1GFNA

Ompf porin deletion (mutant delta 109-114)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
327
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALPYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transmembrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 327
sequence length 334
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfnA00
4LSIA 2O4VA 1GFQA 4KR8A 2ZFGA 3FYXA 4LSEA 2XE5A 2PRNA 2QTKA 1BT9A 5DL5A 4D65A 1HXXA 1PHOA 7PRNA 3O0EA 1BH3A 4KR4A 3PRNA 4JFBA 4GCQA 5JDPA 3T20A 3SYSA 3POQA 2ODJA 2ZLDA 2XE2A 4LSHA 4D5UA 3WI5A 1GFNA 2Y0HA 3JTYA 2FGRA 3SY7A 1HXTA 5DL6A 3SY9A 3SZDA 1MPFA 2Y0LA 3VZTX 2FGQX 2XE1A 3PORA 4BUMX 3SYBA 3NSGA 1OSMA 3POUA 4GCPA 2Y0KA 4RJXA 3T24A 4RJWA 4KRAA 1E54A 1GFPA 5PRNA 2XE3A 3VY8X 4FT6A 2PORA 2K4TA 2OMFA 4FRTA 3K19A 3VZUX 1HXUA 4FRXA 6PRNA 3VZWX 3EMNX 3WI4A 4D64A 4FSOA 1PRNA 2J4UP 3A2SX 3UPGA 3HW9A 4FMSA 3SZVA 8PRNA 4LSFA 5DL7A 3POXA 3VY9X 3T0SA 4C69X 3UU2A 2J1NA 5DL8A 5FVNA 1OPFA 2XG6A 2Y2XA 4GCSA 1H6S1 4FSPA 1GFMA 3HWBA 4FOZA 4AUIA 1GFOA
chains in the Genus database with same CATH superfamily
1ORMA 3AAAA 4LSIA 5AFUK 2R88A 4O3ZA 2O4VA 1GFQA 3UAQA 5B5EO 3AA0B 4KR8A 4B61A 5ADXK 4IL6O 4AYID 4K3CA 2F1VA 2ZFGA 2X9KA 3DA4A 3FYXA 4LSEA 3VE1A 4XNLA 3JCUO 2XMXA 2XTRA 1IZNB 1MM5A 3A0HO 3NJTA 2XE5A 1ZHWA 2ERVA 3LK3A 3LK2A 2PRNA 2QTKA 4QQ1A 1BT9A 4PUXA 5DL5A 4D65A 1HXXA 3AAAB 4AYMC 1PHOA 4GHBA 7PRNA 2N2MA 2KXPA 3O0EA 1BH3A 2F1TA 3QRAA 4KR4A 5GTIO 4AFKA 3PRNA 5H2FO 4JFBA 3DWNA 2LHFA 3LK41 4O4UA 4UB8O 1ZHYA 4GCQA 4O4XA 5EE2A 3LK3B 2JMMA 3LK2B 3SYSA 4Z3TA 3POQA 5JDPA 3T20A 2ODJA 2MHLA 2ZLDA 2IWVA 2XE2A 3DZMA 3DWOX 2R8AA 3AA7A 1ZHZA 3DA3A 4LSHA 2R4NA 4D5UA 3WI5A 1GFNA 2Y0HA 4N59A 3JTYA 2FGRA 2KXPB 4FZNA 1HXTA 3G7GA 4JCHA 5DL6A 3SY7A 2KDYA 3SY9A 5E79O 3SZDA 1MPFA 1ZHTA 5KAIO 2XTQA 2R4LA 2Y0LA 1QJ9A 1THQA 2Y7SA 4AKMA 3VZTX 5T5FA 4N74A 2M06A 2FGQX 4AZLA 3AA7B 3AAEA 2XE1A 5G26A 1T16A 3PGUA 4PJ0O 4G76A 2W81C 3GP6A 4FQEA 4AYEC 3PORA 2LFUA 4BUMX 3SYBA 3VE2A 1QJPA 4C4VA 3C5OA 2AXTO 3NSGA 3BRZA 2KZ7A 4XNKA 4AYDC 1OSMA 2JQYA 3POUA 4GCPA 2Y0KA 4RJXA 3T24A 4RJWA 2WJRA 3AAEB 1ZHXA 4KRAA 4FUVA 1E54A 3PF1A 3PGRA 5IYUA 5G3AA 4FZMA 1GFPA 1YS5A 3QRCA 