1GFNA

Ompf porin deletion (mutant delta 109-114)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
327
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALPYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
total genus 92
structure length 327
sequence length 334
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfnA00
2ZFGA 4GCQA 1HXUA 3VZTX 4FRXA 1H6S1 2FGRA 2ZLDA 3WI4A 2PORA 2Y2XA 4FSPA 2PRNA 1GFQA 5DL7A 5DL6A 3VY8X 3A2SX 1BH3A 3T24A 3POXA 2FGQX 1MPFA 3T20A 1PRNA 4FT6A 3POUA 2Y0KA 2K4TA 5DL5A 3T0SA 2Y0HA 6PRNA 3HW9A 4FMSA 3EMNX 4LSHA 2QTKA 4LSIA 3PORA 3SZVA 4LSFA 3FYXA 2Y0LA 2ODJA 4KR4A 1GFMA 2J1NA 2OMFA 3POQA 3PRNA 3VZUX 3K19A 1GFNA 5DL8A 4FRTA 1OSMA 1E54A 3UU2A 3O0EA 2XG6A 4GCPA 4RJXA 4C69X 4RJWA 3WI5A 4D64A 4D5UA 1GFPA 2XE1A 2O4VA 1BT9A 2XE3A 5JDPA 4BUMX 3SYSA 1PHOA 4KR8A 4LSEA 2J4UP 4KRAA 7PRNA 1GFOA 3VZWX 1HXTA 4FSOA 2XE2A 4JFBA 5PRNA 1HXXA 3SYBA 3JTYA 3VY9X 3UPGA 1OPFA 4FOZA 3SY9A 2XE5A 5FVNA 8PRNA 3HWBA 3SY7A 4D65A 3SZDA 3NSGA 4AUIA 4GCSA
chains in the Genus database with same CATH superfamily
2ZFGA 4U9CA 1YS5A 4GCQA 1ZHZA 1HXUA 3PGUA 3AAAA 3VZTX 5ADXL 4FRXA 1H6S1 2FGRA 2N2LA 2M07A 2PORA 2XTRA 2Y2XA 2ZLDA 1T1LA 3G7GA 4G76A 3WI4A 4E1SA 3AA1A 2K0LA 4N59A 4AYID 4FSPA 2PRNA 4GCSA 4FZMA 1GFQA 2W80C 4K3CA 2R4NA 5DL7A 5DL6A 3AA7A 4QQ1A 5E79O 4XNLA 3VY8X 2MNHA 3A2SX 1P4TA 3AAEA 1BH3A 1MM4A 3T24A 3PGRA 3AA0B 4IL6O 5G39A 3POXA 2F1VA 2FGQX 1MPFA 2R4OA 5KAIO 5G38A 4AKMA 3T20A 1PRNA 4GF4A 4O3YA 2MHLA 4FZLA 4FT6A 3V8UA 3PQSA 2K4TA 2Y0KA 3POUA 5EE2A 2KXPA 4O3XB 5DL5A 5G3AA 3T0SA 2Y0HA 3WU2O 6PRNA 2LFUA 3DA3A 5B66O 4AYNA 1THQA 2R4PA 1ZHYA 2XMXA 3DWOX 3LK2B 3BS0A 3HW9A 4UB8O 4PUXA 3LK2A 4FMSA 5GTHO 3EMNX 3A0HO 4LSHA 2QTKA 4LSIA 5H2FO 3PORA 3LK3B 4LSFA 3SZVA 3FYXA 3HOEA 2Y0LA 2ODJA 2JMMA 2KZ7A 4KR4A 1GFMA 4RLCA 2J1NA 5T5FA 2OMFA 4C00A 3AAAB 2KZ7B 3POQA 3PGSA 1ZHWA 1T16A 3PQUA 3PRNA 3KVDD 5ADXK 3VE2A 3VZUX 2F1CX 5G26A 1G90A 3K19A 1GFNA 5DL8A 1ZHXA 3QRCA 4FRTA 4O4XA 1BXWA 1E54A 1OSMA 3BRYA 4PR7A 2WJQA 3HOLA 3UU2A 3O0EA 2XG6A 3LK41 2GE4A 4GCPA 5IYUA 5AFUL 5KAFO 2M06A 2WJRA 4RJXA 4C69X 4RJWA 4O3ZA 3WI5A 3AA1B 2JQYA 3DWNA 2YPVA 2R88A 2YNKA 4D64A 4D5UA 2R4LA 3KZIO 