4O4XA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
513
structure length
503
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTALNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDINGKKMVAVACCSNLEYMKFGQLWQQTEKQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
molecule keywords TbpB
total genus 112
structure length 503
sequence length 513
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA02
4O3ZA 3VE1A 4AYNA 4AYEC 2LFUA 4O3WA 4QQ1A 4AYDC 4Z3TA 4O3XB 1YS5A 2KC0A 4AYID 4U9CA 2KDYA 3PQSA 3HOEA 4O4XA 2W80C 2Y7SA 3HOLA 4O4UA 3VE2A 5T5FA 3KVDD 4AYMC 5EE2A 4O3YA 4O49A 3UAQA 2YPVA 2W81C 3PQUA 3V8UA
chains in the Genus database with same CATH superfamily
3BLGA 4JGLA 3T24A 3BRYA 1DZPA 3VG4A 3NX2A 2RTLA 5HCCC 3F9DA 1DZKA 4NW4A 2M06A 2QCBA 5HTEA 3KQ0A 1E06A 4GUZA 3VG6A 2FS7A 4XMGA 3EBWA 1JJJA 3STMX 3A0BO 1RAVA 1VWPB 1YWCA 2AVIA 1ZHYA 3ELXA 3VPJE 1FELA 1KT6A 2QM9A 4GH7A 2BHVA 3ZW2A 2XKLA 1SY2A 4PUXA 2KW1A 4BGFA 4YGHA 5HA1A 4NP1A 2A13A 2MJIA 2ACOA 5LKFA 3NADA 2X4MA 4GGTA 4FT6A 2X34A 4ID2A 3OJYC 3NSGA 5HCDC 3PGUA 2YMSA 4GNWA 3TF6A 2I5ZO 1B8EA 5EDBA 1PBYA 2OFRX 4HPDA 1QY1A 4G75A 5ADXK 1DF3A 3HWFA 5D8JA 3PH5A 1QFTA 4C69X 1FTPA 2CZUA 1QJPA 4FBVA 4YFRA 3WYQA 1VWQB 2ODJA 5DL5A 2J1NA 4TKJA 3DWOX 1EALA 4EEJA 1LICA 1E00A 3G7XA 1QJ9A 3O2YA 3FLLA 1LELA 4MVKA 2OL7A 4XMCA 4TKBA 3FEPA 3RDMA 4LSFA 4IABA 3PECA 1L6MA 4O4XA 3VHIA 5B11O 3T20A 4M6SA 3ZW0A 1VYFA 1E2TA 1EIOA 2K0LA 1NP1A 4I3CA 4IB6A 5AJCA 2KZ7B 3FDCA 3L4RA 1O1UA 2F1VA 1Y0GA 3QKGA 2UYWA 1IZNB 2J4UP 1IJ8A 1HY2A 5IYUA 2RCTA 2NP1A 1MM9A 2X46A 3GP6A 1TOUA 3JTYA 2ANSA 2QTKA 2HMBA 1HXXA 1JZUA 4EKVA 2Y0KA 2LHFA 1PBOA 2WWPA 2IWVA 1O1VA 4CK4A 1I04A 3APXA 4CV7A 3BU9A 3IA8A 1X8QA 4MVEA 5H9AA 2CM4A 3WVMA 3FENA 2AT0X 2VDFA 2AT5X 1EI5A 1VYOA 1KGLA 4ORSA 4JCHA 2RTMA 4ZR2A 3WZPA 5L3YA 1CJ5A 4ON1A 4BCSA 3T1DA 2IZIA 5H9NA 2A2UA 1MVGA 2WSJA 4CPFA 4NNSA 1MX8A 3PP6A 5G38A 1G5WA 1AELA 2IZDB 2NNDA 4LKPA 1B4MA 1N43A 1LCVA 1SREA 1FDQA 2POAA 2JOZA 5E79O 2XE3A 4FZLA 2RQ0A 3NX1A 2HZQA 2OMFA 1JJXA 4AYEC 3FR5A 3FW5A 4RJWA 4E1TA 1SRJA 4CSBA 1THQA 1CBRA 5D5DA 4AZLA 2X8SA 2BLGA 1JBHA 4GCQA 1KT5A 2FGQX 2OFBA 4Y0RA 4CDCA 2CBSA 4Y0QA 2CAMA 2IZCB 1HMRA 1KL3A 4PR7A 8PRNA 4ZFXA 4ES7A 1KT4A 3KZIO 4O4SA 1I06A 2RTRB 4BVMA 3HOLA 4TKHA 1LDQA 1VWFB 2R73A 5EE2A 2AKQA 1DF8A 2NNQA 3VHHA 3RE6A 1DC9A 2JMBA 3CWKA 3P6GA 2R4LA 3Q34A 1KT7A 3POQA 4U3QA 1OBPA 3MM0A 3EMNX 4CPIA 3AA7A 5G39A 1ZHZA 4O3YA 4PSQA 1H6S1 1AVEA 1A2DA 3HK1A 4WFUA 3CQNA 4C00A 4QGWA 2A5BA 3H3IA 3SZHA 1JQPA 5KIDA 4FQEA 1GFQA 4AYDC 5LJBA 3ZZVA 1D3SA 1I9HA 1GGLA 4IB8A 2RTPB 5HAEA 5IO7A 3LK3A 4ORYA 2ZSCA 2ZLDA 5IRUA 4ZGFA 4YGGA 4XNKA 3VG3A 5GTIO 5HZ9A 1ICMA 3NBXX 4UU2A 4DNEA 1FE3A 3APWA 3WOVA 3PQSA 5BVSA 3ZI8A 1GXAA 6PRNA 1NBXA 3T6LA 5B5GA 2F1CX 1IFCA 3ZWEA 1LPJA 4D6AA 4CPHA 1ZNKA 2F09A 3FMZA 4A8ZA 1TVQA 4I3DA 2FWVA 1DZMA 4CDEA 2OY5O 1G7NA 1O8VA 4LZVA 5D45A 3OD9A 3APVA 3BX8A 3I0AA 4IL6O 3VY9X 5HTDA 4AZPA 1YUPA 3SYSA 4BX7B 4NYRA 2HYSA 1N9MA 1PHOA 2WQAE 1SWLA 4JHQA 4QYPA 1GX9A 1N7YA 2RTCB 2OFAA 1T1LA 5B2AO 3NJTA 2MHDA 3SLTA 3BS2A 3UPGA 3PEDA 2Q2PA 1SLDB 1MEPA 1OBUA 4Z28A 2DJFA 4YFQA 1LIDA 1GM6A 4ALOA 1VWAB 4Y0PA 2QO4A 4TNNA 2AT6X 2X8TA 2WEWA 1YS5A 3VZWX 1BRPA 1EQDA 3VGWA 2K4TA 3VZTX 2E4JA 2W2AA 2Z4HA 2JN3A 1GKAB 3HWGA 3PH6A 4GK9A 4FZNA 3AA0A 3CQRA 1QY0A 1ZHXA 1BJ7A 4FRTA 3UEXA 3FIDA 3ZUOA 1NGLA 4O49A 1OEEA 1SWDA 1SWBA 5HWZA 3B2LA 1VWGB 2L67A 4LQZA 1KZXA 3KFGA 3LK2B 2AF5A 5H8TA 2JW1A 4AYNA 1SXWA 1GFOA 1KQWA 3SYBA 1X8PA 3PGRA 2QMIA 1EPAA 3KFFA 3SOTA 1N0SA 1EIIA 2X32A 2A0AA 4AZRA 1SA8A 5L8OA 1HXZA 4YMYA 3FYXA 3K19A 2RTEB 3ZUIA 2IFBA 1OPBA 2M4LA 2C1QA 2GTLM 1GX8A 2RD7C 4YKMA 5PRNA 2Y7SA 1T0VA 2WUTA 2A2GA 3LHNA 4LSEA 3MG5A 1GT4A 1UYOX 1PMPA 