4O49A 3PQSA 4FZLA 4C4VB 5PRNA 4O3WA 2KZ7B 5B66O 2XE3A 3VY8X 3KZIO 4FT6A 2PORA 2YNKA 3KVDD 2K4TA 2W80C 4PR7A 2OMFA 4FRTA 5G39A 2YPVA 2GE4A 3K19A 4C00A 3VZUX 1HXUA 4FRXA 6PRNA 2WJQA 3A0BO 1MM4A 3EMNX 3VZWX 5AFUL 3AA1A 4RL9A 2R89A 5ADXL 3WI4A 2WVPA 4D64A 1S5LO 4FSOA 5GTHO 4GF4A 1PRNA 4E1SA 2J4UP 1T1LA 3A2SX 4N75A 3V8UA 3UPGA 3HOEA 3HW9A 4AKRA 1G90A 2KC0A 4FMSA 2K0LA 3BS0A 4E1TA 4RLCA 4U9CA 2R4PA 3SZVA 3AA6A 8PRNA 4LSFA 5DL7A 1Q9FA 5KAFO 4O3XB 3AA1B 3POXA 4FESA 5G38A 3VY9X 3TZGA 3HOLA 3RBHA 4G75A 1P4TA 5GV0A 1BXWA 2M07A 2F1CX 3T0SA 4RLBA 5D5DA 4AKRB 4C69X 3UU2A 2R4OA 2J1NA 2N2LA 5DL8A 4O3YA 3PGSA 3AA6B 4UB6O 5FVNA 1OPFA 2XG6A 1Q9GA 2X27X 2Y2XA 3AA0A 4GCSA 4K3BA 5TISO 1H6S1 4FSPA 3PQUA 4CTDA 3BRYA 1GFMA 3HWBA 2IWWA 2MNHA 3LK42 3WU2O 1IZNA 4N58A 4FOZA 4F4BA 4AUIA 1GFOA 1QJ8A 4AYNA
chains in the Genus database with same CATH topology
1ORMA 3AAAA 4LSIA 5AFUK 3UAQA 4O3ZA 2O4VA 1GFQA 5ADXK 3AA0B 4KR8A 4B61A 4AYID 2F1VA 2ZFGA 3DA4A 3FYXA 4LSEA 3VE1A 4XNLA 2XMXA 2XTRA 1IZNB 1MM5A 2XE5A 1ZHWA 2ERVA 3LK3A 3LK2A 2PRNA 2QTKA 4QQ1A 1BT9A 4PUXA 5DL5A 4D65A 1HXXA 3AAAB 4AYMC 1PHOA 4GHBA 7PRNA 2N2MA 2KXPA 3O0EA 1BH3A 2F1TA 3QRAA 4KR4A 4AFKA 3PRNA 4JFBA 3LK41 2LHFA 4O4UA 5EE2A 1ZHYA 4GCQA 4O4XA 5JDPA 3LK3B 2JMMA 3LK2B 3SYSA 4Z3TA 3POQA 3T20A 2ODJA 2MHLA 2ZLDA 2XE2A 3AA7A 3DA3A 1ZHZA 4LSHA 4D5UA 3WI5A 1GFNA 2Y0HA 4N59A 3JTYA 2FGRA 2KXPB 4FZNA 1HXTA 3G7GA 4JCHA 5DL6A 3SY7A 2KDYA 3SY9A 3SZDA 1MPFA 1ZHTA 2XTQA 2Y0LA 1QJ9A 1THQA 2Y7SA 4AKMA 3VZTX 5T5FA 2M06A 2FGQX 4AZLA 3AA7B 3AAEA 2XE1A 5G26A 4G76A 2W81C 3GP6A 4AYEC 3PORA 2LFUA 4BUMX 3SYBA 3VE2A 1QJPA 3C5OA 3NSGA 4XNKA 2KZ7A 4AYDC 1OSMA 3POUA 4GCPA 2Y0KA 4RJXA 3T24A 4RJWA 3AAEB 1ZHXA 4KRAA 4FUVA 1E54A 5IYUA 4FZMA 1GFPA 1YS5A 3QRCA 4O49A 3PQSA 4FZLA 5PRNA 4O3WA 2KZ7B 2XE3A 3VY8X 4FT6A 2PORA 2YNKA 3KVDD 2K4TA 2W80C 2OMFA 4FRTA 2YPVA 2GE4A 3K19A 3VZUX 1HXUA 4FRXA 6PRNA 3VZWX 3EMNX 1MM4A 5AFUL 3AA1A 4RL9A 5ADXL 3WI4A 4D64A 4FSOA 4GF4A 1PRNA 4E1SA 2J4UP 3A2SX 3V8UA 3UPGA 3HOEA 3HW9A 4AKRA 1G90A 2KC0A 4FMSA 2K0LA 4E1TA 4RLCA 4U9CA 3SZVA 8PRNA 3AA6A 4LSFA 5DL7A 1Q9FA 4O3XB 3AA1B 3POXA 4FESA 3VY9X 3TZGA 3HOLA 3RBHA 4G75A 1P4TA 5GV0A 1BXWA 2M07A 3T0SA 