 2KXPA 2XE2A 1ZHXA 2Y0LA 4RJXA 1QJPA 5PRNA 2GE4A 3HOLA 1PRNA 4IL6O 3SY9A 2N2LA 4N59A 4RLCA 4N74A 2F1VA 2R4OA 2X9KA 3HWBA 5FVNA 3VZUX 4C4VB 1GFOA 4O3YA 2PORA 4AKRA 2R4NA 5B66O 3AA6A 4JCHA 3SYSA 1Q9GA 3LK42 5KAFO 6PRNA 1ZHWA 2ZFGA 4KRAA 5G38A 5DL7A 5GTHO 4FOZA 3BRZA 1OPFA 4FMSA 5G3AA 2KXPB 2MHLA 2JQYA 4GHBA 4KR8A 2WVPA 3LK3A
chains in the Genus database with same CATH topology
1ORMA 1ZHZA 5GV0A 2K4TA 5D5DA 3AA6B 4O4UA 3POXA 4LSFA 1GFQA 1MM5A 1GFMA 2JMMA 3UU2A 4D65A 3AAAA 3A2SX 1G90A 3K19A 3WI4A 3QRCA 3DA4A 5AFUL 3LK3B 4GCPA 8PRNA 3AA1A 4AYEC 5AFUK 5IYUA 1P4TA 4O3WA 4XNKA 2N2MA 2Y0HA 4FT6A 4E1TA 2FGRA 3AAAB 2O4VA 4QQ1A 4O4XA 4GCSA 3UAQA 4D64A 2ODJA 3AA1B 2PRNA 3JTYA 4FRXA 4AFKA 4E1SA 1QJ9A 4D5UA 2XE3A 2Y2XA 2FGQX 1HXXA 5DL5A 3AA7A 3HOEA 2YPVA 4FRTA 1IZNA 4G75A 3PORA 4AYID 1THQA 2X27X 3AA0B 5JDPA 4FUVA 4FZMA 2XTQA 3GP6A 3VY9X 3VZWX 1GFPA 1H6S1 4LSHA 5EE2A 2XMXA 3QRAA 3AA7B 3G7GA 4RLBA 4N58A 3SYBA 3NSGA 3TZGA 1IZNB 2KZ7A 4AKMA 4RJWA 5ADXL 4FZNA 4FSOA 4AYMC 2MNHA 3LK2A 1E54A 2ERVA 3AA0A 3KVDD 5DL6A 3SZDA 3T24A 5DL8A 4AYDC 1HXUA 3LK41 3PRNA 4C69X 2KZ7B 4G76A 2XE1A 5G26A 3WI5A 1ZHYA 2LFUA 4O3ZA 3UPGA 3VZTX 4GCQA 2M07A 2W81C 2YNKA 3LK2B 2OMFA 2KDYA 3FYXA 3SY7A 1MM4A 4FESA 2M06A 4B61A 1BH3A 1BT9A 4LSIA 4Z3TA 3C5OA 3VE2A 1PHOA 4BUMX 4U9CA 3PQUA 4KR4A 3SZVA 3DA3A 1Q9FA 3PQSA 5T5FA 3V8UA 2K0LA 3O0EA 1HXTA 2XE5A 3VE1A 2ZLDA 2XG6A 2Y0KA 3AAEA 3EMNX 4FSPA 4RL9A 7PRNA 2Y7SA 4PUXA 2LHFA 1MPFA 2J4UP 4O49A 4XNLA 4AYNA 5ADXK 4AKRB 1YS5A 2KC0A 4JFBA 3RBHA 4AUIA 3POQA 1BXWA 3AAEB 4O3XB 3HW9A 4AZLA 1OSMA 3T20A 3POUA 4FZLA 2W80C 4LSEA 2XTRA 4GF4A 2QTKA 1ZHTA 1QJ8A 1GFNA 2J1NA 4F4BA 3VY8X 2F1TA 2KXPA 2XE2A 1ZHXA 2Y0LA 4RJXA 1QJPA 5PRNA 2GE4A 3HOLA 1PRNA 3SY9A 3T0SA 2N2LA 4N59A 4RLCA 5FVNA 2F1VA 3VZUX 3HWBA 1GFOA 4O3YA 2PORA 4AKRA 3AA6A 4JCHA 3SYSA 1Q9GA 3LK42 6PRNA 1ZHWA 2ZFGA 4KRAA 5DL7A 4FOZA 1OPFA 4FMSA 2KXPB 2MHLA 4GHBA 4KR8A 3LK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4T A;  3POX A;  4LSF A;  1GFQ A;  3UU2 A;  1GFM A;  4D65 A;  3A2S X;  3K19 A;  3WI4 A;  4GCP A;  