2PI3O 2R4NA 4TJZA 5G26A 3D96A 4N74A 3IFBA 3KFIA 1FENA 3PK2A 4RLCA 2R56A 2F01A 4I3BA 4B55A 3ELZA 3BX7A 1ACDA 3CKGA 4D65A 1Y9TA 2PRNA 2BC3A 4KCAA 1SRFA 2AMMX 1VWEB 1PTSA 1SWAA 2X8FA 5EDCA 4N59A 3F6ZB 2JU7A 1VWBB 4AYMC 2KXPA 1EXSA 3RY2A 1HQPA 1N9YA 4XNLA 4AZQA 4HPBA 5K06A 3RZYA 1LNMA 3P6EA 1BRQA 1GT5A 4ZHGA 3P6HA 2Z4IA 2A5CA 3AKNA 4BX5B 4IRWA 3AAEA 3P02A 3DSZA 5CYBA 3BS0A 1SWNA 1KL5A 2IZBA 5K68A 3PQUA 3WI5A 1AQBA 2R74A 4A60A 2X45A 3D9WA 1JIWI 4UB6O 3SZIA 2Q39A 1BM5A 1X89A 3EC5A 3NP1A 1SRIA 2HLVA 2GTFX 4FSOA 2OFMX 4FOZA 4BQUA 1KXOA 4YH0A 4QNIA 2JGSA 2FLJA 1H91A 2G8CO 1MPFA 1LIBA 4CPEA 1SWSA 1SWPA 4QGVA 4HPAA 5F1EA 1N4JA 4FZMA 4ZH6A 4INNA 2MHLA 4ZHHA 4B61A 1HMSA 1FEMA 4YBUA 3DWNA 2R88A 3DTQA 2A3FX 3MBTA 1CBSA 3PDFA 1B56A 3UEWA 2RTHB 2LFOA 5CHKA 1HXUA 2W80C 2OVSA 3F8AA 3FA8A 4GHBA 1PEEA 3BY0A 4TQ2A 1JYDA 4FBRA 5LKEA 3BU1A 5H2FO 4ZCBA 4YDAA 1LUQA 4U8UM 2GJ5A 4IBAA 3G7GA 2OF8A 5D4AA 1QQSA 1WBIA 4QAEA 1K3BA 1MX7A 4I95A 4O4UA 3LTWA 1E5PA 1MOYA 2OYBO 1W6FA 2A8GA 2G79A 4AZMA 3T6FA 1IZNA 3ZW1A 5EPQA 5DL6A 5BYPA 3AAEB 3U9PC 4LZUA 3ZQ3A 5C0NA 5HZ8A 5JR8A 2OY7A 1ZRYA 3EYCA 2Y32A 1FJ1E 5KHPA 1STSB 1HBQA 1P6PA 4NV7A 4WBKA 4GNYA 3LV4A 2QO6A 1HXTA 1ALBA 1NP4A 3WJGA 4GETA 4GU8A 3POXA 2ACPX 2XE1A 1AB0A 2XTQA 2F73A 1YP7A 1ML7A 1NQNA 2RTBB 2Y3FA 4GD9A 4AUIA 4GCPA 3NQ3A 2RTIB 2WPUA 5IXGA 3A0HO 1BSOA 3D95A 4G76A 2IZAA 3O0EA 1T8VA 4U8UN 1G90A 1W4TA 1CBIA 4AYHA 4AKMA 2AXTO 1G74A 2IZHB 4YVBA 5FAZA 1X8OA 4XMHA 1SRGA 5LJHA 4YKOA 2AH7X 1LCZA 1I78A 4N7DA 4I6SA 3ZW0B 2RCQA 1ORMA 1VPRA 1XKIA 2R4PA 3C77X 4ZJ0A 5GV0A 1HBPA 2QOSC 5KAFO 5TISO 4CTDA 4Z6JA 1BH3A 1LIEA 5HBSA 5LJKA 2RTOB 3P6DA 3KZAA 3AAAA 5B5EO 3FW4A 2RTJA 4GCSA 2NNEA 2OY1O 2JQYA 1QJ8A 1VWIB 4Y59A 1NDJA 1LF7A 2XMXA 4TLJA 2GTLN 4OS3A 4RUUA 1SMPI 2IZEB 3DA4A 2K23A 2Q4NA 4Z2VA 1K24A 4HWMA 5HZQA 2CM9A 4F4BA 4K19A 1SY1A 4BOEA 3APUA 4O9SA 1HMTA 3HPEA 4N7CA 3STKA 5G3AA 3TZGA 2CBRA 4GF4A 3CBCA 4IAWA 2RTDB 3NQKA 1SWCA 4JFBA 2UZ2A 3NR3A 1ERXA 3WZQA 2XTRA 3I17A 4AKRA 4DCBA 1MDCA 1VWRB 1D2UA 3PPTA 3PORA 1G85A 3HW9A 2YPVA 4ZHFA 2JU3A 2L68A 3RKGA 5L8NA 3T2WA 1MK5A 3SLOA 1IW2A 1T16A 4UU3A 1KFFA 4EQAC 1AVGI 2G5LA 3RWXA 3AA0B 2Y0LA 4I60A 1OSPO 3EW1A 5F2BA 3RDXA 2OVAA 1VWMB 1VWCB 2OZQA 1SWKA 4AZNA 3EBKA 2L9CA 2W81C 4ORXA 3U03A 3TGBA 4O3ZA 1LDOA 2C1SA 5F6ZA 1JMZA 2HKDA 1GT3A 4D5UA 1LCWA 3HWDA 2PY1A 3B2JA 3AAAB 5FVNA 2RTAA 1ERBA 2WR6A 2ZAGA 4R0BA 1IFBA 4UB8O 1ZHWA 4LSIA 2FGSA 4ML7B 5AFUK 4CPHB 1STRB 1SY0A 1SLEB 1P4TA 4FQBB 1MM5A 2I5VO 4O3WA 1SWUA 2ERVA 4GRJA 2VFCA 4ORWA 1QG5A 4BX7A 2N2LA 1GT1A 4Z2OA 1ZNGA 1YWAA 2MNHA 2GC9A 3WYPA 1PRNA 1BXWA 3JS1A 3ZW1B 2XE5A 3VG5A 3PGSA 3SY7A 2ZAIA 1JJUA 1BSQA 3T2XA 4YGZA 3T0SA 1SWOA 3E3CA 4RUNA 5K67A 4FBOA 3FYFA 3NQ9A 2KXPB 2WJQA 2RTFB 4BX6A 3RBHA 2FRSA 1YWBA 2DJGA 4JNJA 1XCAA 2GTLO 4GGZA 1Q9FA 4O3XB 1ZNEA 2WJRA 5F7GA 5ADXL 1VYGA 3VE2A 1SLFB 4OELA 1DZJA 5IRWA 3WXQA 3WJDA 5BVQA 2OL8O 2FR3A 4NLIA 1LFOA 4YFPA 3MX7A 4FGIB 3B2KA 1A57A 3TGAA 4KRAA 2JMMA 1KQXA 4Y5DA 1WUBA 3KFHA 3VZUX 1U18A 4IAXA 5F6BA 2AT8X 1S2PA 2XSTA 3KVNA 1SXXA 2IZLB 4E1SA 5H9KA 3D4RA 5HCEC 3AA1B 1YWDA 3U0DA 4GJSA 2FR2A 4NNTA 4LSHA 1GFNA 1SY3A 5DL8A 3PRNA 4AKRB 5CSEA 2FS6A 2R4OA 3SY9A 3JSQA 3PF1A 4WFVA 4KH8A 2GE4A 5FQ7E 1S44A 4KC8A 1SWJA 3K3LA 3P24A 3A2SX 1TW4A 2KD2A 3D97A 1BBPA 1STPA 5FQ6E 4C4VB 4HPCA 1DV9A 1HN2A 2VFBA 1S7DA 3V8UA 5AJBA 4U8UO 5LJCA 3HWBA 1KL4A 3P6FA 4IB9A 1RSTB 4QZTA 3O19A 3C5OA 4ODDA 2QO5A 2FKJA 4OEMA 3VE1A 4YBPA 2LFUA 1X71A 2OVDA 3AUMO 5FENA 3SAOA 4O4OA 5B27A 4I9RA 1OSMA 4DQ3A 3WJEA 2KC0A 3LK2A 3AA6B 5B5FA 2MF6A 4BJ8A 4CDDA 3UEUA 3UEVA 4MIRA 1BWYA 4FRXA 1MUPA 4QGXA 2Y2XA 3UU2A 3JCUO 4C5PA 1VWNB 4OMWA 4EXZA 3AKMA 3POUA 4RL9A 3FEKA 1VWDB 2FKGA 4AYID 1JMXA 3FA7A 1GX3A 1CRBA 