4O4XA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
513
structure length
503
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTALNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDINGKKMVAVACCSNLEYMKFGQLWQQTEKQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TbpB
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
total genus 112
structure length 503
sequence length 513
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA02
4O3XB 3V8UA 3VE1A 2W80C 4AYID 3HOEA 2KC0A 3KVDD 4AYMC 4O3WA 4O3ZA 4O4UA 4U9CA 3VE2A 4AYNA 5EE2A 3PQSA 3UAQA 4O4XA 2YPVA 3HOLA 4O49A 2KDYA 4QQ1A 2W81C 2Y7SA 4AYEC 1YS5A 3PQUA 4Z3TA 4AYDC 2LFUA 4O3YA 5T5FA
chains in the Genus database with same CATH superfamily
4WFVA 5HWZA 2KZ7B 5D48A 1VWGB 2FT9A 1RXJA 5F2BA 3BY0A 1SLEB 4RJXA 5D47A 2M4LA 5HTEA 3AA6A 1Y9TA 3P6FA 2L9CA 2LKKA 3WOVA 3WZPA 3SY9A 3SZJA 3UEUA 1TOUA 2HYSA 5D45A 3RKGA 3D4RA 2JMMA 3JQOA 1SXUA 1A2DA 3AAEA 1HXXA 1EUOA 1PBYA 1H91A 1RXHA 4O3WA 5H9LA 3WJGA 4ZGUA 4ZHDA 3O22A 4XMFA 4ZHFA 2G79A 5G26A 3K3LA 1LCVA 5LJKA 5H9KA 2OMFA 4O3XB 2BS6A 1KGLA 4HPCA 1WUBA 1MK5A 3UPGA 1YWAA 2Y0HA 1VWDB 3Q6LA 1MVGA 1HBPA 1DV9A 2BLGA 5CHKA 4LQZA 2IFBA 1LELA 1EI5A 2PRNA 3B2IA 1ERBA 2HMBA 2MF6A 3P6EA 1NBXA 4ZH6A 4GCPA 2R89A 4AZRA 4LSFA 8PRNA 2F1VA 5KICA 1AB0A 3RDQA 4CV7A 3FLLA 4KR8A 4BX6A 1B8EA 3ZUOA 4YFPA 4Y59A 4CPIA 1NP4A 2PI3O 4UU3A 2IZLB 1LKEA 3PGRA 1BRPA 2VFCA 2R4PA 2AMMX 1THQA 5FQ8E 2WUTA 4ALBA 1X89A 3JS1A 3LTWA 1STSB 2XKLA 4KCAA 2X8FA 4LZVA 2IWWA 3DZMA 1X8QA 5E79O 2A2GA 3PPTA 3QRCA 1OSPO 4FSPA 4NLIA 4U46A 3EM0A 5DL5A 3ZUIA 5DPQA 5IO5A 4OS0A 4D5UA 4I60A 2L5PA 4A60A 1JYDA 3ZW0B 1N43A 4YMYA 1OEEA 2Z4HA 4IMNA 1KQXA 3AA1B 2GE4A 2Z4IA 5D8JA 3SYSA 4NLJA 1RBPA 2ZAGA 1QY2A 1VWLB 3C77X 2OL7A 4AUIA 4QRLA 1CBQA 4QGVA 1KFFA 2HNXA 3FW5A 1O1VA 5CYBA 2OVAA 4NYRA 1AVEA 5LKFA 3MBTA 1GFPA 1RXKA 4LSHA 1LIDA 2AT8X 1CBIA 2FGRA 1LF7A 2G7BA 1HMRA 4ZR2A 4MEEA 4Y0SA 1JMZA 3SLOA 4K3CA 2X8SA 1KT5A 4QGXA 1VWQB 4OELA 1GT5A 5EPQA 3PEDA 2OL6O 2Y32A 5D5DA 4RL9A 5F6BA 2RTDB 1W4TA 4ZJ0A 2MHDA 3JTYA 4FZNA 3GP6A 2C4IA 2IZKA 4DQ3A 1GT4A 2IZIA 1EPBA 2OFAA 3EBKA 4QZUA 2OZQA 2JU3A 4RLBA 2RTFB 4GGZA 1MEPA 1UREA 1PTSA 4TNNA 2BSZA 1SMPI 5HA0A 5IRAA 5IXGA 1HY2A 2RTEB 4E1TA 2KZ7A 3P02A 1SRIA 1W6FA 3T6LA 1SWHA 4M7MA 5AFUL 3BS2A 1P6PA 1KL3A 3FR2A 2GC9A 4GDAA 3RDXA 1E00A 3SZHA 1SWPA 1AVGI 1GGLA 4XMDA 4AFKA 4L3RA 2FGSA 2OFBA 1OEJA 1KL5A 3RWXA 5LJGA 2X9KA 1DZKA 2QCBA 2J4UP 4QGWA 2CZTA 3UEWA 1NQMA 1AVDA 2WJQA 2RTIB 4MVKA 4KIIA 2G78A 3WJFA 1ICMA 3O2YA 2K23A 3T6FA 4TQ2A 1QFVA 4YGGA 4GH7A 4DNEA 3WU2O 1YWDA 2X27X 3CKGA 1FELA 1U0XA 2ERVA 1X8PA 3B2JA 3FR5A 3EBWA 3WI5A 4IAWA 4EKVA 4BUMX 1SRJA 4LKPA 3F8AA 4AYNA 1MDCA 1SWOA 4ZGFA 2OY5O 1SWLA 1X71A 3N91A 4NNSA 4KR4A 4AZPA 3NP1A 4GNWA 1KT6A 1HMTA 1BSYA 4Y5DA 1ORMA 4YKMA 1T0VA 3TGAA 3NJTA 4O49A 4QQ1A 4CDDA 5HTDA 3NPOA 2YG2A 1LUQA 4ORWA 4TKJA 2O62A 1JQPA 2PY1A 3S26A 4AKRB 2LFOA 3POXA 1JIWI 1HXUA 4IAXA 2GH7A 4BX5B 1HBQA 3CQRA 3LK2B 1B0OA 2RTGB 5HZQA 4ZHGA 1Y0GA 2RA6A 3WZOA 2WJRA 5EEDA 1SLFB 4Z27A 2CZUA 2RTHB 4GHBA 1E5PA 2IWVA 1EPAA 5B27A 3ZW0A 4FRTA 3LV4A 4YBUA 4INNA 3CMPA 4ZFXA 2XE1A 5IO7A 4KH8A 1G5WA 1HMSA 4IB7A 2GJ5A 2XE3A 3KVNA 3NQKA 5AQ6A 3TF6A 3BS0A 1YUPA 3CWKA 3AA1A 2FRSA 3U03A 3X00A 1VWBB 1YP6A 1FENA 2QTKA 2MWHA 3CBCA 3VHMA 4IBAA 2F01A 5H9NA 2RTCB 3NQ3A 4ARHA 2XG6A 1SWKA 1S44A 2QO5A 1K24A 3TGBA 3FDCA 1GFNA 1SRHA 4PSQA 4YFQA 2WWPA 1SWCA 3VHHA 3L4RA 3VY9X 3S5VA 2FS7A 3HWBA 5GV0A 4FOZA 5HAEA 4CDFA 3LK41 2KW1A 1KL4A 4ES7A 2I5VO 5EDCA 1HQQA 4AZOA 1D2UA 2XTRA 1T68X 5G38A 4Z28A 3D9WA 1T1LA 1AELA 1DZJA 3WJBA 1ACDA 1GX9A 4U8UM 3TZSA 3NX2A 5TISO 1GKAB 1E54A 2FHLA 4N59A 2OY8A 3NR3A 2KD2A 1JJJA 2MJIA 1HXZA 3SAOA 4GD9A 5JDPA 3EMNX 5F6ZA 4KT5A 1QFTA 4GNYA 4LSEA 1VWFB 3AUMO 1KZXA 3CBSA 5C0NA 3BLGA 2NNDA 2WEXA 1KQWA 4AZMA 2LBAA 1S2PA 3APWA 1MOYA 4U9CA 2OFRX 1XCAA 5FQ7E 2ASNX 2Y7SA 4EFGA 2X34A 3H3IA 5L8OA 2IZAA 3AA7B 1EIOA 4PJ2A 1Y55X 1BSQA 4TKHA 1X8NA 5F58A 1JJXA 1IKJA 2FS6A 4O9SA 1IJ8A 3WVMA 3T24A 2YNKA 5AEOA 4Y0QA 2F1CX 4CK4A 3C5OA 1I9HA 1QQSA 4A8ZA 2R4NA 3O0EA 4QAEA 3OE3A 4EDEA 3D96A 5HZ5A 1ZNKA 3HWGA 2F73A 4U8UO 3VG2A 5KHPA 5B5EO 2Y3EA 1SWSA 5T5FA 2IZDB 4MISA 2ACOA 2AT0X 1ZNGA 3STMX 2JN3A 1YIVA 3FA9A 5HA1A 3A0HO 2PORA 1SWFA 4GGTA 4XMGA 1VWPB 4YCEA 1O1UA 3STNA 3VG6A 1LCWA 1VYGA 3DTQA 3ZW1B 3JCUO 1KT4A 2JGSA 2F09A 3CKFA 2RTBB 1YP7A 1FEMA 1SWQA 5LJEA 4ON1A 3VG3A 1OBPA 4BOEA 4D6AA 3NSGA 2A8GA 5IO6A 4FZMA 1SREA 1N0SA 1L6MA 3T2XA 5B5FA 3RDMA 4ORSA 2MHLA 4FESA 2OYBO 1DFVA 4MVLA 2X55A 1ZNLA 4AKRA 3S5XA 2AT3X 4WHIA 4U3QA 1PEEA 3WJCA 3O19A 4BX5A 1PBOA 4AYDC 3IFBA 2L67A 5L8NA 2FWVA 2RTMA 1QWDA 1SWDA 3T1DA 4N75A 5FVNA 3CQNA 5FAZA 3PH6A 3RDUA 5HZ9A 5BVTA 2IZFB 1A18A 4JO6A 3HWDA 4Z2OA 4BQUA 5HZ6A 3EYCA 4GK9A 3VU1A 2AKQA 2UYWA 3WYPA 1LIEA 1LCZA 1STPA 2VFBA 4QYPA 2AL0X 1O8VA 1KT3A 1SWNA 1BBPA 3VZWX 2WR6A 1Q9FA 1TOWA 2DJGA 2R4LA 1NC9A 1SLGB 1SWTA 2Q2PA 2ZAIA 2UZ2A 5JD2A 4BX7B 2DM5A 1SXYA 3BX7A 2HZRA 5LJDA 1BXWA 3EMMA 2X32A 3FA8A 2BS5A 3KVDD 4AYMC 3KFHA 4FUVA 2WVPA 3A0BO 5B5GA 3WZQA 3VE2A 1SXXA 1PMPA 2W81C 4PUXA 1QABE 4ORRA 3RDSA 1EALA 2M06A 3FIDA 2RTJA 1SWUA 4O4OA 1VWIB 