4RLBA 5D5DA 4AKRB 4C69X 3UU2A 2J1NA 2N2LA 5DL8A 4O3YA 3AA6B 5FVNA 1OPFA 2XG6A 1Q9GA 2X27X 2Y2XA 3AA0A 4GCSA 1H6S1 4FSPA 3PQUA 1GFMA 3HWBA 2MNHA 3LK42 1IZNA 4N58A 4FOZA 4F4BA 4AUIA 1GFOA 1QJ8A 4AYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSI A;  2O4V A;  1GFQ A;  4KR8 A;  2ZFG A;  3FYX A;  4LSE A;  2XE5 A;  2PRN A;  2QTK A;  1BT9 A;  5DL5 A;  4D65 A;  1HXX A;  1PHO A;  7PRN A;  3O0E A;  1BH3 A;  4KR4 A;  3PRN A;  4JFB A;  4GCQ A;  5JDP A;  3T20 A;  3SYS A;  3POQ A;  2ODJ A;  2ZLD A;  2XE2 A;  4LSH A;  4D5U A;  3WI5 A;  1GFN A;  2Y0H A;  3JTY A;  2FGR A;  3SY7 A;  1HXT A;  5DL6 A;  3SY9 A;  3SZD A;  1MPF A;  2Y0L A;  3VZT X;  2FGQ X;  2XE1 A;  3POR A;  4BUM X;  3SYB A;  3NSG A;  1OSM A;  3POU A;  4GCP A;  2Y0K A;  4RJX A;  3T24 A;  4RJW A;  4KRA A;  1E54 A;  1GFP A;  5PRN A;  2XE3 A;  3VY8 X;  4FT6 A;  2POR A;  2K4T A;  2OMF A;  4FRT A;  3K19 A;  3VZU X;  1HXU A;  4FRX A;  6PRN A;  3VZW X;  3EMN X;  3WI4 A;  4D64 A;  4FSO A;  1PRN A;  2J4U P;  3A2S X;  3UPG A;  3HW9 A;  4FMS A;  3SZV A;  8PRN A;  4LSF A;  5DL7 A;  3POX A;  3VY9 X;  3T0S A;  4C69 X;  3UU2 A;  2J1N A;  5DL8 A;  5FVN A;  1OPF A;  2XG6 A;  2Y2X A;  4GCS A;  1H6S 1;  4FSP A;  1GFM A;  3HWB A;  4FOZ A;  4AUI A;  1GFO A; 
#chains in the Genus database with same CATH topology
 1ORM A;  3AAA A;  4LSI A;  5AFU K;  2R88 A;  4O3Z A;  2O4V A;  1GFQ A;  3UAQ A;  5B5E O;  3AA0 B;  4KR8 A;  4B61 A;  5ADX K;  4IL6 O;  4AYI D;  4K3C A;  2F1V A;  2ZFG A;  2X9K A;  3DA4 A;  3FYX A;  4LSE A;  3VE1 A;  4XNL A;  3JCU O;  2XMX A;  2XTR A;  1IZN B;  1MM5 A;  3A0H O;  3NJT A;  2XE5 A;  1ZHW A;  2ERV A;  3LK3 A;  3LK2 A;  2PRN A;  2QTK A;  4QQ1 A;  1BT9 A;  4PUX A;  5DL5 A;  4D65 A;  1HXX A;  3AAA B;  4AYM C;  1PHO A;  4GHB A;  7PRN A;  2N2M A;  2KXP A;  3O0E A;  1BH3 A;  2F1T A;  3QRA A;  4KR4 A;  5GTI O;  4AFK A;  3PRN A;  5H2F O;  4JFB A;  3DWN A;  2LHF A;  3LK4 1;  4O4U A;  4UB8 O;  1ZHY A;  4GCQ A;  4O4X A;  5EE2 A;  3LK3 B;  2JMM A;  3LK2 B;  3SYS A;  4Z3T A;  3POQ A;  5JDP A;  3T20 A;  2ODJ A;  2MHL A;  2ZLD A;  2IWV A;  2XE2 A;  3DZM A;  3DWO X;  2R8A A;  3AA7 A;  1ZHZ A;  3DA3 A;  4LSH A;  2R4N A;  4D5U A;  