2Y0H A;  4FT6 A;  2FGR A;  2O4V A;  4GCS A;  4D64 A;  2ODJ A;  2PRN A;  3JTY A;  4FRX A;  4D5U A;  2XE3 A;  2Y2X A;  2FGQ X;  1HXX A;  5DL5 A;  4FRT A;  3POR A;  5JDP A;  3VY9 X;  3VZW X;  1GFP A;  1H6S 1;  4LSH A;  3SYB A;  3NSG A;  4RJW A;  4FSO A;  5DL6 A;  1E54 A;  3SZD A;  3T24 A;  5DL8 A;  1HXU A;  3PRN A;  2XE1 A;  3WI5 A;  3UPG A;  3VZT X;  4GCQ A;  2OMF A;  3FYX A;  3SY7 A;  1BH3 A;  1BT9 A;  4LSI A;  1PHO A;  4BUM X;  4KR4 A;  3SZV A;  4C69 X;  3O0E A;  1HXT A;  2XE5 A;  2ZLD A;  2XG6 A;  2Y0K A;  3EMN X;  4FSP A;  7PRN A;  1MPF A;  2J4U P;  4JFB A;  4AUI A;  3POQ A;  3T20 A;  3HW9 A;  1OSM A;  3POU A;  4LSE A;  2QTK A;  1GFN A;  2J1N A;  3VY8 X;  5PRN A;  2XE2 A;  2Y0L A;  4RJX A;  8PRN A;  3T0S A;  1PRN A;  3SY9 A;  5FVN A;  3VZU X;  3HWB A;  1GFO A;  2POR A;  3SYS A;  6PRN A;  2ZFG A;  4KRA A;  5DL7 A;  4FOZ A;  1OPF A;  4FMS A;  4KR8 A; 
#chains in the Genus database with same CATH topology
 1ORM A;  1ZHZ A;  3BRY A;  3PF1 A;  5GV0 A;  2K4T A;  5D5D A;  3PGR A;  3AA6 B;  4O4U A;  3POX A;  4LSF A;  1GFQ A;  1MM5 A;  1GFM A;  2JMM A;  3UU2 A;  4D65 A;  3AAA A;  3A2S X;  1G90 A;  3K19 A;  3WI4 A;  3QRC A;  4C00 A;  3KZI O;  3DA4 A;  5AFU L;  3BS0 A;  3LK3 B;  4GCP A;  8PRN A;  1T1L A;  3AA1 A;  4AYE C;  5AFU K;  5IYU A;  1P4T A;  4O3W A;  4XNK A;  2N2M A;  2Y0H A;  4FT6 A;  4E1T A;  2AXT O;  3T0S A;  2FGR A;  3AAA B;  5E79 O;  2O4V A;  4QQ1 A;  4PR7 A;  4O4X A;  4GCS A;  3UAQ A;  4D64 A;  2ODJ A;  3AA1 B;  2PRN A;  3JTY A;  4FRX A;  4AFK A;  4E1S A;  5G39 A;  3PGS A;  1QJ9 A;  4D5U A;  2XE3 A;  2Y2X A;  2FGQ X;  4UB8 O;  1HXX A;  5DL5 A;  3AA7 A;  3HOE A;  2YPV A;  3NJT A;  4FRT A;  1IZN A;  4G75 A;  3POR A;  4AYI D;  1THQ A;  2X27 X;  3AA0 B;  5JDP A;  4FUV A;  4FZM A;  4FQE A;  4PJ0 O;  2XTQ A;  3GP6 A;  3PGU A;  3VY9 X;  3VZW X;  1GFP A;  1H6S 1;  1T16 A;  3DWN A;  4LSH A;  2XMX A;  5EE2 A;  5B5E O;  3QRA A;  3AA7 B;  3G7G A;  4K3B A;  4N58 A;  4RLB A;  3NSG A;  3SYB A;  5GTI O;  1IZN B;  2KZ7 A;  3TZG A;  4AKM A;  2R88 A;  4RJW A;  5TIS