4F4BA 4G75A 1GFPA 2N2MA 3AAEB 4N75A 2XE1A 2O4VA 1BT9A 2KXPB 2XE3A 3AA7B 2LHFA 4N74A 3DZMA 4AUIA 2IWWA 2AXTO 1ORMA 4K3BA 3LK42 4AYMC 4Z3TA 5B5EO 5JDPA 2X27X 3C5OA 4FQEA 5AFUK 4E1TA 4BUMX 4O49A 4AZLA 3SYSA 4AFKA 4O3WA 2WVPA 5D5DA 4CTDA 5TISO 1PHOA 2KDYA 2XTQA 4KR8A 4RL9A 5GTIO 2Y7SA 4LSEA 3VE1A 4RLBA 3BRZA 4AYEC 1Q9GA 3JCUO 2J4UP 1IZNA 3AA0A 4KRAA 7PRNA 4XNKA 1GFOA 4JCHA 4N58A 4C4VA 1IZNB 3VZWX 4AYDC 4C4VB 1HXTA 4B61A 2KC0A 2X9KA 4FSOA 2XE2A 4JFBA 1MM5A 5PRNA 1S5LO 3TZGA 1HXXA 3UAQA 3QRAA 3JTYA 3SYBA 3AA6B 1ZHTA 4FESA 2R8AA 3VY9X 3GP6A 3UPGA 4O4UA 5GV0A 4PJ0O 2ERVA 4AKRB 4FZNA 4GHBA 1QJ9A 3PF1A 1OPFA 1Q9FA 4FOZA 3DA4A 1QJPA 2XE5A 3A0BO 3RBHA 5FVNA 3SY9A 1QJ8A 8PRNA 3HWBA 3NJTA 4FUVA 3AA6A 2R89A 3SY7A 3LK3A 4D65A 3SZDA 3NSGA 2W81C 2F1TA 4AKRA 4UB6O 2IWVA
chains in the Genus database with same CATH topology
2ZFGA 4U9CA 1YS5A 4GCQA 1ZHZA 1HXUA 5ADXL 3AAAA 3VZTX 1G90A 4FRXA 1H6S1 2FGRA 2N2LA 2M07A 2PORA 2XTRA 2Y2XA 2ZLDA 3G7GA 3WI4A 4G76A 4E1SA 3AA1A 2K0LA 4N59A 4AYID 4FSPA 2PRNA 4GCSA 4FZMA 1GFQA 2W80C 5DL7A 5DL6A 3AA7A 4QQ1A 3VY8X 4XNLA 2MNHA 3A2SX 1P4TA 3AAEA 1BH3A 1MM4A 3T24A 3AA0B 3POXA 2F1VA 2FGQX 1MPFA 4AKMA 3T20A 1PRNA 4GF4A 4O3YA 2MHLA 4FZLA 4FT6A 3V8UA 3PQSA 2K4TA 2Y0KA 3POUA 5EE2A 2KXPA 4O3XB 5DL5A 3T0SA 2Y0HA 6PRNA 2LFUA 3DA3A 4AYNA 1THQA 1ZHYA 2XMXA 3LK2B 3HW9A 4PUXA 3LK2A 4FMSA 3EMNX 4LSHA 2QTKA 4LSIA 3PORA 3LK3B 4LSFA 3SZVA 3FYXA 3HOEA 2Y0LA 2ODJA 2JMMA 2KZ7A 4KR4A 1GFMA 4RLCA 2J1NA 5T5FA 2OMFA 3AAAB 2KZ7B 3POQA 3PQUA 1ZHWA 3PRNA 3KVDD 5ADXK 3VE2A 3VZUX 5G26A 3K19A 1GFNA 5DL8A 1ZHXA 3QRCA 4FRTA 4O4XA 1BXWA 1E54A 1OSMA 3HOLA 3UU2A 3O0EA 2XG6A 3LK41 2GE4A 4GCPA 5IYUA 5AFUL 2M06A 4RJXA 4C69X 4RJWA 4O3ZA 3WI5A 3AA1B 2YPVA 2YNKA 4D64A 4D5UA 4F4BA 4G75A 1GFPA 2N2MA 3AAEB 2XE1A 2O4VA 1BT9A 2KXPB 2XE3A 3AA7B 2LHFA 4AUIA 1ORMA 5JDPA 4AYMC 3LK42 4Z3TA 2X27X 3C5OA 5AFUK 4E1TA 4BUMX 4O49A 4AZLA 3SYSA 4AFKA 4O3WA 5D5DA 3VE1A 1PHOA 2KDYA 2XTQA 4KR8A 4RL9A 2Y7SA 4LSEA 4RLBA 4AYEC 1Q9GA 2J4UP 1IZNA 3AA0A 4KRAA 7PRNA 4XNKA 1GFOA 4JCHA 4N58A 1IZNB 3VZWX 4AYDC 1HXTA 4B61A 2KC0A 4FSOA 2XE2A 4JFBA 1MM5A 5PRNA 3TZGA 1HXXA 3UAQA 3QRAA 3JTYA 3SYBA 3AA6B 1ZHTA 4FESA 3VY9X 3GP6A 