3WI5 A;  1GFN A;  2Y0H A;  4N59 A;  3JTY A;  2FGR A;  2KXP B;  4FZN A;  1HXT A;  3G7G A;  4JCH A;  5DL6 A;  3SY7 A;  2KDY A;  3SY9 A;  5E79 O;  3SZD A;  1MPF A;  1ZHT A;  5KAI O;  2XTQ A;  2R4L A;  2Y0L A;  1QJ9 A;  1THQ A;  2Y7S A;  4AKM A;  3VZT X;  5T5F A;  4N74 A;  2M06 A;  2FGQ X;  4AZL A;  3AA7 B;  3AAE A;  2XE1 A;  5G26 A;  1T16 A;  3PGU A;  4PJ0 O;  4G76 A;  2W81 C;  3GP6 A;  4FQE A;  4AYE C;  3POR A;  2LFU A;  4BUM X;  3SYB A;  3VE2 A;  1QJP A;  4C4V A;  3C5O A;  2AXT O;  3NSG A;  3BRZ A;  2KZ7 A;  4XNK A;  4AYD C;  1OSM A;  2JQY A;  3POU A;  4GCP A;  2Y0K A;  4RJX A;  3T24 A;  4RJW A;  2WJR A;  3AAE B;  1ZHX A;  4KRA A;  4FUV A;  1E54 A;  3PF1 A;  3PGR A;  5IYU A;  5G3A A;  4FZM A;  1GFP A;  1YS5 A;  3QRC A;  4O49 A;  3PQS A;  4FZL A;  4C4V B;  5PRN A;  4O3W A;  2KZ7 B;  5B66 O;  2XE3 A;  3VY8 X;  3KZI O;  4FT6 A;  2POR A;  2YNK A;  3KVD D;  2K4T A;  2W80 C;  4PR7 A;  2OMF A;  4FRT A;  5G39 A;  2YPV A;  2GE4 A;  3K19 A;  4C00 A;  3VZU X;  1HXU A;  4FRX A;  6PRN A;  2WJQ A;  3A0B O;  1MM4 A;  3EMN X;  3VZW X;  5AFU L;  3AA1 A;  4RL9 A;  2R89 A;  5ADX L;  3WI4 A;  2WVP A;  4D64 A;  1S5L O;  4FSO A;  5GTH O;  4GF4 A;  1PRN A;  4E1S A;  2J4U P;  1T1L A;  3A2S X;  4N75 A;  3V8U A;  3UPG A;  3HOE A;  3HW9 A;  4AKR A;  1G90 A;  2KC0 A;  4FMS A;  2K0L A;  3BS0 A;  4E1T A;  4RLC A;  4U9C A;  2R4P A;  3SZV A;  3AA6 A;  8PRN A;  4LSF A;  5DL7 A;  1Q9F A;  5KAF O;  4O3X B;  3AA1 B;  3POX A;  4FES A;  5G38 A;  3VY9 X;  3TZG A;  3HOL A;  3RBH A;  4G75 A;  1P4T A;  5GV0 A;  1BXW A;  2M07 A;  2F1C X;  3T0S A;  4RLB A;  5D5D A;  4AKR B;  4C69 X;  3UU2 A;  2R4O A;  2J1N A;  2N2L A;  5DL8 A;  4O3Y A;  3PGS A;  3AA6 B;  4UB6 O;  5FVN A;  1OPF A;  2XG6 A;  1Q9G A;  2X27 X;  2Y2X A;  3AA0 A;  4GCS A;  4K3B A;  5TIS O;  1H6S 1;  4FSP A;  3PQU A;  4CTD A;  3BRY A;  1GFM A;  3HWB A;  2IWW A;  2MNH A;  3LK4 2;  3WU2 O;  1IZN A;  4N58 A;  4FOZ A;  4F4B A;  4AUI A;  1GFO A;  1QJ8 A;  4AYN A; 
#chains in the Genus database with same CATH homology