O;  5ADX L;  4FZN A;  4FSO A;  4AYM C;  2MNH A;  3LK2 A;  1E54 A;  2ERV A;  3AA0 A;  3KVD D;  5DL6 A;  3SZD A;  3T24 A;  5DL8 A;  4AYD C;  1HXU A;  3DWO X;  3LK4 1;  3PRN A;  4C69 X;  2KZ7 B;  4G76 A;  2R8A A;  2XE1 A;  5G26 A;  3WI5 A;  1ZHY A;  2LFU A;  4O3Z A;  3UPG A;  3VZT X;  4GCQ A;  2R4P A;  2M07 A;  2W81 C;  2YNK A;  3LK2 B;  5KAI O;  2OMF A;  2KDY A;  3FYX A;  3SY7 A;  1MM4 A;  4FES A;  2M06 A;  4B61 A;  5H2F O;  1BH3 A;  1BT9 A;  3JCU O;  4LSI A;  4Z3T A;  3C5O A;  3VE2 A;  1PHO A;  4BUM X;  4U9C A;  3PQU A;  2F1C X;  4KR4 A;  3SZV A;  3DA3 A;  1Q9F A;  3PQS A;  5T5F A;  3V8U A;  2K0L A;  3O0E A;  1HXT A;  2XE5 A;  3VE1 A;  2ZLD A;  2XG6 A;  2Y0K A;  3AAE A;  4CTD A;  3A0H O;  3EMN X;  4FSP A;  4RL9 A;  7PRN A;  2Y7S A;  3A0B O;  4PUX A;  2LHF A;  3WU2 O;  1MPF A;  2J4U P;  4O49 A;  4XNL A;  4AYN A;  5ADX K;  2R4L A;  4AKR B;  1YS5 A;  2WJR A;  2IWV A;  2KC0 A;  4JFB A;  4K3C A;  3RBH A;  2IWW A;  4AUI A;  3POQ A;  1BXW A;  3AAE B;  4N75 A;  3HW9 A;  4O3X B;  1OSM A;  4AZL A;  4C4V A;  3POU A;  4FZL A;  3T20 A;  2W80 C;  4LSE A;  2XTR A;  4GF4 A;  2WJQ A;  2QTK A;  1ZHT A;  1QJ8 A;  1GFN A;  2J1N A;  4UB6 O;  1S5L O;  3VY8 X;  4F4B A;  2F1T A;  3DZM A;  2R89 A;  2KXP A;  2XE2 A;  1ZHX A;  2Y0L A;  4RJX A;  1QJP A;  5PRN A;  2GE4 A;  3HOL A;  1PRN A;  4IL6 O;  3SY9 A;  2N2L A;  4N59 A;  4RLC A;  4N74 A;  2F1V A;  2R4O A;  2X9K A;  3HWB A;  5FVN A;  3VZU X;  4C4V B;  1GFO A;  4O3Y A;  2POR A;  4AKR A;  2R4N A;  5B66 O;  3AA6 A;  4JCH A;  3SYS A;  1Q9G A;  3LK4 2;  5KAF O;  6PRN A;  1ZHW A;  2ZFG A;  4KRA A;  5G38 A;  5DL7 A;  5GTH O;  4FOZ A;  3BRZ A;  1OPF A;  4FMS A;  5G3A A;  2KXP B;  2MHL A;  2JQY A;  4GHB A;  4KR8 A;  2WVP A;  3LK3 A; 
#chains in the Genus database with same CATH homology