1ZHZA 3BRZA 2OY7A 4YBPA 2ODJA 1DZPA 2KC0A 3WJDA 5DL8A 2RQ0A 5B66O 2ZFGA 5HCEC 4CPEA 3QRAA 3K19A 2I5ZO 4AKMA 2HKDA 2LHFA 2A2UA 3FYFA 2RTKA 3VE1A 1I05A 2X8TA 4GKCA 4DCBA 2RTAA 4BJ8A 1VWHB 1ADLA 3SZDA 1GKAA 1MM5A 4CDCA 1ZHWA 1OBQA 4PJ0O 1D3SA 1ZNDA 2ALLX 2HZQA 3SOTA 3AA0B 2LB6A 1QY1A 1ALBA 3DWOX 1STRB 4JFBA 2RCTA 3UU2A 5K06A 3IA8A 2X4MA 1SA8A 2LA7A 1LDOA 4TJZA 1OSMA 1JJUA 3GAQA 2RTQB 1BT9A 4D6BA 3SYBA 2K0LA 2R74A 4I3BA 3OJYC 3QQ2A 3AA7A 7PRNA 3VHIA 5H2FO 3ZQ3A 2AT6X 1FJ1E 2GTFX 5FQ6E 5BVSA 2BHVA 4C5PA 1GFMA 4ML7B 3NX1A 4COTA 1GM6A 1SWBA 2FHNX 3NBXX 1LICA 3NQ9A 1G85A 1G74A 4WBKA 3HPEA 4BGFA 4I3CA 3AKNA 2BT9A 2G5LA 2POAA 5B2AO 4G76A 2IZHB 3PDFA 4BCSA 5LJHA 5IRWA 3PK2A 2O4VA 4YH0A 2XMXA 4GE1A 4Y0PA 1MUPA 2W2FA 3DA3A 3ELZA 4YGZA 1HQPA 4RJWA 4JHQA 2N2LA 5B29A 1SXWA 4Z2PA 1GT3A 2Y2XA 3PRNA 4ZHHA 3SLJA 2ACPX 1SY0A 2BC3A 3EW2A 3B2LA 3P6HA 1UYOX 1VWCB 1SRGA 3A2SX 2RTLA 3PORA 4FBRA 4YKOA 1T8VA 3AEHA 3Q34A 2X46A 1TW4A 3ZW1A 4U8UN 4IABA 5CSEA 3PF1A 4XNKA 2Q9SA 1N9YA 4LKTA 2K62A 5KAIO 5DG4A 3D97A 4FT6A 3DSZA 1TVQA 1QJPA 5EZ2A 1N7YA 3HTYA 4YFRA 3T20A 1GFOA 1OPBA 2NP1A 2A13A 5HBSA 3SZVA 5FENA 5BVQA 2OF9A 3P24A 4KC7A 2X56A 1GX8A 1VWMB 2Y0LA 1ERXA 1MPFA 1DF8A 4YGHA 1DC9A 3PQSA 3UAQA 1VWJB 3SZIA 1YS5A 4F4BA 3MX7A 4WFUA 2Q39A 1T16A 1PRNA 3V8UA 4RUNA 4ORXA 2FKGA 1VYFA 4PR7A 1QJ8A 2R88A 3AKMA 1KZWA 3F9DA 1IIUA 1E06A 1VWAB 4GRJA 4JNJA 2XE5A 3G7XA 4TLJA 3FELA 4NV8A 4YCHA 4K3BA 1S5LO 4EEJA 2Q2MA 4TKBA 4AYID 5BYPA 3VG4A 2CBRA 3EW1A 1SWGA 2NNEA 3FR4A 2ZLDA 4BX7A 2Y0KA 2Y3FA 3ZWEA 1ML7A 2WPUA 3B2KA 4C4VB 2N2MA 4FRXA 4GCSA 2AXTO 1XKIA 4A1HA 5B10O 3T0SA 3D95A 3DA4A 4LZUA 2AH7X 2OFMX 4L1NA 1BM5A 1VYOA 5JR8A 1ZHXA 3POQA 4KRAA 1IFCA 1BRQA 1WBIA 1FDQA 2GTLM 4E1SA 1OBUA 4OS3A 4KC8A 3TZGA 4FQEA 1EIIA 1LIBA 2J1NA 3PH5A 1JMXA 4GJVA 1NP1A 1NQNA 1HN2A 3G7GA 4GZVA 3PP6A 4EQAC 1QJ9A 2M07A 3PGUA 4CTDA 2FGQX 2A5CA 3POUA 2X45A 4QZTA 3P6GA 5EEEA 3RY2A 3U9PC 5HZ8A 4AZLA 2JQYA 4I6SA 4CDEA 5L3YA 5LKEA 2IZEB 1Y53X 4IB6A 2ZSCA 1BH3A 2AF5A 3AAAB 5F7GA 1MM9A 4YDAA 2RTRB 1Q9GA 3AA0A 4GETA 2QOSC 2C1QA 1SY2A 4MVEA 3BU1A 3I0AA 3HWEA 3HOEA 4XNLA 3FMZA 2WSJA 2CBSA 1X8UA 2IZJA 3ZZVA 4FZLA 4CPHB 1SWAA 5LJBA 3P6CA 1KOIA 2LFUA 1RAVA 2OVSA 2FLJA 2WQAE 5KIDA 2XSTA 2VDFA 2GTLO 1CBRA 5B3MO 1VPRA 4O4XA 3APVA 3I17A 1HXTA 4RLCA 2KDYA 2MO5A 1W5RA 4ZCBA 4G75A 2QO6A 2A3FX 1DZMA 4M6SA 1U17A 4EXZA 3BRNA 4MIRA 3VGWA 1SRFA 3WXQA 2AVIA 3VZUX 1UZ2X 3WZNA 1VWEB 4ZHCA 2RTNB 1I4UA 2Q4NA 2C1SA 5EE2A 2N93A 2K4TA 3VZTX 3HWFA 3KFIA 4OKAA 4OMXA 1YWCA 4AZNA 1A3YA 4N7CA 2RN4A 3LK3B 3U0DA 4UU2A 2IZCB 3FA7A 1IZNB 1QG5A 1B4MA 4GF4A 3DWNA 2OY1O 4OEMA 1SY3A 1DF3A 1RLBE 1LPJA 2L68A 1PM1X 3LK2A 4N58A 1BWYA 4O4UA 3BX8A 4GUZA 4NW4A 2R4OA 1G7NA 5EDBA 5HCCC 4A1YA 3F6ZB 3UEVA 2FTBA 1U18A 3WJEA 3VG5A 2JU8A 4O4SA 2KXPB 4ORYA 3RBHA 4BVMA 1LFOA 4GDZA 1CJ5A 2HLVA 2AT5X 4YVBA 1FTPA 4UB6O 1Y52X 2MM3A 4GJSA 4D65A 4OS8A 2KTDA 4FMSA 5IYUA 2FR2A 4QYNA 3P6DA 4LSIA 1N4JA 1Y9LA 4K19A 2RD7C 3BU9A 1P4TA 1CRBA 1TXLA 1GX3A 2DJFA 3BSZE 3S60A 5B11O 3MM0A 5H8TA 4FGIB 1E02A 2MNHA 3HK1A 4UB8O 2W2AA 3E3CA 2F1TA 4CPFA 4O3ZA 2LBVA 1VWNB 2OL8O 2QO4A 3T2WA 1QY0A 3WBGA 4Y0RA 1JYJA 4XMCA 4I3DA 4Z3TA 1CBSA 2ANSA 4C4VA 1GT1A 2EU7X 2KT4B 2FKJA 3FEKA 3APXA 4Z2VA 3AA6B 4ORUA 2QMIA 3KQ0A 3FEPA 4ZH9A 3MG5A 4C00A 3FENA 1LDQA 3FA6A 1JV4A 3KFFA 1I78A 3AAEB 3GE2A 2WEWA 6PRNA 3QKGA 1EW3A 2JU7A 3UEXA 1ZNHA 3KFGA 1SWJA 2JOZA 1K3BA 3KZIO 1B56A 3WYQA 5AFUK 4IMOA 4AYHA 1H6S1 3ZW2A 4HPDA 4DQ4A 1SWEA 2XTQA 3SY7A 1RSTB 2W80C 5F1EA 4IB9A 1I04A 4XMEA 3FYXA 3VY8X 2IZBA 3VG7A 1SLDB 4GU8A 2OF8A 4XMHA 3AAAA 1IW2A 1SWRA 1VWRB 2IZGB 5AJCA 2KTSA 2OVDA 1EQDA 5D4AA 3BDRA 1Z24A 1GFQA 1A57A 3RY1A 3BRYA 4BX6B 4ID2A 1JBHA 1MM4A 5LJCA 5ADXK 3PQUA 4HPAA 2QM9A 3PECA 1UYNX 4O3YA 2RTPB 5H9AA 2CAMA 4FBVA 4IL6O 1EXSA 5ADXL 4D64A 4CPHA 4NNTA 1AQBA 1BLRA 1X8OA 1S7DA 4CSBA 3HOLA 1NDJA 1G90A 4GCQA 1RSUB 1MX7A 3EC5A 4IRWA 1ZRYA 2FR3A 3STKA 5HCDC 2NNQA 4I9SA 4JCHA 2R8AA 4ALOA 5L8IA 1KT7A 2QOMA 1NGLA 3APUA 1OPAA 3PGSA 1I06A 2A0AA 3LK42 4NYQA 2P8GA 4BBOA 4ODDA 1JZUA 4N74A 1E2TA 1LNMA 3JSQA 4I9RA 5GTHO 2GTLN 4AW8A 1BEBA 3VPJE 5CE4A 5AJBA 5K67A 3OD9A 2A5BA 3LK3A 4OMWA 3ZI8A 2YMSA 4YDBA 2CM9A 4B61A 3ELXA 2JMBA 1IZNA 5KAFO 1HXLA 1KXOA 1IFBA 3FIQA 2OVEA 4GGRA 5DL6A 4HFOA 3WI4A 3LHNA 1N9MA 3C76X 2R56A 1BSOA 3KZAA 1VWOB 3MVFA 1OPFA 2RCQA 3RE5A 5G39A 4NP1A 4IB8A 2RTOB 1OEKA 4R0BA 4B55A 1LIFA 2JW1A 3RBYA 4Z6JA 2WQ9A 4AZQA 5IRUA 3TGCA 4N7DA 2YPVA 1GXAA 2KXPA 3RSWA 3RE6A 2R73A 3RDOA 4MVIA 3CR6A 1SY1A 1ZHYA 3OBLA 4FSOA 5G3AA 4HWMA 1PHOA 3RZYA 4NV7A 3SLTA 1MX8A 3FW4A 4FQBB 4RUUA 4HPBA 3NADA 5PRNA 5K68A 1IKEA 4AYEC 1VWKB 3B2HA 1BJ7A 2XE2A 4I95A 1ICNA 5GTIO 3C78X 1R0UA 2CM4A 1ZNEA 1ZHTA 4FBOA 4QNIA 2E4JA 5DL7A 5FFHA 1YWBA 2W2BA 2G8CO 4C69X 4JGLA 1FE3A 3HW9A
chains in the Genus database with same CATH topology