1VWLB 2IZKA 1GFMA 1IKJA 2YNKA 1BEBA 5EZ2A 5B66O 4XMFA 3RDUA 4OS0A 2FT9A 4GKCA 3JQOA 3QQ2A 2RTQB 2L5PA 4WHIA 4ZHDA 4OKAA 3SZVA 2WEXA 5CE4A 4QQ1A 2X27X 3VG2A 1OBQA 1Z24A 4KT5A 3FR2A 2K62A 1QABE 1X8UA 4Z2PA 3BSZE 1SWHA 2RTGB 3QRAA 2CZTA 2M07A 4DQ4A 1UYNX 4A1HA 2BSZA 2N93A 1B0OA 1SXUA 3HOEA 4HFOA 1R0UA 3DZMA 4A1YA 1OPFA 3X00A 1OEJA 4PJ2A 2O4VA 4L3RA 5KAIO 3GE2A 3AA6A 1PM1X 3CMPA 3O22A 3S26A 1VWKB 4QZUA 1S5LO 4Z3TA 1RLBE 3FR4A 4ZH9A 4FUVA 4GGRA 1VWJB 2OVEA 2HZRA 3RSWA 3GAQA 3WU2O 3S5XA 5GTHO 3HWEA 2KTDA 3FA9A 4RJXA 1LIFA 3LK42 3EW2A 1IKEA 2DM5A 1ADLA 4JO6A 3SLJA 1UZ2X 3QRCA 3SZJA 2XG6A 2MWHA 2IWWA 3BRZA 4QRLA 4AZOA 2G78A 1OPAA 2FHNX 1TXLA 5AFUL 2GH7A 3S5VA 5HZ5A 1X8NA 4ZGUA 4FMSA 5BVTA 3AEHA 3WJBA 1HQQA 4CDFA 1Y52X 1KT3A 4COTA 5KICA 4M7MA 4PJ0O 1DFVA 1QWDA 2Q2MA 2EU7X 3SZDA 3RBYA 3WZOA 1LKEA 2HNXA 5DPQA 5L8IA 5IO5A 1A3YA 4GDAA 4Z27A 3FELA 1ZNHA 2IZFB 4IMOA 2LBAA 2MM3A 4U46A 3B2IA 3CR6A 5B3MO 3UAQA 1BT9A 1EUOA 1GFPA 3VY8X 3RDOA 1NC9A 4K3BA 5AEOA 4ZHCA 2ALLX 5HZ6A 1YIVA 1SWEA 2IZGB 1YP6A 3RY1A 3WJFA 2BS6A 2BT9A 1QY2A 4MVLA 2RN4A 2R8AA 4C4VA 2OF9A 3EMMA 4N58A 1UREA 3CBSA 2P8GA 3CKFA 3RE5A 2N2MA 1VWOB 2R89A 3LK3B 1QFVA 2W2BA 5D48A 1Y9LA 4MEEA 1JYJA 1SWFA 2JU8A 5LJGA 1I05A 2C4IA 3NPOA 2RTKA 1RSUB 1W5RA 1RXHA 3C76X 2IZJA 2OL6O 5JDPA 4FESA 2Y0HA 1RXKA 4U9CA 2LBVA 3WBGA 4KR4A 4I9SA 1ICNA 2LA7A 5H9LA 5LJDA 2Q9SA 4K3CA 5IO6A 3STNA 1T68X 5FFHA 1VWHB 3AA7B 2X56A 4ALBA 4BX5A 1EW3A 4NLJA 4KC7A 5LJEA 4ARHA 1RBPA 3Q6LA 2LKKA 4XMDA 3OBLA 1ZNLA 2XE2A 5DL7A 4EFGA 2BS5A 3AA1A 1CBQA 2WVPA 4BBOA 5JD2A 5DG4A 3OE3A 1BLRA 5EEDA 4YDBA 5F58A 1Y53X 7PRNA 4D6BA 1SWQA 4MISA 5B29A 2AT3X 4N75A 4GJVA 5IRAA 4BUMX 1U17A 1JV4A 4KR8A 3DA3A 3VHMA 2AL0X 4NYQA 1EPBA 4IMNA 4RLBA 2F1TA 5HA0A 5AQ6A 2O62A 3WJCA 1SXYA 4BX6B 4GDZA 3BDRA 3EM0A 3WI4A 3TGCA 2Y3EA 2PORA 1SWGA 3S60A 4EDEA 4ORUA 3FIQA 5D47A 1SLGB 1AVDA 3P6CA 4AW8A 4FSPA 2RA6A 2KT4B 2FHLA 4GZVA 1NQMA 1OEKA 4LKTA 3C78X 3LK41 2FGRA 2X9KA 1IIUA 4YCEA 5EEEA 2G7BA 1Q9GA 4KIIA 1HXLA 1TOWA 1Y55X 4Y0SA 2WQ9A 1ZNDA 3FA6A 3RDQA 4MVIA 5B10O 3BRNA 2KDYA 4NV8A 3RDSA 4OMXA 1E54A 1MM4A 2ASNX 2ZFGA 2KTSA 4QYNA 3WZNA 4OS8A 3HTYA 2W2FA 1I4UA 2LB6A 1BSYA 3VG7A 4GE1A 4YCHA 1A18A 4ORRA 3N91A 3MVFA 2MO5A 1E02A 2KZ7A 2YG2A 3KVDD 1KZWA 1KOIA 2OY8A 1GKAA 1U0XA 1SWRA 5FQ8E 3TZSA 1RXJA 2FTBA 4XMEA 2QOMA 2RTNB 4IB7A 3VU1A 5T5FA 1SRHA 4L1NA 2X55A 3B2HA 1SWTA 4D64A 4AFKA 1ZHTA
chains in the Genus database with same CATH topology
1QABE 3BLGA 1GM6A 4JGLA 4ALOA 3T24A 1X8OA 1X8UA 4XMHA 3BSZE 1DZPA 4Y0PA 2QO4A 4TNNA 3QRAA 2AT6X 2CZTA 3VG4A 2M07A 2X8TA 5LJHA 3NX2A 2WEWA 4YKOA 4DQ4A 1YS5A 5HCCC 3F9DA 3VZWX 1BRPA 1EQDA 2AH7X 4A1HA 1DZKA 2N93A 1B0OA 1SXUA 3HOEA 4HFOA 1R0UA 4NW4A 2M06A 2K4TA 3VZTX 4N7DA 4I6SA 2E4JA 2W2AA 3ZW0B 2RCQA 2Z4HA 2JN3A 5HTEA 4A1YA 1VPRA 1GKAB 1XKIA 1E06A 3HWGA 3KQ0A 3C77X 3PH6A 3VG6A 1OEJA 4PJ2A 4ZJ0A 1HBPA 5GV0A 2FS7A 2QOSC 4GK9A 4L3RA 2O4VA 4FZNA 4XMGA 3EBWA 3GE2A 3AA6A 1JJJA 1PM1X 3CMPA 3STMX 3AA0A 3CQRA 1QY0A 3O22A 3S26A 1YWCA 1ZHXA 1BH3A 1LIEA 5HBSA 4QZUA 4Z3TA 1BJ7A 5LJKA 1RLBE 3P6DA 1ZHYA 4FRTA 3KZAA 3FR4A 3ELXA 4ZH9A 3UEXA 3VPJE 1FELA 3AAAA 3FW4A 4FUVA 1KT6A 2QM9A 4GH7A 3ZUOA 2BHVA 3ZW2A 2NNEA 2XKLA 4GCSA 1NGLA 1SY2A 1QJ8A 2KW1A 4PUXA 2OVEA 4O49A 2HZRA 4YGHA 1OEEA 5HA1A 3RSWA 1LF7A 3GAQA 4NP1A 2XMXA 4TLJA 2GTLN 4OS3A 2A13A 2MJIA 1SMPI 4RUUA 3B2LA 3S5XA 2ACOA 5HWZA 3DA4A 2K23A 5LKFA 3NADA 4FZLA 3HWEA 2KTDA 2L67A 2Q4NA 3FA9A 4FT6A 4HWMA 4LQZA 4RJXA 5HZQA 1LIFA 3LK42 2CM9A 4F4BA 4K19A 1KZXA 1IKEA 4ID2A 1SY1A 3OJYC 2DM5A 1ADLA 4BOEA 3NSGA 1UZ2X 3APUA 1HMTA 4O9SA 3KFGA 5HCDC 3QRCA 3LK2B 4N7CA 2YMSA 4GNWA 3STKA 3TF6A 3TZGA 2XG6A 5H8TA 2CBRA 2MWHA 4GF4A 3CBCA 1B8EA 4QRLA 2JW1A 4IAWA 5EDBA 2OFRX 4HPDA 