3UPGA 4O4UA 5GV0A 2ERVA 4AKRB 4FZNA 4GHBA 1QJ9A 1OPFA 1Q9FA 4FOZA 3DA4A 1QJPA 2XE5A 3RBHA 3SY9A 5FVNA 1QJ8A 8PRNA 3HWBA 4FUVA 3AA6A 3SY7A 3LK3A 4D65A 3SZDA 3NSGA 2W81C 2F1TA 4AKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFG A;  4GCQ A;  1HXU A;  3VZT X;  4FRX A;  1H6S 1;  2FGR A;  2ZLD A;  3WI4 A;  2POR A;  2Y2X A;  4FSP A;  2PRN A;  1GFQ A;  5DL7 A;  5DL6 A;  3VY8 X;  3A2S X;  1BH3 A;  3T24 A;  3POX A;  2FGQ X;  1MPF A;  3T20 A;  1PRN A;  4FT6 A;  3POU A;  2Y0K A;  2K4T A;  5DL5 A;  3T0S A;  2Y0H A;  6PRN A;  3HW9 A;  4FMS A;  3EMN X;  4LSH A;  2QTK A;  4LSI A;  3POR A;  3SZV A;  4LSF A;  3FYX A;  2Y0L A;  2ODJ A;  4KR4 A;  1GFM A;  2J1N A;  2OMF A;  3POQ A;  3PRN A;  3VZU X;  3K19 A;  1GFN A;  5DL8 A;  4FRT A;  1OSM A;  1E54 A;  3UU2 A;  3O0E A;  2XG6 A;  4GCP A;  4RJX A;  4C69 X;  4RJW A;  3WI5 A;  4D64 A;  4D5U A;  1GFP A;  2XE1 A;  2O4V A;  1BT9 A;  2XE3 A;  5JDP A;  4BUM X;  3SYS A;  1PHO A;  4KR8 A;  4LSE A;  2J4U P;  4KRA A;  7PRN A;  1GFO A;  3VZW X;  1HXT A;  4FSO A;  2XE2 A;  4JFB A;  5PRN A;  1HXX A;  3SYB A;  3JTY A;  3VY9 X;  3UPG A;  1OPF A;  4FOZ A;  3SY9 A;  2XE5 A;  5FVN A;  8PRN A;  3HWB A;  3SY7 A;  4D65 A;  3SZD A;  3NSG A;  4AUI A;  4GCS A; 
#chains in the Genus database with same CATH topology
 2ZFG A;  4U9C A;  1YS5 A;  4GCQ A;  1ZHZ A;  1HXU A;  3PGU A;  3AAA A;  3VZT X;  5ADX L;  4FRX A;  1H6S 1;  2FGR A;  2N2L A;  2M07 A;  2POR A;  2XTR A;  2Y2X A;  2ZLD A;  1T1L A;  3G7G A;  4G76 A;  3WI4 A;  4E1S A;  3AA1 A;  2K0L A;  4N59 A;  4AYI D;  4FSP A;  2PRN A;  4GCS A;  4FZM A;  1GFQ A;  2W80 C;  4K3C A;  2R4N A;  5DL7 A;  5DL6 A;  3AA7 A;  4QQ1 A;  5E79 O;  4XNL A;  3VY8 X;  2MNH A;  3A2S X;  1P4T A;  3AAE A;  1BH3 A;  1MM4 A;  3T24 A;  3PGR A;  3AA0 B;  4IL6 O;  5G39 A;  3POX A;  2F1V A;  2FGQ X;  1MPF A;  2R4O A;  5KAI O;  5G38 A;  4AKM A;  3T20 A;  1PRN A;  4GF4 A;  4O3Y A;  2MHL A;  4FZL A;  4FT6 A;  3V8U A;  3PQS A;  2K4T A;  2Y0K A;  3POU A;  5EE2 A;  2KXP A;  4O3X B;  5DL5 A;  5G3A A;  3T0S A;  2Y0H A;  3WU2 O;  6PRN A;  2LFU A;  3DA3 A;  5B66 O;  4AYN A;  1THQ A;  2R4P A;  1ZHY A;  2XMX A;  3DWO X;  3LK2 B;  3BS0 A;  3HW9 