3VE1A 4N7CA 4WFVA 5HWZA 2LFOA 2KZ7B 3POXA 1I05A 2RN4A 1JIWI 2X8TA 4GKCA 5D48A 1HXUA 3LK3B 2FT9A 4IAXA 3U0DA 4UU2A 3BY0A 3FA7A 4RJXA 1IZNB 5D47A 1QG5A 1ADLA 2M4LA 5HTEA 1B4MA 3SZDA 1GKAA 3AA6A 1Y9TA 1MM5A 1HBQA 3CQRA 1OBQA 2L9CA 2LKKA 3P6FA 1D3SA 3WOVA 1ZNDA 1ZHWA 3LK2B 3SY9A 3UEUA 2ALLX 2HZQA 1TOUA 3SOTA 2HYSA 1B0OA 5D45A 3RKGA 3D4RA 2JMMA 3JQOA 1SXUA 1SY3A 5HZQA 4ZHGA 1DF3A 1RLBE 1A2DA 1LPJA 3AAEA 3AA0B 1HXXA 1EUOA 4GF4A 2RA6A 1H91A 2L68A 1PM1X 2LB6A 3LK2A 4N58A 4O3WA 5H9LA 3WJGA 4ZGUA 4O4UA 1QY1A 1BWYA 1ALBA 3BX8A 4ZHDA 4KRAA 5EEDA 2CZUA 4NW4A 4GHBA 3O22A 1G7NA 4XMFA 5EDBA 1E5PA 2G79A 4ZHFA 3K3LA 5HCCC 1EPAA 4JFBA 5G26A 5B27A 2RCTA 3UU2A 3ZW0A 4A1YA 3F6ZB 5K06A 3IA8A 4FRTA 3LV4A 5LJKA 4YBUA 1SA8A 2LA7A 3UEVA 2FTBA 4INNA 4TJZA 3CMPA 4ZFXA 2XE1A 5IO7A 5H9KA 4KH8A 1U18A 1G5WA 3WJEA 3GAQA 1OSMA 1HMSA 1BT9A 4IB7A 2GJ5A 4D6BA 2OMFA 3VG5A 2XE3A 3SYBA 4O3XB 2JU8A 3NQKA 4O4SA 2K0LA 2KXPB 2BS6A 4ORYA 1KGLA 5AQ6A 3TF6A 3RBHA 4HPCA 4BVMA 2R74A 4I3BA 1YUPA 3CWKA 3AA1A 2FRSA 3U03A 3UPGA 1LFOA 4GDZA 3OJYC 1CJ5A 1YWAA 2HLVA 3AA7A 7PRNA 2Y0HA 1YP6A 1FENA 2AT5X 3Q6LA 2QTKA 3ZQ3A 2AT6X 1FTPA 2MWHA 2GTFX 1MVGA 5FQ6E 3CBCA 1HBPA 5BVSA 1DV9A 2BHVA 4IBAA 2MM3A 4D65A 1GFMA 2BLGA 4ML7B 3NX1A 4OS8A 2KTDA 5H9NA 4COTA 1GM6A 4FMSA 5IYUA 2FR2A 3NQ3A 4QYNA 4ARHA 3P6DA 3NBXX 1LICA 2XG6A 4LSIA 3NQ9A 1G85A 1G74A 1S44A 2QO5A 1Y9LA 4K19A 4WBKA 3TGBA 2RD7C 3BU9A 4I3CA 1P4TA 4LQZA 1GFNA 1CRBA 2IFBA 1TXLA 1EI5A 4PSQA 4YFQA 3AKNA 2WWPA 2BT9A 2PRNA 2POAA 3BSZE 3L4RA 4G76A 3B2IA 3VY9X 3S5VA 2FS7A 1ERBA 2HMBA 3P6EA 4ZH6A 3S60A 4GCPA 5LJHA 3HWBA 5GV0A 2O4VA 5HAEA 4FOZA 4YH0A 4AZRA 5H8TA 4LSFA 4FGIB 1E02A 8PRNA 3LK41 2F1VA 2XMXA 2KW1A 4GE1A 4Y0PA 2MNHA 3HK1A 5KICA 1MUPA 1AB0A 2W2FA 4CV7A 3FLLA 4ES7A 4KR8A 3DA3A 1B8EA 3ELZA 4YGZA 2W2AA 3E3CA 4YFPA 3ZUOA 2F1TA 1HQPA 4RJWA 5EDCA 1NP4A 4AZOA 2N2LA 1D2UA 2XTRA 4UU3A 4O3ZA 1T68X 1LKEA 5B29A 2LBVA 1SXWA 1BRPA 1AELA 1DZJA 1GT3A 3WJBA 2Y2XA 2AMMX 2QO4A 3PRNA 4ZHHA 1ACDA 1QY0A 2ACPX 3WBGA 1SY0A 1THQA 4Y0RA 5FQ8E 1JYJA 4XMCA 2WUTA 4I3DA 4ALBA 4Z3TA 1CBSA 1GX9A 1X89A 2ANSA 3B2LA 3P6HA 4U8UM 3TZSA 1GT1A 2EU7X 3JS1A 2KT4B 3A2SX 3NX2A 3FEKA 3APXA 2XKLA 4KCAA 2X8FA 4LZVA 1GKAB 3AA6B 1E54A 4ORUA 1X8QA 2QMIA 4FBRA 3KQ0A 3PORA 4YKOA 1T8VA 3POQA 4N59A 3FEPA 2X46A 4ZH9A 1TW4A 2A2GA 3NR3A 2KD2A 1JJJA 2MJIA 3ZW1A 3FENA 3SAOA 3PPTA 4U8UN 5JDPA 3FA6A 3EMNX 5F6ZA 1JV4A 4IABA 3QRCA 3KFFA 4KT5A 4FSPA 4NLIA 3AAEB 1QFTA 3GE2A 4GNYA 2WEWA 4LSEA 2Q9SA 4XNKA 3EM0A 5DL5A 4LKTA 2K62A 3ZUIA 6PRNA 5DPQA 1KZXA 3CBSA 5DG4A 3D97A 5C0NA 3QKGA 5IO5A 1EW3A 4OS0A 4D5UA 2JU7A 3UEXA 3BLGA 4FT6A 3DSZA 1TVQA 1QJPA 2L5PA 1ZNHA 2NNDA 2WEXA 1KQWA 3KFGA 2LBAA 5EZ2A 1JYDA 2JOZA 1S2PA 3ZW0B 4A60A 4AZMA 1B56A 3APWA 5AFUK 3HTYA 4U9CA 2OFRX 4IMOA 4AYHA 4YFRA 1H6S1 3T20A 3ZW2A 1GFOA 1XCAA 4HPDA 5FQ7E 4YMYA 1OPBA 2NP1A 2A13A 1OEEA 5HBSA 3SZVA 2ASNX 5FENA 5BVQA 2Z4HA 2Y7SA 4DQ4A 4EFGA 4IMNA 3H3IA 5L8OA 1KQXA 3P24A 4KC7A 2XTQA 3AA1B 2GE4A 2Z4IA 5D8JA 3SY7A 3AA7B 1GX8A 2W80C 5F1EA 3SYSA 1EIOA 4IB9A 4NLJA 4PJ2A 1RBPA 1BSQA 2Y0LA 4TKHA 1I04A 2ZAGA 1ERXA 1QY2A 1X8NA 1MPFA 4XMEA 3FYXA 4YGHA 3VY8X 5F58A 1DC9A 3C77X 3PQSA 3UAQA 3VG7A 1JJXA 4GU8A 1IKJA 4AUIA 4QRLA 1CBQA 2FS6A 4QGVA 4O9SA 1YS5A 4XMHA 3AAAA 2HNXA 1IW2A 4F4BA 3MX7A 4WFUA 3WVMA 3T24A 3FW5A 2YNKA 1O1VA 5AEOA 4Y0QA 2Q39A 5CYBA 5AJCA 1PRNA 2OVAA 4NYRA 4CK4A 3V8UA 2KTSA 3C5OA 4RUNA 2OVDA 5LKFA 1EQDA 1QQSA 4A8ZA 3MBTA 4ORXA 1GFPA 4LSHA 1LIDA 1VYFA 5D4AA 3O0EA 1QJ8A 4QAEA 3BDRA 1Z24A 3OE3A 3AKMA 1KZWA 3F9DA 1GFQA 2AT8X 1CBIA 4EDEA 1A57A 1IIUA 3D96A 1E06A 1ZNKA 5HZ5A 2FGRA 1LF7A 4GRJA 2G7BA 3HWGA 1HMRA 4ID2A 2F73A 2XE5A 1JBHA 3G7XA 4U8UO 4ZR2A 3VG2A 5KHPA 5LJCA 1MM4A 5ADXK 3PQUA 4TLJA 4HPAA 2QM9A 4Y0SA 3PECA 3FELA 4YCHA 4O3YA 5H9AA 4EEJA 4FBVA 1EXSA 5T5FA 2Q2MA 4TKBA 4AYID 5BYPA 2CBRA 2ACOA 4MISA 2AT0X 3VG4A 1ZNGA 4NNTA 3STMX 4D64A 2JN3A 2NNEA 1AQBA 1YIVA 3FR4A 1BLRA 2Y0KA 2ZLDA 2X8SA 3FA9A 3ZWEA 1ML7A 1X8OA 5HA1A 3B2KA 1KT5A 1S7DA 4QGXA 4CSBA 2PORA 3HOLA 2N2MA 1G90A 1GT5A 4FRXA 4XMGA 4GCSA 4GCQA 4YCEA 5EPQA 1MX7A 3PEDA 1O1UA 1XKIA 4A1HA 3STNA 3VG6A 1VYGA 3T0SA 1ZRYA 3D95A 2FR3A 3DA4A 3DTQA 4LZUA 3STKA 3ZW1B 5HCDC 2AH7X 2NNQA 2OFMX 4L1NA 1KT4A 2F09A 4I9SA 4JCHA 1BM5A 5D5DA 4RL9A 5JR8A 5F6BA 4ZJ0A 2MHDA 1ZHXA 1YP7A 4ALOA 1KT7A 3APUA 1FEMA 1NGLA 1IFCA 5L8IA 3JTYA 1BRQA 1OPAA 5LJEA 3GP6A 4FZNA 1FDQA 4ON1A 2GTLM 4DQ3A 4E1SA 3VG3A 1OBPA 1GT4A 1OBUA 4OS3A 4KC8A 1I06A 2A0AA 1EPBA 3EBKA 3TZGA 4BOEA 1EIIA 4NYQA 2P8GA 2OZQA 4QZUA 4D6AA 3LK42 4ODDA 3NSGA 1JZUA 1LIBA 5IO6A 2J1NA 2JU3A 4FZMA 3PH5A 1N0SA 4RLBA 1LNMA 3JSQA 1NP1A 4I9RA 1L6MA 1UREA 5ADXL 1HN2A 3G7GA 2GTLN 4ORSA 4TNNA 1SMPI 5HA0A 4GZVA 2MHLA 4AW8A 1BEBA 3PP6A 4EQAC 4FESA 1QJ9A 1DFVA 3VPJE 2M07A 4MVLA 1ZNLA 2FGQX 4AKRA 5CE4A 3S5XA 3POUA 5AJBA 4E1TA 2X45A 2KZ7A 3P02A 3OD9A 3P6GA 2AT3X 4QZTA 4U3QA 4WHIA 5EEEA 3LK3A 4OMWA 3ZI8A 1PEEA 3U9PC 5HZ8A 4M7MA 2YMSA 3BS2A 1P6PA 4YDBA 4AZLA 5AFUL 3WJCA 2CM9A 3FR2A 3O19A 4I6SA 4B61A 1PBOA 2GC9A 3ELXA 4AYDC 3IFBA 2JMBA 1IZNA 2L67A 5L8NA 1E00A 2FWVA 5LKEA 1QWDA 1AVGI 3T1DA 1GGLA 4XMDA 5FVNA 3CQNA 1KXOA 4IB6A 4AFKA 5FAZA 3PH6A 4L3RA 1BH3A 5HZ9A 5BVTA 1IFBA 3FIQA 2OVEA 1A18A 3AAAB 1OEJA 5F7GA 3HWDA 5DL6A 4YDAA 4BQUA 4HFOA 3RWXA 5HZ6A 3WI4A 3EYCA 1Q9GA 4GK9A 3VU1A 3AA0A 3LHNA 4GETA 1DZKA 2QOSC 5LJGA 2AKQA 2J4UP 1LIEA 4QGWA 2CZTA 3UEWA 1SY2A 3C76X 4MVEA 2R56A 1BSOA 4MVKA 3KZAA 3MVFA 3BU1A 1OPFA 4QYPA 2RCQA 2AL0X 3I0AA 1O8VA 1KT3A 4NP1A 