4AZOA 3NQKA 1QY1A 2G78A 4G75A 1OPAA 4JFBA 1DF3A 1TXLA 3HWFA 4AYNA 5ADXK 5AFUL 5D8JA 3PH5A 1QFTA 4C69X 1FTPA 3NR3A 1SXWA 2CZUA 3S5VA 1QJPA 1ERXA 4FBVA 4YFRA 5HZ5A 1X8NA 2XTRA 3I17A 1KQWA 1GFOA 2ODJA 3SYBA 1MDCA 4AKRA 1X8PA 4ZGUA 4FMSA 5DL5A 5BVTA 1D2UA 2QMIA 2J1NA 4TKJA 1EPAA 3KFFA 3SOTA 1EALA 1N0SA 3WJBA 1EIIA 4EEJA 1LICA 1E00A 3PPTA 1KT3A 4COTA 3PORA 2A0AA 1G85A 3G7XA 4AZRA 3HW9A 1SA8A 5KICA 5L8OA 1QJ9A 3O2YA 3FLLA 2YPVA 4ZHFA 4M7MA 2JU3A 4YMYA 1DFVA 2L68A 3RKGA 5L8NA 1QWDA 2Q2MA 4MVKA 2EU7X 3FYXA 3K19A 3SZDA 4XMCA 4TKBA 1IW2A 3FEPA 3RBYA 4UU3A 4LSFA 1LKEA 2HNXA 5DPQA 4IABA 5L8IA 2IFBA 1OPBA 2M4LA 1AVGI 3ZUIA 4EQAC 5IO5A 1A3YA 3RWXA 3AA0B 2GTLM 1GX8A 2RD7C 3PECA 3FELA 2Y0LA 4YKMA 1ZNHA 5PRNA 1L6MA 4O4XA 4IMOA 2Y7SA 2OVAA 3T20A 1T0VA 2LBAA 2OZQA 2A2GA 2WUTA 3LHNA 4AZNA 4LSEA 1GT4A 4M6SA 2MM3A 3ZW0A 3B2IA 3CR6A 3EBKA 1PMPA 2L9CA 1VYFA 3UAQA 1BT9A 1EUOA 1GFPA 2W81C 3VY8X 4ORXA 4TJZA 3U03A 1EIOA 3TGBA 5G26A 4O3ZA 3D96A 2K0LA 5F6ZA 1NP1A 3IFBA 5AEOA 4ZHCA 4I3CA 4IB6A 1GT3A 2ALLX 5HZ6A 5AJCA 2KZ7B 1YIVA 3KFIA 4D5UA 1FENA 3HWDA 2PY1A 4RLCA 3B2JA 1YP6A 2R56A 3L4RA 3AAAB 1O1UA 2F1VA 3QKGA 4I3BA 5FVNA 3WJFA 2BS6A 2BT9A 1IZNB 1ERBA 2J4UP 1QY2A 2WR6A 2ZAGA 4R0BA 5IYUA 1IFBA 2RCTA 2NP1A 4MVLA 2X46A 3ELZA 3BX7A 3GP6A 2RN4A 1ACDA 1TOUA 3JTYA 2ANSA 1ZHWA 2QTKA 4LSIA 2HMBA 1Y9TA 3EMMA 1UREA 1HXXA 4N58A 4D65A 3CBSA 4ML7B 2PRNA 2P8GA 1JZUA 5AFUK 4KCAA 1SY0A 2Y0KA 2LHFA 1PBOA 2WWPA 1P4TA 4FQBB 1O1VA 1MM5A 4CK4A 1I04A 4O3WA 2AMMX 2N2MA 3LK3B 1QFVA 2ERVA 2W2BA 4GRJA 2X8FA 1Y9LA 5D48A 3APXA 1JYJA 5EDCA 4N59A 4ORWA 1QG5A 3F6ZB 4CV7A 2JU8A 3BU9A 3IA8A 2JU7A 2N2LA 1X8QA 1GT1A 4MVEA 5LJGA 1ORMA 1ZNGA 1YWAA 5H9AA 4AYMC 2CM4A 1I05A 2MNHA 2KXPA 1EXSA 3WVMA 1HQPA 3FENA 2AT0X 2GC9A 2AT5X 1PRNA 1BXWA 4XNLA 4AZQA 3NPOA 3JS1A 3ZW1B 1EI5A 3C76X 2XE5A 4HPBA 3VG5A 1KGLA 3SY7A 5JDPA 2ZAIA 4ORSA 4JCHA 5K06A 3RZYA 1LNMA 4FESA 4ZR2A 3P6EA 2Y0HA 1BSQA 1CJ5A 1OPFA 1BRQA 4ON1A 1GT5A 4ZHGA 3P6HA 4U9CA 4YGZA 3T0SA 2Z4IA 2LBVA 3WBGA 4KR4A 3AKNA 3E3CA 4I9SA 4RUNA 3T1DA 1ICNA 2LA7A 4FBOA 5H9NA 1MVGA 2A2UA 3FYFA 3P02A 3DSZA 5H9LA 3AAEA 2WSJA 3NQ9A 4NNSA 5CYBA 2KXPB 1MX8A 3PP6A 1G5WA 3RBHA 5LJDA 2FRSA 3PQUA 1AELA 1YWBA 2Q9SA 3WI5A 1AQBA 2NNDA 2R74A 5IO6A 4LKPA 4A60A 1B4MA 3STNA 2X45A 1T68X 1XCAA 5FFHA 2GTLO 1Q9FA 1FDQA 3AA7B 4O3XB 1ZNEA 1JIWI 1BM5A 2Q39A 5F7GA 4ALBA 1X89A 2POAA 5ADXL 3NP1A 1VYGA 2JOZA 1EW3A 2HLVA 2GTFX 4NLJA 4KC7A 3VE2A 5LJEA 4ARHA 4FSOA 1RBPA 2OFMX 2XE3A 1DZJA 2RQ0A 1KXOA 4BQUA 3NX1A 2HZQA 4QNIA 3Q6LA 4YH0A 2OMFA 2LKKA 2FLJA 4XMDA 3OBLA 1H91A 1JJXA 1ZNLA 4AYEC 3FR5A 3FW5A 4RJWA 3WXQA 2XE2A 3WJDA 1MPFA 1LIBA 4E1TA 5BVQA 5DL7A 4EFGA 2BS5A 2FR3A 3AA1A 1CBQA 4CSBA 4QGVA 4NLIA 1THQA 1CBRA 1LFOA 5D5DA 4AZLA 4HPAA 4YFPA 5F1EA 2X8SA 2BLGA 1JBHA 4GCQA 3MX7A 1KT5A 2FGQX 4FZMA 5DG4A 3OE3A 4FGIB 3B2KA 4INNA 4Y0RA 4ZH6A 1A57A 2CBSA 3TGAA 4KRAA 2JMMA 1BLRA 4Y0QA 1KQXA 5EEDA 2MHLA 4ZHHA 4YDBA 5F58A 4B61A 1HMSA 1FEMA 4YBUA 7PRNA 3KFHA 3VZUX 1U18A 4D6BA 4IAXA 5F6BA 1HMRA 2AT8X 1S2PA 8PRNA 2XSTA 4MISA 3DTQA 2A3FX 3MBTA 5B29A 1CBSA 4ZFXA 4ES7A 1KT4A 1B56A 1SXXA 3UEWA 4O4SA 2AT3X 2LFOA 1I06A 4BUMX 1U17A 1HXUA 2W80C 4BVMA 3HOLA 1JV4A 4TKHA 2R73A 4KR8A 2OVSA 3F8AA 4E1SA 3FA8A 5H9KA 5EE2A 3D4RA 5HCEC 3AA1B 2AKQA 2AL0X 1YWDA 4NYQA 3DA3A 4GHBA 1EPBA 1PEEA 3U0DA 2NNQA 4IMNA 3BY0A 4TQ2A 2FR2A 4NNTA 4LSHA 1JYDA 4FBRA 5LKEA 2F1TA 3BU1A 1SY3A 1GFNA 5HA0A 1DC9A 4RLBA 5AQ6A 5DL8A 4ZCBA 2JMBA 4YDAA 2O62A 3PRNA 3WJCA 3CWKA 4U8UM 4AKRB 1SXYA 2GJ5A 2FS6A 4GDZA 3BDRA 3EM0A 3P6GA 3SY9A 3JSQA 4IBAA 3WI4A 3G7GA 4WFVA 5D4AA 4KH8A 2GE4A 5FQ7E 1KT7A 1QQSA 1S44A 4KC8A 3K3LA 3P24A 4U3QA 1OBPA 3TGCA 3A2SX 1TW4A 3POQA 4QAEA 2KD2A 1MX7A 3D97A 2PORA 4I95A 3EMNX 3S60A 4O4UA 1BBPA 