A;  4UB8 O;  4PUX A;  3LK2 A;  4FMS A;  5GTH O;  3EMN X;  3A0H O;  4LSH A;  2QTK A;  4LSI A;  5H2F O;  3POR A;  3LK3 B;  4LSF A;  3SZV A;  3FYX A;  3HOE A;  2Y0L A;  2ODJ A;  2JMM A;  2KZ7 A;  4KR4 A;  1GFM A;  4RLC A;  2J1N A;  5T5F A;  2OMF A;  4C00 A;  3AAA B;  2KZ7 B;  3POQ A;  3PGS A;  1ZHW A;  1T16 A;  3PQU A;  3PRN A;  3KVD D;  5ADX K;  3VE2 A;  3VZU X;  2F1C X;  5G26 A;  1G90 A;  3K19 A;  1GFN A;  5DL8 A;  1ZHX A;  3QRC A;  4FRT A;  4O4X A;  1BXW A;  1E54 A;  1OSM A;  3BRY A;  4PR7 A;  2WJQ A;  3HOL A;  3UU2 A;  3O0E A;  2XG6 A;  3LK4 1;  2GE4 A;  4GCP A;  5IYU A;  5AFU L;  5KAF O;  2M06 A;  2WJR A;  4RJX A;  4C69 X;  4RJW A;  4O3Z A;  3WI5 A;  3AA1 B;  2JQY A;  3DWN A;  2YPV A;  2R88 A;  2YNK A;  4D64 A;  4D5U A;  2R4L A;  3KZI O;  4F4B A;  4G75 A;  1GFP A;  2N2M A;  3AAE B;  4N75 A;  2XE1 A;  2O4V A;  1BT9 A;  2KXP B;  2XE3 A;  3AA7 B;  2LHF A;  4N74 A;  3DZM A;  4AUI A;  2IWW A;  2AXT O;  1ORM A;  4K3B A;  3LK4 2;  4AYM C;  4Z3T A;  5B5E O;  5JDP A;  2X27 X;  3C5O A;  4FQE A;  5AFU K;  4E1T A;  4BUM X;  4O49 A;  4AZL A;  3SYS A;  4AFK A;  4O3W A;  2WVP A;  5D5D A;  4CTD A;  5TIS O;  1PHO A;  2KDY A;  2XTQ A;  4KR8 A;  4RL9 A;  5GTI O;  2Y7S A;  4LSE A;  3VE1 A;  4RLB A;  3BRZ A;  4AYE C;  1Q9G A;  3JCU O;  2J4U P;  1IZN A;  3AA0 A;  4KRA A;  7PRN A;  4XNK A;  1GFO A;  4JCH A;  4N58 A;  4C4V A;  1IZN B;  3VZW X;  4AYD C;  4C4V B;  1HXT A;  4B61 A;  2KC0 A;  2X9K A;  4FSO A;  2XE2 A;  4JFB A;  1MM5 A;  5PRN A;  1S5L O;  3TZG A;  1HXX A;  3UAQ A;  3QRA A;  3JTY A;  3SYB A;  3AA6 B;  1ZHT A;  4FES A;  2R8A A;  3VY9 X;  3GP6 A;  3UPG A;  4O4U A;  5GV0 A;  4PJ0 O;  2ERV A;  4AKR B;  4FZN A;  4GHB A;  1QJ9 A;  3PF1 A;  1OPF A;  1Q9F A;  4FOZ A;  3DA4 A;  1QJP A;  2XE5 A;  3A0B O;  3RBH A;  5FVN A;  3SY9 A;  1QJ8 A;  8PRN A;  3HWB A;  3NJT A;  4FUV A;  3AA6 A;  2R89 A;  3SY7 A;  3LK3 A;  4D65 A;  3SZD A;  3NSG A;  2W81 C;  2F1T A;  4AKR A;  4UB6 O;  2IWV A; 
#chains in the Genus database with same CATH homology