 1ORM A;  3AAA A;  4LSI A;  5AFU K;  3UAQ A;  4O3Z A;  2O4V A;  1GFQ A;  5ADX K;  3AA0 B;  4KR8 A;  4B61 A;  4AYI D;  2F1V A;  2ZFG A;  3DA4 A;  3FYX A;  4LSE A;  3VE1 A;  4XNL A;  2XMX A;  2XTR A;  1IZN B;  1MM5 A;  2XE5 A;  1ZHW A;  2ERV A;  3LK3 A;  3LK2 A;  2PRN A;  2QTK A;  4QQ1 A;  1BT9 A;  4PUX A;  5DL5 A;  4D65 A;  1HXX A;  3AAA B;  4AYM C;  1PHO A;  4GHB A;  7PRN A;  2N2M A;  2KXP A;  3O0E A;  1BH3 A;  2F1T A;  3QRA A;  4KR4 A;  4AFK A;  3PRN A;  4JFB A;  3LK4 1;  2LHF A;  4O4U A;  5EE2 A;  1ZHY A;  4GCQ A;  4O4X A;  5JDP A;  3LK3 B;  2JMM A;  3LK2 B;  3SYS A;  4Z3T A;  3POQ A;  3T20 A;  2ODJ A;  2MHL A;  2ZLD A;  2XE2 A;  3AA7 A;  3DA3 A;  1ZHZ A;  4LSH A;  4D5U A;  3WI5 A;  1GFN A;  2Y0H A;  4N59 A;  3JTY A;  2FGR A;  2KXP B;  4FZN A;  1HXT A;  3G7G A;  4JCH A;  5DL6 A;  3SY7 A;  2KDY A;  3SY9 A;  3SZD A;  1MPF A;  1ZHT A;  2XTQ A;  2Y0L A;  1QJ9 A;  1THQ A;  2Y7S A;  4AKM A;  3VZT X;  5T5F A;  2M06 A;  2FGQ X;  4AZL A;  3AA7 B;  3AAE A;  2XE1 A;  5G26 A;  4G76 A;  2W81 C;  3GP6 A;  4AYE C;  3POR A;  2LFU A;  4BUM X;  3SYB A;  3VE2 A;  1QJP A;  3C5O A;  3NSG A;  4XNK A;  2KZ7 A;  4AYD C;  1OSM A;  3POU A;  4GCP A;  2Y0K A;  4RJX A;  3T24 A;  4RJW A;  3AAE B;  1ZHX A;  4KRA A;  4FUV A;  1E54 A;  5IYU A;  4FZM A;  1GFP A;  1YS5 A;  3QRC A;  4O49 A;  3PQS A;  4FZL A;  5PRN A;  4O3W A;  2KZ7 B;  2XE3 A;  3VY8 X;  4FT6 A;  2POR A;  2YNK A;  3KVD D;  2K4T A;  2W80 C;  2OMF A;  4FRT A;  2YPV A;  2GE4 A;  3K19 A;  3VZU X;  1HXU A;  4FRX A;  6PRN A;  3VZW X;  3EMN X;  1MM4 A;  5AFU L;  3AA1 A;  4RL9 A;  5ADX L;  3WI4 A;  4D64 A;  4FSO A;  4GF4 A;  1PRN A;  4E1S A;  2J4U P;  3A2S X;  3V8U A;  3UPG A;  3HOE A;  3HW9 A;  4AKR A;  1G90 A;  2KC0 A;  4FMS A;  2K0L A;  4E1T A;  4RLC A;  4U9C A;  3SZV A;  8PRN A;  3AA6 A;  4LSF A;  5DL7 A;  1Q9F A;  4O3X B;  3AA1 B;  3POX A;  4FES A;  3VY9 X;  3TZG A;  3HOL A;  3RBH A;  4G75 A;  1P4T A;  5GV0 A;  1BXW A;  2M07 A;  3T0S A;  4RLB A;  5D5D A;  4AKR B;  4C69 X;  3UU2 A;  2J1N A;  2N2L A;  5DL8 A;  4O3Y A;  3AA6 B;  5FVN A;  1OPF A;  2XG6 A;  1Q9G A;  2X27 X;  2Y2X A;  3AA0 A;  4GCS A;  1H6S 1;  4FSP A;  3PQU A;  1GFM A;  3HWB A;  2MNH A;  3LK4 2;  1IZN A;  4N58 A;  4FOZ A;  4F4B A;  4AUI A;  1GFO A;  1QJ8 A;  4AYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...