3AA7A 4EDEA 4ORUA 5FQ6E 1E5PA 1ZHZA 4O3YA 3FIQA 5D47A 3P6CA 4PSQA 4HPCA 4AW8A 1DV9A 1H6S1 1HN2A 2G79A 1A2DA 4AZMA 1IZNA 1S7DA 3V8UA 4FSPA 3ZW1A 3HK1A 4WFUA 2RA6A 3CQNA 2KT4B 4QGWA 5AJBA 4U8UO 4GZVA 5EPQA 5LJCA 1OEKA 5DL6A 3H3IA 5BYPA 4LKTA 3C78X 5KIDA 3HWBA 1GFQA 3AAEB 4AYDC 5LJBA 3P6FA 4IB9A 3ZZVA 3U9PC 1D3SA 3LK41 4QZTA 2FGRA 1IIUA 3O19A 1GGLA 4IB8A 4LZUA 3ZQ3A 5HAEA 4YCEA 5IO7A 5C0NA 5EEEA 2G7BA 5HZ8A 4ODDA 3C5OA 1Q9GA 3LK3A 4ORYA 5JR8A 4KIIA 2ZLDA 2QO5A 1ZRYA 3EYCA 5KHPA 4ZGFA 3VE1A 1TOWA 4YBPA 4Y0SA 1HBQA 2WQ9A 4YGGA 1P6PA 1X71A 1ZNDA 2OVDA 5FENA 3SAOA 4O4OA 3FA6A 3VG3A 2LFUA 5HZ9A 4XNKA 5B27A 4I9RA 1OSMA 4MVIA 4WBKA 1ICMA 3BRNA 3NBXX 4UU2A 3WJEA 4DQ3A 4GNYA 2KC0A 3LK2A 3LV4A 1FE3A 2QO6A 3APWA 2KDYA 3AA6B 3WOVA 3PQSA 1HXTA 4OMXA 1ALBA 5BVSA 3ZI8A 1E54A 1NP4A 3WJGA 1MM4A 4GETA 4GU8A 3UEUA 3POXA 2ACPX 1GXAA 2XE1A 6PRNA 3UEVA 4MIRA 1AB0A 1BWYA 2XTQA 2F73A 4FRXA 2ASNX 1MUPA 4QGXA 2ZFGA 2Y2XA 3UU2A 1IFCA 2KTSA 3ZWEA 1LPJA 1YP7A 4QYNA 4D6AA 1ML7A 4OS8A 1ZNKA 2F09A 3FMZA 4OMWA 3HTYA 1TVQA 4A8ZA 4EXZA 4I3DA 2FWVA 3AKMA 2W2FA 1I4UA 3POUA 1DZMA 4RL9A 2LB6A 1BSYA 1G7NA 3FEKA 1O8VA 4LZVA 3VG7A 4GE1A 4AYID 4YCHA 1A18A 5D45A 3OD9A 4AUIA 4GCPA 3FA7A 4ORRA 3N91A 1CRBA 3APVA 3BX8A 3NQ3A 4FOZA 3MVFA 1GFMA 2MO5A 1E02A 2KZ7A 2YG2A 3I0AA 3KVDD 3VY9X 5HTDA 4AZPA 1IKJA 2YNKA 1YUPA 1BSOA 3D95A 1BEBA 5EZ2A 4XMFA 1KZWA 3SYSA 4OS0A 2FT9A 4GKCA 4G76A 3JQOA 4NYRA 2HYSA 1T8VA 3O0EA 1PHOA 4U8UN 2L5PA 2WQAE 4WHIA 1KOIA 4ZHDA 1G90A 1GKAA 4QYPA 3SZVA 1GX9A 2WEXA 1CBIA 1U0XA 4QQ1A 5FQ8E 5CE4A 4AYHA 2X27X 4AKMA 2MHDA 3TZSA 2FTBA 3VG2A 4XMEA 3BS2A 3UPGA 4IB7A 3VU1A 3PEDA 2Q2PA 5T5FA 1OBQA 4L1NA 1Z24A 3B2HA 1G74A 4D64A 1OBUA 5FAZA 4YFQA 4AFKA 1ZHTA 4KT5A 1LIDA 3FR2A 2K62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Z A;  3VE1 A;  4AYN A;  4AYE C;  2LFU A;  4O3W A;  4QQ1 A;  4AYD C;  4Z3T A;  4O3X B;  1YS5 A;  2KC0 A;  4AYI D;  4U9C A;  2KDY A;  3PQS A;  3HOE A;  4O4X A;  2W80 C;  2Y7S A;  3HOL A;  4O4U A;  3VE2 A;  5T5F A;  3KVD D;  4AYM C;  5EE2 A;  4O3Y A;  4O49 A;  3UAQ A;  2YPV A;  2W81 C;  3PQU A;  3V8U A; 
#chains in the Genus database with same CATH topology
 3BLG A;  4JGL A;  3T24 A;  3BRY A;  1DZP A;  3VG4 A;  3NX2 A;  2RTL A;  5HCC C;  3F9D A;  1DZK A;  4NW4 A;  2M06 A;  2QCB A;  5HTE A;  3KQ0 A;  1E06 A;  4GUZ A;  3VG6 A;  2FS7 A;  4XMG A;  3EBW A;  1JJJ A;  3STM X;  3A0B O;  1RAV A;  1VWP B;  1YWC A;  2AVI A;  1ZHY A;  3ELX A;  3VPJ E;  1FEL A;  1KT6 A;  2QM9 A;  4GH7 A;  2BHV A;  3ZW2 A;  2XKL A;  1SY2 A;  4PUX A;  2KW1 A;  4BGF A;  4YGH A;  5HA1 A;  4NP1 A;  2A13 A;  2MJI A;  2ACO A;  5LKF A;  3NAD A;  2X4M A;  4GGT A;  4FT6 A;  2X34 A;  4ID2 A;  3OJY C;  3NSG A;  5HCD C;  3PGU A;  2YMS A;  4GNW A;  3TF6 A;  2I5Z O;  1B8E A;  5EDB A;  1PBY A;  2OFR X;  4HPD A;  1QY1 A;  4G75 A;  5ADX K;  1DF3 A;  3HWF A;  5D8J A;  3PH5 A;  1QFT A;  4C69 X;  1FTP A;  2CZU A;  1QJP A;  4FBV A;  4YFR A;  3WYQ A;  1VWQ B;  2ODJ A;  5DL5 A;  2J1N A;  4TKJ A;  3DWO X;  1EAL A;  4EEJ A;  1LIC A;  1E00 A;  3G7X A;  1QJ9 A;  3O2Y A;  3FLL A;  1LEL A;  4MVK A;  2OL7 A;  4XMC A;  4TKB A;  3FEP A;  3RDM A;  4LSF A;  4IAB A;  3PEC A;  1L6M A;  4O4X A;  3VHI A;  5B11 O;  3T20 A;  4M6S A;  3ZW0 A;  1VYF A;  1E2T A;  1EIO A;  2K0L A;  1NP1 A;  4I3C A;  4IB6 A;  5AJC A;  2KZ7 B;  3FDC A;  3L4R A;  1O1U A;  2F1V A;  1Y0G A;  3QKG A;  2UYW A;  1IZN B;  2J4U P;  1IJ8 A;  1HY2 A;  5IYU A;  2RCT A;  2NP1 A;  1MM9 A;  2X46 A;  3GP6 A;  1TOU A;  3JTY A;  2ANS A;  2QTK A;  2HMB A;  1HXX A;  1JZU A;  4EKV A;  2Y0K A;  2LHF A;  1PBO A;  2WWP A;  2IWV A;  1O1V A;  4CK4 A;  1I04 A;  3APX A;  4CV7 A;  3BU9 A;  3IA8 A;  1X8Q A;  4MVE A;  5H9A A;  2CM4 