4IB8A 3HWEA 4KIIA 3HOEA 1BBPA 3VZWX 2G78A 4XNLA 3WJFA 1OEKA 3FMZA 2WR6A 1ICMA 1Q9FA 4R0BA 3O2YA 2K23A 1LIFA 2JW1A 3RBYA 4TQ2A 1QFVA 1TOWA 2WQ9A 4GH7A 4YGGA 4AZQA 3TGCA 4N7DA 2WSJA 2Q2PA 2YPVA 1GXAA 1YWDA 3RSWA 2KXPA 2ZAIA 2X27X 2R73A 2CBSA 1X8UA 3ZZVA 4FZLA 1FELA 1U0XA 2ERVA 1X8PA 5LJBA 3P6CA 3B2JA 3FR5A 2DM5A 1SXYA 1KOIA 2LFUA 4MVIA 3BX7A 3EBWA 3WI5A 2HZRA 3CR6A 1SY1A 5LJDA 1BXWA 1ZHYA 3EMMA 3OBLA 2OVSA 3FA8A 4IAWA 2FLJA 4FSOA 2WQAE 4HWMA 2XSTA 5KIDA 4BUMX 2BS5A 3KVDD 1PHOA 3RZYA 4AYMC 3KFHA 4FUVA 2GTLO 1CBRA 1VPRA 3VE2A 4LKPA 3F8AA 4AYNA 1MX8A 3FW4A 3APVA 4O4XA 3I17A 1HXTA 4FQBB 4RUUA 1SXXA 2MO5A 1PMPA 4HPBA 1MDCA 3NADA 2KDYA 4RLCA 2W81C 4PUXA 1IKEA 1QABE 4ORRA 2QO6A 4ZCBA 4G75A 5PRNA 4AYEC 2A3FX 1EALA 2M06A 4ZGFA 1DZMA 4M6SA 1U17A 1X71A 3B2HA 3N91A 4NNSA 4O4OA 1ZHZA 4KR4A 4EXZA 3BRNA 1BJ7A 4MIRA 2XE2A 4AZPA 4YBPA 3NP1A 4GNWA 1ICNA 4I95A 3WXQA 2ODJA 1DZPA 1KT6A 2KC0A 1HMTA 3VZUX 3C78X 1R0UA 1BSYA 1UZ2X 2CM4A 1ZNEA 1ORMA 1ZHTA 4ZHCA 4FBOA 4QNIA 4YKMA 3WJDA 1T0VA 1I4UA 2Q4NA 5DL8A 2E4JA 3TGAA 2RQ0A 5DL7A 5EE2A 5FFHA 2ZFGA 2N93A 5HCEC 2K4TA 3VZTX 3HWFA 3QRAA 3K19A 4AKMA 3KFIA 4O49A 4QQ1A 1YWBA 2W2BA 5HTDA 3NPOA 2LHFA 2YG2A 2A2UA 4ORWA 4C69X 4OMXA 4TKJA 3FYFA 4JGLA 2O62A 1FE3A 2PY1A 1YWCA 3HW9A 4AZNA 3S26A 1A3YA 4AKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3X B;  3V8U A;  3VE1 A;  2W80 C;  4AYI D;  3HOE A;  2KC0 A;  3KVD D;  4AYM C;  4O3W A;  4O3Z A;  4O4U A;  4U9C A;  3VE2 A;  4AYN A;  5EE2 A;  3PQS A;  3UAQ A;  4O4X A;  2YPV A;  3HOL A;  4O49 A;  2KDY A;  4QQ1 A;  2W81 C;  2Y7S A;  4AYE C;  1YS5 A;  3PQU A;  4Z3T A;  4AYD C;  2LFU A;  4O3Y A;  5T5F A; 
#chains in the Genus database with same CATH topology
 4WFV A;  5HWZ A;  2KZ7 B;  5D48 A;  1VWG B;  2FT9 A;  1RXJ A;  5F2B A;  3BY0 A;  1SLE B;  4RJX A;  5D47 A;  2M4L A;  5HTE A;  3AA6 A;  1Y9T A;  3P6F A;  2L9C A;  2LKK A;  3WOV A;  3WZP A;  3SY9 A;  3SZJ A;  3UEU A;  1TOU A;  2HYS A;  5D45 A;  3RKG A;  3D4R A;  2JMM A;  3JQO A;  1SXU A;  1A2D A;  3AAE A;  1HXX A;  1EUO A;  1PBY A;  1H91 A;  1RXH A;  4O3W A;  5H9L A;  3WJG A;  4ZGU A;  4ZHD A;  3O22 A;  4XMF A;  4ZHF A;  2G79 A;  5G26 A;  3K3L A;  1LCV A;  5LJK A;  5H9K A;  2OMF A;  4O3X B;  2BS6 A;  1KGL A;  4HPC A;  1WUB A;  1MK5 A;  3UPG A;  1YWA A;  2Y0H A;  1VWD B;  3Q6L A;  1MVG A;  1HBP A;  1DV9 A;  2BLG A;  5CHK A;  4LQZ A;  2IFB A;  1LEL A;  1EI5 A;  2PRN A;  3B2I A;  1ERB A;  2HMB A;  2MF6 A;  3P6E A;  1NBX A;  4ZH6 A;  4GCP A;  2R89 A;  4AZR A;  4LSF A;  8PRN A;  2F1V A;  5KIC A;  1AB0 A;  3RDQ A;  4CV7 A;  3FLL A;  4KR8 A;  4BX6 A;  1B8E A;  3ZUO A;  4YFP A;  4Y59 A;  4CPI A;  1NP4 A;  2PI3 O;  4UU3 A;  2IZL B;  1LKE A;  3PGR A;  1BRP A;  2VFC A;  2R4P A;  2AMM X;  1THQ A;  5FQ8 E;  2WUT A;  4ALB A;  1X89 A;  3JS1 A;  3LTW A;  1STS B;  2XKL A;  4KCA A;  2X8F A;  4LZV A;  2IWW A;  3DZM A;  1X8Q A;  5E79 O;  2A2G A;  3PPT A;  3QRC A;  1OSP O;  4FSP A;  4NLI A;  4U46 A;  3EM0 A;  5DL5 A;  3ZUI A;  5DPQ A;  5IO5 A;  4OS0 A;  4D5U A;  4I60 A;  2L5P A;  4A60 A;  1JYD A;  3ZW0 B;  1N43 A;  4YMY A;  1OEE A;  2Z4H A;  4IMN A;  1KQX A;  3AA1 B;  2GE4 A;  2Z4I A;  5D8J A;  3SYS A;  4NLJ A;  1RBP A;  2ZAG A;  1QY2 A;  1VWL B;  3C77 X;  2OL7 A;  4AUI A;  4QRL A;  1CBQ A;  4QGV A;  1KFF A;  2HNX A;  3FW5 A;  1O1V A;  5CYB A;  2OVA A;  4NYR A;  1AVE A;  5LKF A;  3MBT A;  1GFP A;  1RXK A;  4LSH A;  1LID A;  2AT8 X;  1CBI A;  2FGR A;  1LF7 A;  2G7B A;  1HMR A;  4ZR2 A;  4MEE A;  4Y0S A;  1JMZ A;  3SLO A;  4K3C A;  2X8S A;  1KT5 A;  4QGX A;  1VWQ B;  4OEL A;  1GT5 A;  5EPQ A;  3PED A;  2OL6 O;  2Y32 A;  5D5D A;  4RL9 A;  5F6B A;  2RTD B;  1W4T A;  4ZJ0 A;  2MHD A;  3JTY A;  4FZN A;  3GP6 A;  2C4I A;  2IZK A;  4DQ3 A;  1GT4 A;  2IZI A;  1EPB A;  2OFA A;  3EBK A;  4QZU A;  2OZQ A;  2JU3 A;  4RLB A;  2RTF B;  4GGZ A;  1MEP A;  1URE A;  1PTS A;  4TNN A;  2BSZ A;  1SMP I;  5HA0 A;  5IRA A;  5IXG A;  1HY2 A;  2RTE B;  4E1T A;  2KZ7 A;  3P02 A;  1SRI A;  1W6F A;  3T6L A;  1SWH A;  4M7M A;  5AFU L;  3BS2 A;  1P6P A;  1KL3 A;  3FR2 A;  2GC9 A;  4GDA A;  3RDX A;  1E00 A;  3SZH A;  1SWP A;  1AVG I;  1GGL A;  4XMD A;  4AFK A;  4L3R A;  2FGS A;  2OFB A;  1OEJ A;  1KL5 A;  3RWX A;  5LJG A;  2X9K A;  1DZK A;  2QCB A;  2J4U P;  4QGW A;  2CZT A;  3UEW A;  1NQM A;  1AVD A;  2WJQ A;  2RTI B;  4MVK A;  4KII A;  2G78 A;  3WJF A;  1ICM A;  3O2Y A;  2K23 A;  3T6F A;  4TQ2 A;  1QFV A;  4YGG A;  4GH7 A;  4DNE A;  3WU2 O;  1YWD A;  2X27 X;  3CKG A;  1FEL A;  1U0X A;  2ERV A;  1X8P A;  3B2J A;  3FR5 A;  3EBW A;  3WI5 A;  4IAW A;  4EKV A;  4BUM X;  1SRJ A;  4LKP A;  3F8A A;  4AYN A;  1MDC A;  1SWO A;  4ZGF A;  2OY5 O;  1SWL A;  1X71 A;  3N91 A;  4NNS A;  4KR4 A;  4AZP A;  3NP1 A;  4GNW A;  1KT6 A;  1HMT A;  1BSY A;  4Y5D A;  1ORM A;  4YKM A;  1T0V A;  3TGA A;  3NJT A;  4O49 A;  4QQ1 A;  4CDD A;  5HTD A;  3NPO A;  2YG2 A;  1LUQ A;  4ORW A;  4TKJ A;  2O62 A;  1JQP A;  2PY1 A;  3S26 A;  4AKR B;  2LFO A;  3POX A;  1JIW I;  1HXU A;  4IAX A;  2GH7 A;  4BX5 B;  1HBQ A;  3CQR A;  3LK2 B;  1B0O A;  2RTG B;  5HZQ A;  4ZHG A;  1Y0G A;  2RA6 A;  3WZO