 1ORM A;  1ZHZ A;  5GV0 A;  2K4T A;  5D5D A;  3AA6 B;  4O4U A;  3POX A;  4LSF A;  1GFQ A;  1MM5 A;  1GFM A;  2JMM A;  3UU2 A;  4D65 A;  3AAA A;  3A2S X;  1G90 A;  3K19 A;  3WI4 A;  3QRC A;  3DA4 A;  5AFU L;  3LK3 B;  4GCP A;  8PRN A;  3AA1 A;  4AYE C;  5AFU K;  5IYU A;  1P4T A;  4O3W A;  4XNK A;  2N2M A;  2Y0H A;  4FT6 A;  4E1T A;  2FGR A;  3AAA B;  2O4V A;  4QQ1 A;  4O4X A;  4GCS A;  3UAQ A;  4D64 A;  2ODJ A;  3AA1 B;  2PRN A;  3JTY A;  4FRX A;  4AFK A;  4E1S A;  1QJ9 A;  4D5U A;  2XE3 A;  2Y2X A;  2FGQ X;  1HXX A;  5DL5 A;  3AA7 A;  3HOE A;  2YPV A;  4FRT A;  1IZN A;  4G75 A;  3POR A;  4AYI D;  1THQ A;  2X27 X;  3AA0 B;  5JDP A;  4FUV A;  4FZM A;  2XTQ A;  3GP6 A;  3VY9 X;  3VZW X;  1GFP A;  1H6S 1;  4LSH A;  5EE2 A;  2XMX A;  3QRA A;  3AA7 B;  3G7G A;  4RLB A;  4N58 A;  3SYB A;  3NSG A;  3TZG A;  1IZN B;  2KZ7 A;  4AKM A;  4RJW A;  5ADX L;  4FZN A;  4FSO A;  4AYM C;  2MNH A;  3LK2 A;  1E54 A;  2ERV A;  3AA0 A;  3KVD D;  5DL6 A;  3SZD A;  3T24 A;  5DL8 A;  4AYD C;  1HXU A;  3LK4 1;  3PRN A;  4C69 X;  2KZ7 B;  4G76 A;  2XE1 A;  5G26 A;  3WI5 A;  1ZHY A;  2LFU A;  4O3Z A;  3UPG A;  3VZT X;  4GCQ A;  2M07 A;  2W81 C;  2YNK A;  3LK2 B;  2OMF A;  2KDY A;  3FYX A;  3SY7 A;  1MM4 A;  4FES A;  2M06 A;  4B61 A;  1BH3 A;  1BT9 A;  4LSI A;  4Z3T A;  3C5O A;  3VE2 A;  1PHO A;  4BUM X;  4U9C A;  3PQU A;  4KR4 A;  3SZV A;  3DA3 A;  1Q9F A;  3PQS A;  5T5F A;  3V8U A;  2K0L A;  3O0E A;  1HXT A;  2XE5 A;  3VE1 A;  2ZLD A;  2XG6 A;  2Y0K A;  3AAE A;  3EMN X;  4FSP A;  4RL9 A;  7PRN A;  2Y7S A;  4PUX A;  2LHF A;  1MPF A;  2J4U P;  4O49 A;  4XNL A;  4AYN A;  5ADX K;  4AKR B;  1YS5 A;  2KC0 A;  4JFB A;  3RBH A;  4AUI A;  3POQ A;  1BXW A;  3AAE B;  4O3X B;  3HW9 A;  4AZL A;  1OSM A;  3T20 A;  3POU A;  4FZL A;  2W80 C;  4LSE A;  2XTR A;  4GF4 A;  2QTK A;  1ZHT A;  1QJ8 A;  1GFN A;  2J1N A;  4F4B A;  3VY8 X;  2F1T A;  2KXP A;  2XE2 A;  1ZHX A;  2Y0L A;  4RJX A;  1QJP A;  5PRN A;  2GE4 A;  3HOL A;  1PRN A;  3SY9 A;  3T0S A;  2N2L A;  4N59 A;  4RLC A;  5FVN A;  2F1V A;  3VZU X;  3HWB A;  1GFO A;  4O3Y A;  2POR A;  4AKR A;  3AA6 A;  4JCH A;  3SYS A;  1Q9G A;  3LK4 2;  6PRN A;  1ZHW A;  2ZFG A;  4KRA A;  5DL7 A;  4FOZ A;  1OPF A;  4FMS A;  2KXP B;  2MHL A;  4GHB A;  4KR8 A;  3LK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...