 2ZFG A;  4U9C A;  1YS5 A;  4GCQ A;  1ZHZ A;  1HXU A;  5ADX L;  3AAA A;  3VZT X;  1G90 A;  4FRX A;  1H6S 1;  2FGR A;  2N2L A;  2M07 A;  2POR A;  2XTR A;  2Y2X A;  2ZLD A;  3G7G A;  3WI4 A;  4G76 A;  4E1S A;  3AA1 A;  2K0L A;  4N59 A;  4AYI D;  4FSP A;  2PRN A;  4GCS A;  4FZM A;  1GFQ A;  2W80 C;  5DL7 A;  5DL6 A;  3AA7 A;  4QQ1 A;  3VY8 X;  4XNL A;  2MNH A;  3A2S X;  1P4T A;  3AAE A;  1BH3 A;  1MM4 A;  3T24 A;  3AA0 B;  3POX A;  2F1V A;  2FGQ X;  1MPF A;  4AKM A;  3T20 A;  1PRN A;  4GF4 A;  4O3Y A;  2MHL A;  4FZL A;  4FT6 A;  3V8U A;  3PQS A;  2K4T A;  2Y0K A;  3POU A;  5EE2 A;  2KXP A;  4O3X B;  5DL5 A;  3T0S A;  2Y0H A;  6PRN A;  2LFU A;  3DA3 A;  4AYN A;  1THQ A;  1ZHY A;  2XMX A;  3LK2 B;  3HW9 A;  4PUX A;  3LK2 A;  4FMS A;  3EMN X;  4LSH A;  2QTK A;  4LSI A;  3POR A;  3LK3 B;  4LSF A;  3SZV A;  3FYX A;  3HOE A;  2Y0L A;  2ODJ A;  2JMM A;  2KZ7 A;  4KR4 A;  1GFM A;  4RLC A;  2J1N A;  5T5F A;  2OMF A;  3AAA B;  2KZ7 B;  3POQ A;  3PQU A;  1ZHW A;  3PRN A;  3KVD D;  5ADX K;  3VE2 A;  3VZU X;  5G26 A;  3K19 A;  1GFN A;  5DL8 A;  1ZHX A;  3QRC A;  4FRT A;  4O4X A;  1BXW A;  1E54 A;  1OSM A;  3HOL A;  3UU2 A;  3O0E A;  2XG6 A;  3LK4 1;  2GE4 A;  4GCP A;  5IYU A;  5AFU L;  2M06 A;  4RJX A;  4C69 X;  4RJW A;  4O3Z A;  3WI5 A;  3AA1 B;  2YPV A;  2YNK A;  4D64 A;  4D5U A;  4F4B A;  4G75 A;  1GFP A;  2N2M A;  3AAE B;  2XE1 A;  2O4V A;  1BT9 A;  2KXP B;  2XE3 A;  3AA7 B;  2LHF A;  4AUI A;  1ORM A;  5JDP A;  4AYM C;  3LK4 2;  4Z3T A;  2X27 X;  3C5O A;  5AFU K;  4E1T A;  4BUM X;  4O49 A;  4AZL A;  3SYS A;  4AFK A;  4O3W A;  5D5D A;  3VE1 A;  1PHO A;  2KDY A;  2XTQ A;  4KR8 A;  4RL9 A;  2Y7S A;  4LSE A;  4RLB A;  4AYE C;  1Q9G A;  2J4U P;  1IZN A;  3AA0 A;  4KRA A;  7PRN A;  4XNK A;  1GFO A;  4JCH A;  4N58 A;  1IZN B;  3VZW X;  4AYD C;  1HXT A;  4B61 A;  2KC0 A;  4FSO A;  2XE2 A;  4JFB A;  1MM5 A;  5PRN A;  3TZG A;  1HXX A;  3UAQ A;  3QRA A;  3JTY A;  3SYB A;  3AA6 B;  1ZHT A;  4FES A;  3VY9 X;  3GP6 A;  3UPG A;  4O4U A;  5GV0 A;  2ERV A;  4AKR B;  4FZN A;  4GHB A;  1QJ9 A;  1OPF A;  1Q9F A;  4FOZ A;  3DA4 A;  1QJP A;  2XE5 A;  3RBH A;  3SY9 A;  5FVN A;  1QJ8 A;  8PRN A;  3HWB A;  4FUV A;  3AA6 A;  3SY7 A;  3LK3 A;  4D65 A;  3SZD A;  3NSG A;  2W81 C;  2F1T A;  4AKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...