A;  2WJR A;  5EED A;  1SLF B;  4Z27 A;  2CZU A;  2RTH B;  4GHB A;  1E5P A;  2IWV A;  1EPA A;  5B27 A;  3ZW0 A;  4FRT A;  3LV4 A;  4YBU A;  4INN A;  3CMP A;  4ZFX A;  2XE1 A;  5IO7 A;  4KH8 A;  1G5W A;  1HMS A;  4IB7 A;  2GJ5 A;  2XE3 A;  3KVN A;  3NQK A;  5AQ6 A;  3TF6 A;  3BS0 A;  1YUP A;  3CWK A;  3AA1 A;  2FRS A;  3U03 A;  3X00 A;  1VWB B;  1YP6 A;  1FEN A;  2QTK A;  2MWH A;  3CBC A;  3VHM A;  4IBA A;  2F01 A;  5H9N A;  2RTC B;  3NQ3 A;  4ARH A;  2XG6 A;  1SWK A;  1S44 A;  2QO5 A;  1K24 A;  3TGB A;  3FDC A;  1GFN A;  1SRH A;  4PSQ A;  4YFQ A;  2WWP A;  1SWC A;  3VHH A;  3L4R A;  3VY9 X;  3S5V A;  2FS7 A;  3HWB A;  5GV0 A;  4FOZ A;  5HAE A;  4CDF A;  3LK4 1;  2KW1 A;  1KL4 A;  4ES7 A;  2I5V O;  5EDC A;  1HQQ A;  4AZO A;  1D2U A;  2XTR A;  1T68 X;  5G38 A;  4Z28 A;  3D9W A;  1T1L A;  1AEL A;  1DZJ A;  3WJB A;  1ACD A;  1GX9 A;  4U8U M;  3TZS A;  3NX2 A;  5TIS O;  1GKA B;  1E54 A;  2FHL A;  4N59 A;  2OY8 A;  3NR3 A;  2KD2 A;  1JJJ A;  2MJI A;  1HXZ A;  3SAO A;  4GD9 A;  5JDP A;  3EMN X;  5F6Z A;  4KT5 A;  1QFT A;  4GNY A;  4LSE A;  1VWF B;  3AUM O;  1KZX A;  3CBS A;  5C0N A;  3BLG A;  2NND A;  2WEX A;  1KQW A;  4AZM A;  2LBA A;  1S2P A;  3APW A;  1MOY A;  4U9C A;  2OFR X;  1XCA A;  5FQ7 E;  2ASN X;  2Y7S A;  4EFG A;  2X34 A;  3H3I A;  5L8O A;  2IZA A;  3AA7 B;  1EIO A;  4PJ2 A;  1Y55 X;  1BSQ A;  4TKH A;  1X8N A;  5F58 A;  1JJX A;  1IKJ A;  2FS6 A;  4O9S A;  1IJ8 A;  3WVM A;  3T24 A;  2YNK A;  5AEO A;  4Y0Q A;  2F1C X;  4CK4 A;  3C5O A;  1I9H A;  1QQS A;  4A8Z A;  2R4N A;  3O0E A;  4QAE A;  3OE3 A;  4EDE A;  3D96 A;  5HZ5 A;  1ZNK A;  3HWG A;  2F73 A;  4U8U O;  3VG2 A;  5KHP A;  5B5E O;  2Y3E A;  1SWS A;  5T5F A;  2IZD B;  4MIS A;  2ACO A;  2AT0 X;  1ZNG A;  3STM X;  2JN3 A;  1YIV A;  3FA9 A;  5HA1 A;  3A0H O;  2POR A;  1SWF A;  4GGT A;  4XMG A;  1VWP B;  4YCE A;  1O1U A;  3STN A;  3VG6 A;  1LCW A;  1VYG A;  3DTQ A;  3ZW1 B;  3JCU O;  1KT4 A;  2JGS A;  2F09 A;  3CKF A;  2RTB B;  1YP7 A;  1FEM A;  1SWQ A;  5LJE A;  4ON1 A;  3VG3 A;  1OBP A;  4BOE A;  4D6A A;  3NSG A;  2A8G A;  5IO6 A;  4FZM A;  1SRE A;  1N0S A;  1L6M A;  3T2X A;  5B5F A;  3RDM A;  4ORS A;  2MHL A;  4FES A;  2OYB O;  1DFV A;  4MVL A;  2X55 A;  1ZNL A;  4AKR A;  3S5X A;  2AT3 X;  4WHI A;  4U3Q A;  1PEE A;  3WJC A;  3O19 A;  4BX5 A;  1PBO A;  4AYD C;  3IFB A;  2L67 A;  5L8N A;  2FWV A;  2RTM A;  1QWD A;  1SWD A;  3T1D A;  4N75 A;  5FVN A;  3CQN A;  5FAZ A;  3PH6 A;  3RDU A;  5HZ9 A;  5BVT A;  2IZF B;  1A18 A;  4JO6 A;  3HWD A;  4Z2O A;  4BQU A;  5HZ6 A;  3EYC A;  4GK9 A;  3VU1 A;  2AKQ A;  2UYW A;  3WYP A;  1LIE A;  1LCZ A;  1STP A;  2VFB A;  4QYP A;  2AL0 X;  1O8V A;  1KT3 A;  1SWN A;  1BBP A;  3VZW X;  2WR6 A;  1Q9F A;  1TOW A;  2DJG A;  2R4L A;  1NC9 A;  1SLG B;  1SWT A;  2Q2P A;  2ZAI A;  2UZ2 A;  5JD2 A;  4BX7 B;  2DM5 A;  1SXY A;  3BX7 A;  2HZR A;  5LJD A;  1BXW A;  3EMM A;  2X32 A;  3FA8 A;  2BS5 A;  3KVD D;  4AYM C;  3KFH A;  4FUV A;  2WVP A;  3A0B O;  5B5G A;  3WZQ A;  3VE2 A;  1SXX A;  1PMP A;  2W81 C;  4PUX A;  1QAB E;  4ORR A;  3RDS A;  1EAL A;  2M06 A;  3FID A;  2RTJ A;  1SWU A;  4O4O A;  1VWI B;  1ZHZ A;  3BRZ A;  2OY7 A;  4YBP A;  2ODJ A;  1DZP A;  2KC0 A;  3WJD A;  5DL8 A;  2RQ0 A;  5B66 O;  2ZFG A;  5HCE C;  4CPE A;  3QRA A;  3K19 A;  2I5Z O;  4AKM A;  2HKD A;  2LHF A;  2A2U A;  3FYF A;  2RTK A;  3VE1 A;  1I05 A;  2X8T A;  4GKC A;  4DCB A;  2RTA A;  4BJ8 A;  1VWH B;  1ADL A;  3SZD A;  1GKA A;  1MM5 A;  4CDC A;  1ZHW A;  1OBQ A;  4PJ0 O;  1D3S A;  1ZND A;  2ALL X;  2HZQ A;  3SOT A;  3AA0 B;  2LB6 A;  1QY1 A;  1ALB A;  3DWO X;  1STR B;  4JFB A;  2RCT A;  3UU2 A;  5K06 A;  3IA8 A;  2X4M A;  1SA8 A;  2LA7 A;  1LDO A;  4TJZ A;  1OSM A;  1JJU A;  3GAQ A;  2RTQ B;  1BT9 A;  4D6B A;  3SYB A;  2K0L A;  2R74 A;  4I3B A;  3OJY C;  3QQ2 A;  3AA7 A;  7PRN A;  3VHI A;  5H2F O;  3ZQ3 A;  2AT6 X;  1FJ1 E;  2GTF X;  5FQ6 E;  5BVS A;  2BHV A;  4C5P A;  1GFM A;  4ML7 B;  3NX1 A;  4COT A;  1GM6 A;  1SWB A;  2FHN X;  3NBX X;  1LIC A;  3NQ9 A;  1G85 A;  1G74 A;  4WBK A;  3HPE A;  4BGF A;  4I3C A;  3AKN A;  2BT9 A;  2G5L A;  2POA A;  5B2A O;  4G76 A;  2IZH B;  3PDF A;  4BCS A;  5LJH A;  5IRW A;  3PK2 A;  2O4V A;  4YH0 A;  2XMX A;  4GE1 A;  4Y0P A;  1MUP A;  2W2F A;  3DA3 A;  3ELZ A;  4YGZ A;  1HQP A;  4RJW A;  4JHQ A;  2N2L A;  5B29 A;  1SXW A;  4Z2P A;  1GT3 A;  2Y2X A;  3PRN A;  4ZHH A;  3SLJ A;  2ACP X;  1SY0 A;  2BC3 A;  3EW2 A;  3B2L A;  3P6H A;  1UYO X;  1VWC B;  1SRG A;  3A2S X;  2RTL A;  3POR A;  4FBR A;  4YKO A;  1T8V A;  3AEH A;  3Q34 A;  2X46 A;  1TW4 A;  3ZW1 A;  4U8U N;  4IAB A;  5CSE A;  3PF1 A;  4XNK A;  2Q9S A;  1N9Y A;  4LKT A;  2K62 A;  5KAI O;  5DG4 A;  3D97 A;  4FT6 A;  3DSZ A;  1TVQ A;  1QJP A;  5EZ2 A;  1N7Y A;  3HTY A;  4YFR A;  3T20 A;  1GFO A;  1OPB A;  2NP1 A;  2A13 A;  5HBS A;  3SZV A;  5FEN A;  5BVQ A;  2OF9 A;  3P24 A;  4KC7 A;  2X56 A;  1GX8 A;  1VWM B;  2Y0L A;  1ERX A;  1MPF A;  1DF8 A;  4YGH A;  1DC9 A;  3PQS A;  3UAQ A;  1VWJ B;  3SZI A;  1YS5 A;  4F4B A;  3MX7 A;  4WFU A;  2Q39 A;  1T16 A;  1PRN A;  3V8U A;  4RUN A;  4ORX