A;  3WVM A;  3FEN A;  2AT0 X;  2VDF A;  2AT5 X;  1EI5 A;  1VYO A;  1KGL A;  4ORS A;  4JCH A;  2RTM A;  4ZR2 A;  3WZP A;  5L3Y A;  1CJ5 A;  4ON1 A;  4BCS A;  3T1D A;  2IZI A;  5H9N A;  2A2U A;  1MVG A;  2WSJ A;  4CPF A;  4NNS A;  1MX8 A;  3PP6 A;  5G38 A;  1G5W A;  1AEL A;  2IZD B;  2NND A;  4LKP A;  1B4M A;  1N43 A;  1LCV A;  1SRE A;  1FDQ A;  2POA A;  2JOZ A;  5E79 O;  2XE3 A;  4FZL A;  2RQ0 A;  3NX1 A;  2HZQ A;  2OMF A;  1JJX A;  4AYE C;  3FR5 A;  3FW5 A;  4RJW A;  4E1T A;  1SRJ A;  4CSB A;  1THQ A;  1CBR A;  5D5D A;  4AZL A;  2X8S A;  2BLG A;  1JBH A;  4GCQ A;  1KT5 A;  2FGQ X;  2OFB A;  4Y0R A;  4CDC A;  2CBS A;  4Y0Q A;  2CAM A;  2IZC B;  1HMR A;  1KL3 A;  4PR7 A;  8PRN A;  4ZFX A;  4ES7 A;  1KT4 A;  3KZI O;  4O4S A;  1I06 A;  2RTR B;  4BVM A;  3HOL A;  4TKH A;  1LDQ A;  1VWF B;  2R73 A;  5EE2 A;  2AKQ A;  1DF8 A;  2NNQ A;  3VHH A;  3RE6 A;  1DC9 A;  2JMB A;  3CWK A;  3P6G A;  2R4L A;  3Q34 A;  1KT7 A;  3POQ A;  4U3Q A;  1OBP A;  3MM0 A;  3EMN X;  4CPI A;  3AA7 A;  5G39 A;  1ZHZ A;  4O3Y A;  4PSQ A;  1H6S 1;  1AVE A;  1A2D A;  3HK1 A;  4WFU A;  3CQN A;  4C00 A;  4QGW A;  2A5B A;  3H3I A;  3SZH A;  1JQP A;  5KID A;  4FQE A;  1GFQ A;  4AYD C;  5LJB A;  3ZZV A;  1D3S A;  1I9H A;  1GGL A;  4IB8 A;  2RTP B;  5HAE A;  5IO7 A;  3LK3 A;  4ORY A;  2ZSC A;  2ZLD A;  5IRU A;  4ZGF A;  4YGG A;  4XNK A;  3VG3 A;  5GTI O;  5HZ9 A;  1ICM A;  3NBX X;  4UU2 A;  4DNE A;  1FE3 A;  3APW A;  3WOV A;  3PQS A;  5BVS A;  3ZI8 A;  1GXA A;  6PRN A;  1NBX A;  3T6L A;  5B5G A;  2F1C X;  1IFC A;  3ZWE A;  1LPJ A;  4D6A A;  4CPH A;  1ZNK A;  2F09 A;  3FMZ A;  4A8Z A;  1TVQ A;  4I3D A;  2FWV A;  1DZM A;  4CDE A;  2OY5 O;  1G7N A;  1O8V A;  4LZV A;  5D45 A;  3OD9 A;  3APV A;  3BX8 A;  3I0A A;  4IL6 O;  3VY9 X;  5HTD A;  4AZP A;  1YUP A;  3SYS A;  4BX7 B;  4NYR A;  2HYS A;  1N9M A;  1PHO A;  2WQA E;  1SWL A;  4JHQ A;  4QYP A;  1GX9 A;  1N7Y A;  2RTC B;  2OFA A;  1T1L A;  5B2A O;  3NJT A;  2MHD A;  3SLT A;  3BS2 A;  3UPG A;  3PED A;  2Q2P A;  1SLD B;  1MEP A;  1OBU A;  4Z28 A;  2DJF A;  4YFQ A;  1LID A;  1GM6 A;  4ALO A;  1VWA B;  4Y0P A;  2QO4 A;  4TNN A;  2AT6 X;  2X8T A;  2WEW A;  1YS5 A;  3VZW X;  1BRP A;  1EQD A;  3VGW A;  2K4T A;  3VZT X;  2E4J A;  2W2A A;  2Z4H A;  2JN3 A;  1GKA B;  3HWG A;  3PH6 A;  4GK9 A;  4FZN A;  3AA0 A;  3CQR A;  1QY0 A;  1ZHX A;  1BJ7 A;  4FRT A;  3UEX A;  3FID A;  3ZUO A;  1NGL A;  4O49 A;  1OEE A;  1SWD A;  1SWB A;  5HWZ A;  3B2L A;  1VWG B;  2L67 A;  4LQZ A;  1KZX A;  3KFG A;  3LK2 B;  2AF5 A;  5H8T A;  2JW1 A;  4AYN A;  1SXW A;  1GFO A;  1KQW A;  3SYB A;  1X8P A;  3PGR A;  2QMI A;  1EPA A;  3KFF A;  3SOT A;  1N0S A;  1EII A;  2X32 A;  2A0A A;  4AZR A;  1SA8 A;  5L8O A;  1HXZ A;  4YMY A;  3FYX A;  3K19 A;  2RTE B;  3ZUI A;  2IFB A;  1OPB A;  2M4L A;  2C1Q A;  2GTL M;  1GX8 A;  2RD7 C;  4YKM A;  5PRN A;  2Y7S A;  1T0V A;  2WUT A;  2A2G A;  3LHN A;  4LSE A;  3MG5 A;  1GT4 A;  1UYO X;  1PMP A;  2PI3 O;  2R4N A;  4TJZ A;  5G26 A;  3D96 A;  4N74 A;  3IFB A;  3KFI A;  1FEN A;  3PK2 A;  4RLC A;  2R56 A;  2F01 A;  4I3B A;  4B55 A;  3ELZ A;  3BX7 A;  1ACD A;  3CKG A;  4D65 A;  1Y9T A;  2PRN A;  2BC3 A;  4KCA A;  1SRF A;  2AMM X;  1VWE B;  1PTS A;  1SWA A;  2X8F A;  5EDC A;  4N59 A;  3F6Z B;  2JU7 A;  1VWB B;  4AYM C;  2KXP A;  1EXS A;  3RY2 A;  1HQP A;  1N9Y A;  4XNL A;  4AZQ A;  4HPB A;  5K06 A;  3RZY A;  1LNM A;  3P6E A;  1BRQ A;  1GT5 A;  4ZHG A;  3P6H A;  2Z4I A;  2A5C A;  3AKN A;  4BX5 B;  4IRW A;  3AAE A;  3P02 A;  3DSZ A;  5CYB A;  3BS0 A;  1SWN A;  1KL5 A;  2IZB A;  5K68 A;  3PQU A;  3WI5 A;  1AQB A;  2R74 A;  4A60 A;  2X45 A;  3D9W A;  1JIW I;  4UB6 O;  3SZI A;  2Q39 A;  1BM5 A;  1X89 A;  3EC5 