A;  2FKG A;  1VYF A;  4PR7 A;  1QJ8 A;  2R88 A;  3AKM A;  1KZW A;  3F9D A;  1IIU A;  1E06 A;  1VWA B;  4GRJ A;  4JNJ A;  2XE5 A;  3G7X A;  4TLJ A;  3FEL A;  4NV8 A;  4YCH A;  4K3B A;  1S5L O;  4EEJ A;  2Q2M A;  4TKB A;  4AYI D;  5BYP A;  3VG4 A;  2CBR A;  3EW1 A;  1SWG A;  2NNE A;  3FR4 A;  2ZLD A;  4BX7 A;  2Y0K A;  2Y3F A;  3ZWE A;  1ML7 A;  2WPU A;  3B2K A;  4C4V B;  2N2M A;  4FRX A;  4GCS A;  2AXT O;  1XKI A;  4A1H A;  5B10 O;  3T0S A;  3D95 A;  3DA4 A;  4LZU A;  2AH7 X;  2OFM X;  4L1N A;  1BM5 A;  1VYO A;  5JR8 A;  1ZHX A;  3POQ A;  4KRA A;  1IFC A;  1BRQ A;  1WBI A;  1FDQ A;  2GTL M;  4E1S A;  1OBU A;  4OS3 A;  4KC8 A;  3TZG A;  4FQE A;  1EII A;  1LIB A;  2J1N A;  3PH5 A;  1JMX A;  4GJV A;  1NP1 A;  1NQN A;  1HN2 A;  3G7G A;  4GZV A;  3PP6 A;  4EQA C;  1QJ9 A;  2M07 A;  3PGU A;  4CTD A;  2FGQ X;  2A5C A;  3POU A;  2X45 A;  4QZT A;  3P6G A;  5EEE A;  3RY2 A;  3U9P C;  5HZ8 A;  4AZL A;  2JQY A;  4I6S A;  4CDE A;  5L3Y A;  5LKE A;  2IZE B;  1Y53 X;  4IB6 A;  2ZSC A;  1BH3 A;  2AF5 A;  3AAA B;  5F7G A;  1MM9 A;  4YDA A;  2RTR B;  1Q9G A;  3AA0 A;  4GET A;  2QOS C;  2C1Q A;  1SY2 A;  4MVE A;  3BU1 A;  3I0A A;  3HWE A;  3HOE A;  4XNL A;  3FMZ A;  2WSJ A;  2CBS A;  1X8U A;  2IZJ A;  3ZZV A;  4FZL A;  4CPH B;  1SWA A;  5LJB A;  3P6C A;  1KOI A;  2LFU A;  1RAV A;  2OVS A;  2FLJ A;  2WQA E;  5KID A;  2XST A;  2VDF A;  2GTL O;  1CBR A;  5B3M O;  1VPR A;  4O4X A;  3APV A;  3I17 A;  1HXT A;  4RLC A;  2KDY A;  2MO5 A;  1W5R A;  4ZCB A;  4G75 A;  2QO6 A;  2A3F X;  1DZM A;  4M6S A;  1U17 A;  4EXZ A;  3BRN A;  4MIR A;  3VGW A;  1SRF A;  3WXQ A;  2AVI A;  3VZU X;  1UZ2 X;  3WZN A;  1VWE B;  4ZHC A;  2RTN B;  1I4U A;  2Q4N A;  2C1S A;  5EE2 A;  2N93 A;  2K4T A;  3VZT X;  3HWF A;  3KFI A;  4OKA A;  4OMX A;  1YWC A;  4AZN A;  1A3Y A;  4N7C A;  2RN4 A;  3LK3 B;  3U0D A;  4UU2 A;  2IZC B;  3FA7 A;  1IZN B;  1QG5 A;  1B4M A;  4GF4 A;  3DWN A;  2OY1 O;  4OEM A;  1SY3 A;  1DF3 A;  1RLB E;  1LPJ A;  2L68 A;  1PM1 X;  3LK2 A;  4N58 A;  1BWY A;  4O4U A;  3BX8 A;  4GUZ A;  4NW4 A;  2R4O A;  1G7N A;  5EDB A;  5HCC C;  4A1Y A;  3F6Z B;  3UEV A;  2FTB A;  1U18 A;  3WJE A;  3VG5 A;  2JU8 A;  4O4S A;  2KXP B;  4ORY A;  3RBH A;  4BVM A;  1LFO A;  4GDZ A;  1CJ5 A;  2HLV A;  2AT5 X;  4YVB A;  1FTP A;  4UB6 O;  1Y52 X;  2MM3 A;  4GJS A;  4D65 A;  4OS8 A;  2KTD A;  4FMS A;  5IYU A;  2FR2 A;  4QYN A;  3P6D A;  4LSI A;  1N4J A;  1Y9L A;  4K19 A;  2RD7 C;  3BU9 A;  1P4T A;  1CRB A;  1TXL A;  1GX3 A;  2DJF A;  3BSZ E;  3S60 A;  5B11 O;  3MM0 A;  5H8T A;  4FGI B;  1E02 A;  2MNH A;  3HK1 A;  4UB8 O;  2W2A A;  3E3C A;  2F1T A;  4CPF A;  4O3Z A;  2LBV A;  1VWN B;  2OL8 O;  2QO4 A;  3T2W A;  1QY0 A;  3WBG A;  4Y0R A;  1JYJ A;  4XMC A;  4I3D A;  4Z3T A;  1CBS A;  2ANS A;  4C4V A;  1GT1 A;  2EU7 X;  2KT4 B;  2FKJ A;  3FEK A;  3APX A;  4Z2V A;  3AA6 B;  4ORU A;  2QMI A;  3KQ0 A;  3FEP A;  4ZH9 A;  3MG5 A;  4C00 A;  3FEN A;  1LDQ A;  3FA6 A;  1JV4 A;  3KFF A;  1I78 A;  3AAE B;  3GE2 A;  2WEW A;  6PRN A;  3QKG A;  1EW3 A;  2JU7 A;  3UEX A;  1ZNH A;  3KFG A;  1SWJ A;  2JOZ A;  1K3B A;  3KZI O;  1B56 A;  3WYQ A;  5AFU K;  4IMO A;  4AYH A;  1H6S 1;  3ZW2 A;  4HPD A;  4DQ4 A;  1SWE A;  2XTQ A;  3SY7 A;  1RST B;  2W80 C;  5F1E A;  4IB9 A;  1I04 A;  4XME A;  3FYX A;  3VY8 X;  2IZB A;  3VG7 A;  1SLD B;  4GU8 A;  2OF8 A;  4XMH A;  3AAA A;  1IW2 A;  1SWR A;  1VWR B;  2IZG B;  5AJC A;  2KTS A;  2OVD A;  1EQD A;  5D4A A;  3BDR A;  1Z24 A;  1GFQ A;  1A57 A;  3RY1 A;  3BRY A;  4BX6 B;  4ID2 A;  1JBH A;  1MM4 A;  5LJC A;  5ADX K;  3PQU A;  4HPA A;  2QM9 A;  3PEC A;  1UYN X;  4O3Y A;  2RTP B;  5H9A A;  2CAM A;  4FBV A;  4IL6 O;  1EXS A;  5ADX L;  4D64 A;  4CPH A;  4NNT A;  1AQB A;  1BLR A;  1X8O A;  1S7D A;  4CSB A;  3HOL A;  1NDJ A;  1G90 A;  4GCQ A;  1RSU B;  1MX7 A;  3EC5 A;  4IRW A;  1ZRY A;  2FR3 A;  3STK A;  5HCD C;  2NNQ A;  4I9S A;  4JCH A;  2R8A A;  4ALO A;  5L8I A;  1KT7 A;  2QOM A;  1NGL A;  3APU A;  1OPA A;  3PGS A;  1I06 A;  2A0A A;  3LK4 2;  4NYQ A;  2P8G A;  4BBO A;  4ODD A;  1JZU A;  4N74 A;  1E2T A;  1LNM A;  3JSQ A;  4I9R A;  5GTH O;  2GTL N;  4AW8 A;  1BEB A;  3VPJ E;  5CE4 A;  5AJB A;  5K67 A;  3OD9 A;  2A5B A;  3LK3 A;  4OMW A;  3ZI8 A;  2YMS A;  4YDB A;  2CM9 A;  4B61 A;  3ELX A;  2JMB A;  1IZN A;  5KAF O;  1HXL A;  1KXO A;  1IFB A;  3FIQ A;  2OVE A;  4GGR A;  5DL6 A;  4HFO A;  3WI4 A;  3LHN A;  1N9M A;  3C76 X;  2R56 A;  1BSO A;  3KZA A;  1VWO B;  3MVF A;  1OPF A;  2RCQ A;  3RE5 A;  5G39 A;  4NP1 A;  4IB8 A;  2RTO B;  1OEK A;  4R0B A;  4B55 A;  1LIF A;  2JW1 A;  3RBY A;  4Z6J A;  2WQ9 A;  4AZQ A;  5IRU A;  3TGC A;  4N7D A;  2YPV A;  1GXA A;  2KXP A;  3RSW A;  3RE6 A;  2R73 A;  3RDO A;  4MVI A;  3CR6 A;  1SY1 A;  1ZHY A;  3OBL A;  4FSO A;  5G3A A;  4HWM A;  1PHO A;  3RZY A;  4NV7 A;  3SLT A;  1MX8 A;  3FW4 A;  4FQB B;  4RUU A;  4HPB A;  3NAD A;  5PRN A;  5K68 A;  1IKE A;  4AYE C;  1VWK B;  3B2H A;  1BJ7 A;  2XE2 A;  4I95 A;  1ICN A;  5GTI O;  3C78 X;  1R0U A;  2CM4 A;  1ZNE A;  1ZHT A;  4FBO A;  4QNI A;  2E4J A;  5DL7 A;  5FFH A;  1YWB A;  2W2B A;  2G8C O;  4C69 X;  4JGL A;  1FE3 A;  3HW9 A; 
#chains in the Genus database with same CATH homology
 3VE1 A;  4N7C A;  4WFV A;  5HWZ A;  2LFO A;  2KZ7 B;  3POX A;  1I05 A;  2RN4 A;  1JIW I;  2X8T A;  4GKC A;  5D48 A;  1HXU A;  3LK3 B;  2FT9 A;  4IAX A;  3U0D A;  4UU2 A;  3BY0 A;  3FA7 A;  4RJX A;  1IZN B;  5D47 A;  1QG5 A;  1ADL A;  2M4L A;  5HTE A;  1B4M A;  3SZD A;  1GKA A;  3AA6 A;  1Y9T A;  1MM5 A;  1HBQ A;  3CQR A;  1OBQ A;  2L9C A;  2LKK A;  3P6F A;  1D3S A;  3WOV A;  1ZND A;  1ZHW A;  3LK2 B;  3SY9 A;  3UEU A;  2ALL X;  2HZQ A;  1TOU A;  3SOT A;  2HYS A;  1B0O A;  5D45 A;  3RKG A;  3D4R A;  2JMM A;  3JQO A;  1SXU A;  1SY3 A;  5HZQ A;  4ZHG A;  1DF3 A;  1RLB E;  1A2D A;  1LPJ A;  3AAE A;  3AA0 B;  1HXX A;  1EUO A;  4GF4 A;  2RA6 A;  1H91 A;  2L68 A;  1PM1 X;  2LB6 A;  3LK2 A;  4N58 A;  4O3W A;  5H9L A;  3WJG A;  4ZGU A;  4O4U A;  1QY1 A;  1BWY A;  1ALB A;  3BX8 A;  4ZHD A;  4KRA A;  5EED A;  2CZU A;  4NW4 A;  4GHB A;  3O22 A;  1G7N A;  4XMF A;  5EDB A;  1E5P A;  2G79 A;  4ZHF A;  3K3L A;  5HCC C;  1EPA A;  4JFB A;  5G26 A;  5B27 A;  2RCT A;  3UU2 A;  3ZW0 A;  4A1Y A;  3F6Z B;  5K06 A;  3IA8 A;  4FRT A;  3LV4 A;  5LJK A;  4YBU A;  1SA8 A;  2LA7 A;  3UEV A;  2FTB A;  4INN A;  4TJZ A;  3CMP A;  4ZFX A;  2XE1 A;  5IO7 A;  5H9K A;  4KH8 A;  1U18 A;  1G5W A;  3WJE A;  3GAQ A;  1OSM A;  1HMS A;  1BT9 A;  4IB7 A;  2GJ5 A;  4D6B A;  2OMF A;  3VG5 A;  2XE3 A;  3SYB A;  4O3X B;  2JU8 A;  3NQK A;  4O4S A;  2K0L A;  2KXP B;  2BS6 A;  4ORY A;  1KGL A;  5AQ6 A;  3TF6 A;  3RBH A;  4HPC A;  4BVM A;  2R74 A;  4I3B A;  1YUP A;  3CWK A;  3AA1 A;  2FRS A;  3U03 A;  3UPG A;  1LFO A;  4GDZ A;  3OJY C;  1CJ5 A;  1YWA A;  2HLV A;  3AA7 A;  7PRN A;  2Y0H A;  1YP6 A;  1FEN A;  2AT5 X;  3Q6L A;  2QTK A;  3ZQ3 A;  2AT6 X;  1FTP A;  2MWH A;  2GTF X;  1MVG A;  5FQ6 E;  3CBC A;  1HBP A;  5BVS A;  1DV9 A;  2BHV A;  4IBA A;  2MM3 A;  4D65 A;  1GFM A;  2BLG A;  4ML7 B;  3NX1 A;  4OS8 A;  2KTD A;  5H9N A;  4COT A;  1GM6 A;  4FMS A;  5IYU A;  2FR2 A;  3NQ3 A;  4QYN A;  4ARH A;  3P6D A;  3NBX X;  1LIC A;  2XG6 A;  4LSI A;  3NQ9 A;  1G85 A;  1G74 A;  1S44 A;  2QO5 A;  1Y9L A;  4K19 A;  4WBK A;  3TGB A;  2RD7 C;  3BU9 A;  4I3C A;  1P4T A;  4LQZ A;  1GFN A;  1CRB A;  2IFB A;  1TXL A;  1EI5 A;  4PSQ A;  4YFQ A;  3AKN A;  2WWP A;  2BT9 A;  2PRN A;  2POA A;  3BSZ E;  3L4R A;  4G76 A;  3B2I A;  3VY9 X;  3S5V A;  2FS7 A;  1ERB A;  2HMB A;  3P6E A;  4ZH6 A;  3S60 A;  4GCP A;  5LJH A;  3HWB A;  5GV0 A;  2O4V A;  5HAE A;  4FOZ A;  4YH0 A;  4AZR A;  5H8T A;  4LSF A;  4FGI B;  1E02 A;  8PRN A;  3LK4 1;  2F1V A;  2XMX A;  2KW1 A;  4GE1 A;  4Y0P A;  2MNH A;  3HK1 A;  5KIC A;  1MUP A;  1AB0 A;  2W2F A;  4CV7 A;  3FLL A;  4ES7 A;  4KR8 A;  3DA3 A;  1B8E A;  3ELZ A;  4YGZ A;  2W2A A;  3E3C A;  4YFP A;  3ZUO A;  2F1T A;  1HQP A;  4RJW A;  5EDC A;  1NP4 A;  4AZO A;  2N2L A;  1D2U A;  2XTR A;  4UU3 A;  4O3Z A;  1T68 X;  1LKE A;  5B29 A;  2LBV A;  1SXW A;  1BRP A;  1AEL A;  1DZJ A;  1GT3 A;  3WJB A;  2Y2X A;  2AMM X;  2QO4 A;  3PRN A;  4ZHH A;  1ACD A;  1QY0 A;  2ACP X;  3WBG A;  1SY0 A;  1THQ A;  4Y0R A;  5FQ8 E;  1JYJ A;  4XMC A;  2WUT A;  4I3D A;  4ALB A;  4Z3T A;  1CBS A;  1GX9 A;  1X89 A;  2ANS A;  3B2L A;  3P6H A;  4U8U M;  3TZS A;  1GT1 A;  2EU7 X;  3JS1 A;  2KT4 B;  3A2S X;  3NX2 A;  3FEK A;  3APX A;  2XKL A;  4KCA A;  2X8F A;  4LZV A;  1GKA B;  3AA6 B;  1E54 A;  4ORU A;  1X8Q A;  2QMI A;  4FBR A;  3KQ0 A;  3POR A;  4YKO A;  1T8V A;  3POQ A;  4N59 A;  3FEP A;  2X46 A;  4ZH9 A;  1TW4 A;  2A2G A;  3NR3 A;  2KD2 A;  1JJJ A;  2MJI A;  3ZW1 A;  3FEN A;  3SAO A;  3PPT A;  4U8U N;  5JDP A;  3FA6 A;  3EMN X;  5F6Z A;  1JV4 A;  4IAB A;  3QRC A;  3KFF A;  4KT5 A;  4FSP A;  4NLI A;  3AAE B;  1QFT A;  3GE2 A;  4GNY A;  2WEW A;  4LSE A;  2Q9S A;  4XNK A;  3EM0 A;  5DL5 A;  4LKT A;  2K62 A;  3ZUI A;  6PRN A;  5DPQ A;  1KZX A;  3CBS A;  5DG4 A;  3D97 A;  5C0N A;  3QKG A;  5IO5 A;  1EW3 A;  4OS0 A;  4D5U A;  2JU7 A;  3UEX A;  3BLG A;  4FT6 A;  3DSZ A;  1TVQ A;  1QJP A;  2L5P A;  1ZNH A;  2NND A;  2WEX A;  1KQW A;  3KFG A;  2LBA A;  5EZ2 A;  1JYD A;  2JOZ A;  1S2P A;  3ZW0 B;  4A60 A;  4AZM A;  1B56 A;  3APW A;  5AFU K;  3HTY A;  4U9C A;  2OFR X;  4IMO A;  4AYH A;  4YFR A;  1H6S 1;  3T20 A;  3ZW2 A;  1GFO A;  1XCA A;  4HPD A;  5FQ7 E;  4YMY A;  1OPB A;  2NP1 A;  2A13 A;  1OEE A;  5HBS A;  3SZV A;  2ASN X;  5FEN A;  5BVQ A;  2Z4H A;  2Y7S A;  4DQ4 A;  4EFG A;  4IMN A;  3H3I A;  5L8O A;  1KQX A;  3P24 A;  4KC7 A;  2XTQ A;  3AA1 B;  2GE4 A;  2Z4I A;  5D8J A;  3SY7 A;  3AA7 B;  1GX8 A;  2W80 C;  5F1E A;  3SYS A;  1EIO A;  4IB9 A;  4NLJ A;  4PJ2 A;  1RBP A;  1BSQ A;  2Y0L A;  4TKH A;  1I04 A;  2ZAG A;  1ERX A;  1QY2 A;  1X8N A;  1MPF A;  4XME A;  3FYX A;  4YGH A;  3VY8 X;  5F58 A;  1DC9 A;  3C77 X;  3PQS A;  3UAQ A;  3VG7 A;  1JJX A;  4GU8 A;  1IKJ A;  4AUI A;  4QRL A;  1CBQ A;  2FS6 A;  4QGV A;  4O9S A;  1YS5 A;  4XMH A;  3AAA A;  2HNX A;  1IW2 A;  4F4B A;  3MX7 A;  4WFU A;  3WVM A;  3T24 A;  3FW5 A;  2YNK A;  1O1V A;  5AEO A;  4Y0Q A;  2Q39 A;  5CYB A;  5AJC A;  1PRN A;  2OVA A;  4NYR