A;  3NP1 A;  1SRI A;  2HLV A;  2GTF X;  4FSO A;  2OFM X;  4FOZ A;  4BQU A;  1KXO A;  4YH0 A;  4QNI A;  2JGS A;  2FLJ A;  1H91 A;  2G8C O;  1MPF A;  1LIB A;  4CPE A;  1SWS A;  1SWP A;  4QGV A;  4HPA A;  5F1E A;  1N4J A;  4FZM A;  4ZH6 A;  4INN A;  2MHL A;  4ZHH A;  4B61 A;  1HMS A;  1FEM A;  4YBU A;  3DWN A;  2R88 A;  3DTQ A;  2A3F X;  3MBT A;  1CBS A;  3PDF A;  1B56 A;  3UEW A;  2RTH B;  2LFO A;  5CHK A;  1HXU A;  2W80 C;  2OVS A;  3F8A A;  3FA8 A;  4GHB A;  1PEE A;  3BY0 A;  4TQ2 A;  1JYD A;  4FBR A;  5LKE A;  3BU1 A;  5H2F O;  4ZCB A;  4YDA A;  1LUQ A;  4U8U M;  2GJ5 A;  4IBA A;  3G7G A;  2OF8 A;  5D4A A;  1QQS A;  1WBI A;  4QAE A;  1K3B A;  1MX7 A;  4I95 A;  4O4U A;  3LTW A;  1E5P A;  1MOY A;  2OYB O;  1W6F A;  2A8G A;  2G79 A;  4AZM A;  3T6F A;  1IZN A;  3ZW1 A;  5EPQ A;  5DL6 A;  5BYP A;  3AAE B;  3U9P C;  4LZU A;  3ZQ3 A;  5C0N A;  5HZ8 A;  5JR8 A;  2OY7 A;  1ZRY A;  3EYC A;  2Y32 A;  1FJ1 E;  5KHP A;  1STS B;  1HBQ A;  1P6P A;  4NV7 A;  4WBK A;  4GNY A;  3LV4 A;  2QO6 A;  1HXT A;  1ALB A;  1NP4 A;  3WJG A;  4GET A;  4GU8 A;  3POX A;  2ACP X;  2XE1 A;  1AB0 A;  2XTQ A;  2F73 A;  1YP7 A;  1ML7 A;  1NQN A;  2RTB B;  2Y3F A;  4GD9 A;  4AUI A;  4GCP A;  3NQ3 A;  2RTI B;  2WPU A;  5IXG A;  3A0H O;  1BSO A;  3D95 A;  4G76 A;  2IZA A;  3O0E A;  1T8V A;  4U8U N;  1G90 A;  1W4T A;  1CBI A;  4AYH A;  4AKM A;  2AXT O;  1G74 A;  2IZH B;  4YVB A;  5FAZ A;  1X8O A;  4XMH A;  1SRG A;  5LJH A;  4YKO A;  2AH7 X;  1LCZ A;  1I78 A;  4N7D A;  4I6S A;  3ZW0 B;  2RCQ A;  1ORM A;  1VPR A;  1XKI A;  2R4P A;  3C77 X;  4ZJ0 A;  5GV0 A;  1HBP A;  2QOS C;  5KAF O;  5TIS O;  4CTD A;  4Z6J A;  1BH3 A;  1LIE A;  5HBS A;  5LJK A;  2RTO B;  3P6D A;  3KZA A;  3AAA A;  5B5E O;  3FW4 A;  2RTJ A;  4GCS A;  2NNE A;  2OY1 O;  2JQY A;  1QJ8 A;  1VWI B;  4Y59 A;  1NDJ A;  1LF7 A;  2XMX A;  4TLJ A;  2GTL N;  4OS3 A;  4RUU A;  1SMP I;  2IZE B;  3DA4 A;  2K23 A;  2Q4N A;  4Z2V A;  1K24 A;  4HWM A;  5HZQ A;  2CM9 A;  4F4B A;  4K19 A;  1SY1 A;  4BOE A;  3APU A;  4O9S A;  1HMT A;  3HPE A;  4N7C A;  3STK A;  5G3A A;  3TZG A;  2CBR A;  4GF4 A;  3CBC A;  4IAW A;  2RTD B;  3NQK A;  1SWC A;  4JFB A;  2UZ2 A;  3NR3 A;  1ERX A;  3WZQ A;  2XTR A;  3I17 A;  4AKR A;  4DCB A;  1MDC A;  1VWR B;  1D2U A;  3PPT A;  3POR A;  1G85 A;  3HW9 A;  2YPV A;  4ZHF A;  2JU3 A;  2L68 A;  3RKG A;  5L8N A;  3T2W A;  1MK5 A;  3SLO A;  1IW2 A;  1T16 A;  4UU3 A;  1KFF A;  4EQA C;  1AVG I;  2G5L A;  3RWX A;  3AA0 B;  2Y0L A;  4I60 A;  1OSP O;  3EW1 A;  5F2B A;  3RDX A;  2OVA A;  1VWM B;  1VWC B;  2OZQ A;  1SWK A;  4AZN A;  3EBK A;  2L9C A;  2W81 C;  4ORX A;  3U03 A;  3TGB A;  4O3Z A;  1LDO A;  2C1S A;  5F6Z A;  1JMZ A;  2HKD A;  1GT3 A;  4D5U A;  1LCW A;  3HWD A;  2PY1 A;  3B2J A;  3AAA B;  5FVN A;  2RTA A;  1ERB A;  2WR6 A;  2ZAG A;  4R0B A;  1IFB A;  4UB8 O;  1ZHW A;  4LSI A;  2FGS A;  4ML7 B;  5AFU K;  4CPH B;  1STR B;  1SY0 A;  1SLE B;  1P4T A;  4FQB B;  1MM5 A;  2I5V O;  4O3W A;  1SWU A;  2ERV A;  4GRJ A;  2VFC A;  4ORW A;  1QG5 A;  4BX7 A;  2N2L A;  1GT1 A;  4Z2O A;  1ZNG A;  1YWA A;  2MNH A;  2GC9 A;  3WYP A;  1PRN A;  1BXW A;  3JS1 A;  3ZW1 B;  2XE5 A;  3VG5 A;  3PGS A;  3SY7 A;  2ZAI A;  1JJU A;  1BSQ A;  3T2X A;  4YGZ A;  3T0S A;  1SWO A;  3E3C A;  4RUN A;  5K67 A;  4FBO A;  3FYF A;  3NQ9 A;  2KXP B;  2WJQ A;  2RTF B;  4BX6 A;  3RBH A;  2FRS A;  1YWB A;  2DJG A;  4JNJ A;  1XCA A;  2GTL O;  4GGZ A;  1Q9F A;  4O3X B;  1ZNE A;  2WJR A;  5F7G A;  5ADX L;  1VYG A;  3VE2 A;  1SLF B;  4OEL A;  1DZJ A;  5IRW A;  3WXQ A;  3WJD A;  5BVQ A;  2OL8 O;  2FR3 A;  4NLI A;  1LFO A;  4YFP A;  3MX7 A;  4FGI B;  3B2K A;  1A57 A;  3TGA A;  4KRA A;  2JMM A;  1KQX A;  4Y5D A;  