A;  4CK4 A;  3V8U A;  2KTS A;  3C5O A;  4RUN A;  2OVD A;  5LKF A;  1EQD A;  1QQS A;  4A8Z A;  3MBT A;  4ORX A;  1GFP A;  4LSH A;  1LID A;  1VYF A;  5D4A A;  3O0E A;  1QJ8 A;  4QAE A;  3BDR A;  1Z24 A;  3OE3 A;  3AKM A;  1KZW A;  3F9D A;  1GFQ A;  2AT8 X;  1CBI A;  4EDE A;  1A57 A;  1IIU A;  3D96 A;  1E06 A;  1ZNK A;  5HZ5 A;  2FGR A;  1LF7 A;  4GRJ A;  2G7B A;  3HWG A;  1HMR A;  4ID2 A;  2F73 A;  2XE5 A;  1JBH A;  3G7X A;  4U8U O;  4ZR2 A;  3VG2 A;  5KHP A;  5LJC A;  1MM4 A;  5ADX K;  3PQU A;  4TLJ A;  4HPA A;  2QM9 A;  4Y0S A;  3PEC A;  3FEL A;  4YCH A;  4O3Y A;  5H9A A;  4EEJ A;  4FBV A;  1EXS A;  5T5F A;  2Q2M A;  4TKB A;  4AYI D;  5BYP A;  2CBR A;  2ACO A;  4MIS A;  2AT0 X;  3VG4 A;  1ZNG A;  4NNT A;  3STM X;  4D64 A;  2JN3 A;  2NNE A;  1AQB A;  1YIV A;  3FR4 A;  1BLR A;  2Y0K A;  2ZLD A;  2X8S A;  3FA9 A;  3ZWE A;  1ML7 A;  1X8O A;  5HA1 A;  3B2K A;  1KT5 A;  1S7D A;  4QGX A;  4CSB A;  2POR A;  3HOL A;  2N2M A;  1G90 A;  1GT5 A;  4FRX A;  4XMG A;  4GCS A;  4GCQ A;  4YCE A;  5EPQ A;  1MX7 A;  3PED A;  1O1U A;  1XKI A;  4A1H A;  3STN A;  3VG6 A;  1VYG A;  3T0S A;  1ZRY A;  3D95 A;  2FR3 A;  3DA4 A;  3DTQ A;  4LZU A;  3STK A;  3ZW1 B;  5HCD C;  2AH7 X;  2NNQ A;  2OFM X;  4L1N A;  1KT4 A;  2F09 A;  4I9S A;  4JCH A;  1BM5 A;  5D5D A;  4RL9 A;  5JR8 A;  5F6B A;  4ZJ0 A;  2MHD A;  1ZHX A;  1YP7 A;  4ALO A;  1KT7 A;  3APU A;  1FEM A;  1NGL A;  1IFC A;  5L8I A;  3JTY A;  1BRQ A;  1OPA A;  5LJE A;  3GP6 A;  4FZN A;  1FDQ A;  4ON1 A;  2GTL M;  4DQ3 A;  4E1S A;  3VG3 A;  1OBP A;  1GT4 A;  1OBU A;  4OS3 A;  4KC8 A;  1I06 A;  2A0A A;  1EPB A;  3EBK A;  3TZG A;  4BOE A;  1EII A;  4NYQ A;  2P8G A;  2OZQ A;  4QZU A;  4D6A A;  3LK4 2;  4ODD A;  3NSG A;  1JZU A;  1LIB A;  5IO6 A;  2J1N A;  2JU3 A;  4FZM A;  3PH5 A;  1N0S A;  4RLB A;  1LNM A;  3JSQ A;  1NP1 A;  4I9R A;  1L6M A;  1URE A;  5ADX L;  1HN2 A;  3G7G A;  2GTL N;  4ORS A;  4TNN A;  1SMP I;  5HA0 A;  4GZV A;  2MHL A;  4AW8 A;  1BEB A;  3PP6 A;  4EQA C;  4FES A;  1QJ9 A;  1DFV A;  3VPJ E;  2M07 A;  4MVL A;  1ZNL A;  2FGQ X;  4AKR A;  5CE4 A;  3S5X A;  3POU A;  5AJB A;  4E1T A;  2X45 A;  2KZ7 A;  3P02 A;  3OD9 A;  3P6G A;  2AT3 X;  4QZT A;  4U3Q A;  4WHI A;  5EEE A;  3LK3 A;  4OMW A;  3ZI8 A;  1PEE A;  3U9P C;  5HZ8 A;  4M7M A;  2YMS A;  3BS2 A;  1P6P A;  4YDB A;  4AZL A;  5AFU L;  3WJC A;  2CM9 A;  3FR2 A;  3O19 A;  4I6S A;  4B61 A;  1PBO A;  2GC9 A;  3ELX A;  4AYD C;  3IFB A;  2JMB A;  1IZN A;  2L67 A;  5L8N A;  1E00 A;  2FWV A;  5LKE A;  1QWD A;  1AVG I;  3T1D A;  1GGL A;  4XMD A;  5FVN A;  3CQN A;  1KXO A;  4IB6 A;  4AFK A;  5FAZ A;  3PH6 A;  4L3R A;  1BH3 A;  5HZ9 A;  5BVT A;  1IFB A;  3FIQ A;  2OVE A;  1A18 A;  3AAA B;  1OEJ A;  5F7G A;  3HWD A;  5DL6 A;  4YDA A;  4BQU A;  4HFO A;  3RWX A;  5HZ6 A;  3WI4 A;  3EYC A;  1Q9G A;  4GK9 A;  3VU1 A;  3AA0 A;  3LHN A;  4GET A;  1DZK A;  2QOS C;  5LJG A;  2AKQ A;  2J4U P;  1LIE A;  4QGW A;  2CZT A;  3UEW A;  1SY2 A;  3C76 X;  4MVE A;  2R56 A;  1BSO A;  4MVK A;  3KZA A;  3MVF A;  3BU1 A;  1OPF A;  4QYP A;  2RCQ A;  2AL0 X;  3I0A A;  1O8V A;  1KT3 A;  4NP1 A;  4IB8 A;  3HWE A;  4KII A;  3HOE A;  1BBP A;  3VZW X;  2G78 A;  4XNL A;  3WJF A;  1OEK A;  3FMZ A;  2WR6 A;  1ICM A;  1Q9F A;  4R0B A;  3O2Y A;  2K23 A;  1LIF A;  2JW1 A;  3RBY A;  4TQ2 A;  1QFV A;  1TOW A;  2WQ9 A;  4GH7 A;  4YGG A;  4AZQ A;  3TGC A;  4N7D A;  2WSJ A;  2Q2P A;  2YPV A;  1GXA A;  1YWD A;  3RSW A;  2KXP A;  2ZAI A;  2X27 X;  2R73 A;  2CBS A;  1X8U A;  3ZZV A;  4FZL A;  1FEL A;  1U0X A;  2ERV A;  1X8P A;  5LJB A;  3P6C A;  3B2J A;  3FR5 A;  2DM5 A;  1SXY A;  1KOI A;  2LFU A;  4MVI A;  3BX7 A;  3EBW A;  3WI5 A;  2HZR A;  3CR6 A;  1SY1 A;  5LJD A;  1BXW A;  1ZHY A;  3EMM A;  3OBL A;  2OVS A;  3FA8 A;  4IAW A;  2FLJ A;  4FSO A;  2WQA E;  4HWM A;  2XST A;  5KID A;  4BUM X;  2BS5 A;  3KVD D;  1PHO A;  3RZY A;  4AYM C;  3KFH A;  4FUV A;  2GTL O;  1CBR A;  1VPR A;  3VE2 A;  4LKP A;  3F8A A;  4AYN A;  1MX8 A;  3FW4 A;  3APV A;  4O4X A;  3I17 A;  1HXT A;  4FQB B;  4RUU A;  1SXX A;  2MO5 A;  1PMP A;  4HPB A;  1MDC A;  3NAD A;  2KDY A;  4RLC A;  2W81 C;  4PUX A;  1IKE A;  1QAB E;  4ORR A;  2QO6 A;  4ZCB A;  4G75 A;  5PRN A;  4AYE C;  2A3F X;  1EAL A;  2M06 A;  4ZGF A;  1DZM A;  4M6S A;  1U17 A;  1X71 A;  3B2H A;  3N91 A;  4NNS A;  4O4O A;  1ZHZ A;  4KR4 A;  4EXZ A;  3BRN A;  1BJ7 A;  4MIR A;  2XE2 A;  4AZP A;  4YBP A;  3NP1 A;  4GNW A;  1ICN A;  4I95 A;  3WXQ A;  2ODJ A;  1DZP A;  1KT6 A;  2KC0 A;  1HMT A;  3VZU X;  3C78 X;  1R0U A;  1BSY A;  1UZ2 X;  2CM4 A;  1ZNE A;  1ORM A;  1ZHT A;  4ZHC A;  4FBO A;  4QNI A;  4YKM A;  3WJD A;  1T0V A;  1I4U A;  2Q4N A;  5DL8 A;  2E4J A;  3TGA A;  2RQ0 A;  5DL7 A;  5EE2 A;  5FFH A;  2ZFG A;  2N93 A;  5HCE C;  2K4T A;  3VZT X;  3HWF A;  3QRA A;  3K19 A;  4AKM A;  3KFI A;  4O49 A;  4QQ1 A;  1YWB A;  2W2B A;  5HTD A;  3NPO A;  2LHF A;  2YG2 A;  2A2U A;  4ORW A;  4C69 X;  4OMX A;  4TKJ A;  3FYF A;  4JGL A;  2O62 A;  1FE3 A;  2PY1 A;  1YWC A;  3HW9 A;  4AZN A;  3S26 A;  1A3Y A;  4AKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...