1WUB A;  3KFH A;  3VZU X;  1U18 A;  4IAX A;  5F6B A;  2AT8 X;  1S2P A;  2XST A;  3KVN A;  1SXX A;  2IZL B;  4E1S A;  5H9K A;  3D4R A;  5HCE C;  3AA1 B;  1YWD A;  3U0D A;  4GJS A;  2FR2 A;  4NNT A;  4LSH A;  1GFN A;  1SY3 A;  5DL8 A;  3PRN A;  4AKR B;  5CSE A;  2FS6 A;  2R4O A;  3SY9 A;  3JSQ A;  3PF1 A;  4WFV A;  4KH8 A;  2GE4 A;  5FQ7 E;  1S44 A;  4KC8 A;  1SWJ A;  3K3L A;  3P24 A;  3A2S X;  1TW4 A;  2KD2 A;  3D97 A;  1BBP A;  1STP A;  5FQ6 E;  4C4V B;  4HPC A;  1DV9 A;  1HN2 A;  2VFB A;  1S7D A;  3V8U A;  5AJB A;  4U8U O;  5LJC A;  3HWB A;  1KL4 A;  3P6F A;  4IB9 A;  1RST B;  4QZT A;  3O19 A;  3C5O A;  4ODD A;  2QO5 A;  2FKJ A;  4OEM A;  3VE1 A;  4YBP A;  2LFU A;  1X71 A;  2OVD A;  3AUM O;  5FEN A;  3SAO A;  4O4O A;  5B27 A;  4I9R A;  1OSM A;  4DQ3 A;  3WJE A;  2KC0 A;  3LK2 A;  3AA6 B;  5B5F A;  2MF6 A;  4BJ8 A;  4CDD A;  3UEU A;  3UEV A;  4MIR A;  1BWY A;  4FRX A;  1MUP A;  4QGX A;  2Y2X A;  3UU2 A;  3JCU O;  4C5P A;  1VWN B;  4OMW A;  4EXZ A;  3AKM A;  3POU A;  4RL9 A;  3FEK A;  1VWD B;  2FKG A;  4AYI D;  1JMX A;  3FA7 A;  1GX3 A;  1CRB A;  1VWL B;  2IZK A;  1GFM A;  1IKJ A;  2YNK A;  1BEB A;  5EZ2 A;  5B66 O;  4XMF A;  3RDU A;  4OS0 A;  2FT9 A;  4GKC A;  3JQO A;  3QQ2 A;  2RTQ B;  2L5P A;  4WHI A;  4ZHD A;  4OKA A;  3SZV A;  2WEX A;  5CE4 A;  4QQ1 A;  2X27 X;  3VG2 A;  1OBQ A;  1Z24 A;  4KT5 A;  3FR2 A;  2K62 A;  1QAB E;  1X8U A;  4Z2P A;  3BSZ E;  1SWH A;  2RTG B;  3QRA A;  2CZT A;  2M07 A;  4DQ4 A;  1UYN X;  4A1H A;  2BSZ A;  2N93 A;  1B0O A;  1SXU A;  3HOE A;  4HFO A;  1R0U A;  3DZM A;  4A1Y A;  1OPF A;  3X00 A;  1OEJ A;  4PJ2 A;  2O4V A;  4L3R A;  5KAI O;  3GE2 A;  3AA6 A;  1PM1 X;  3CMP A;  3O22 A;  3S26 A;  1VWK B;  4QZU A;  1S5L O;  4Z3T A;  1RLB E;  3FR4 A;  4ZH9 A;  4FUV A;  4GGR A;  1VWJ B;  2OVE A;  2HZR A;  3RSW A;  3GAQ A;  3WU2 O;  3S5X A;  5GTH O;  3HWE A;  2KTD A;  3FA9 A;  4RJX A;  1LIF A;  3LK4 2;  3EW2 A;  1IKE A;  2DM5 A;  1ADL A;  4JO6 A;  3SLJ A;  1UZ2 X;  3QRC A;  3SZJ A;  2XG6 A;  2MWH A;  2IWW A;  3BRZ A;  4QRL A;  4AZO A;  2G78 A;  1OPA A;  2FHN X;  1TXL A;  5AFU L;  2GH7 A;  3S5V A;  5HZ5 A;  1X8N A;  4ZGU A;  4FMS A;  5BVT A;  3AEH A;  3WJB A;  1HQQ A;  4CDF A;  1Y52 X;  1KT3 A;  4COT A;  5KIC A;  4M7M A;  4PJ0 O;  1DFV A;  1QWD A;  2Q2M A;  2EU7 X;  3SZD A;  3RBY A;  3WZO A;  1LKE A;  2HNX A;  5DPQ A;  5L8I A;  5IO5 A;  1A3Y A;  4GDA A;  4Z27 A;  3FEL A;  1ZNH A;  2IZF B;  4IMO A;  2LBA A;  2MM3 A;  4U46 A;  3B2I A;  3CR6 A;  5B3M O;  3UAQ A;  1BT9 A;  1EUO A;  1GFP A;  3VY8 X;  3RDO A;  1NC9 A;  4K3B A;  5AEO A;  4ZHC A;  2ALL X;  5HZ6 A;  1YIV A;  1SWE A;  2IZG B;  1YP6 A;  3RY1 A;  3WJF A;  2BS6 A;  2BT9 A;  1QY2 A;  4MVL A;  2RN4 A;  2R8A A;  4C4V A;  2OF9 A;  3EMM A;  4N58 A;  1URE A;  3CBS A;  2P8G A;  3CKF A;  3RE5 A;  2N2M A;  1VWO B;  2R89 A;  3LK3 B;  1QFV A;  2W2B A;  5D48 A;  1Y9L A;  4MEE A;  1JYJ A;  1SWF A;  2JU8 A;  5LJG A;  1I05 A;  2C4I A;  3NPO A;  2RTK A;  1RSU B;  1W5R A;  1RXH A;  3C76 X;  2IZJ A;  2OL6 O;  5JDP A;  4FES A;  2Y0H A;  1RXK A;  4U9C A;  2LBV A;  3WBG A;  4KR4 A;  4I9S A;  1ICN A;  2LA7 A;  5H9L A;  5LJD A;  2Q9S A;  4K3C A;  5IO6 A;  3STN A;  1T68 X;  5FFH A;  1VWH B;  3AA7 B;  2X56 A;  4ALB A;  4BX5 A;  1EW3 A;  4NLJ A;  4KC7 A;  5LJE A;  4ARH A;  1RBP A;  3Q6L A;  2LKK A;  4XMD A;  3OBL A;  1ZNL A;  2XE2 A;  5DL7 A;  4EFG A;  2BS5 A;  3AA1 A;  1CBQ A;  2WVP A;  4BBO A;  5JD2 A;  5DG4 A;  3OE3 A;  1BLR A;  5EED A;  4YDB A;  5F58 A;  1Y53 X;  7PRN A;  4D6B A;  1SWQ A;  4MIS A;  5B29 A;  2AT3 X;  4N75 A;  4GJV A;  5IRA A;  4BUM X;  1U17 A;  1JV4 A;  4KR8 A;  3DA3 A;  3VHM A;  2AL0 X;  4NYQ A;  1EPB A;  4IMN A;  4RLB A;  2F1T A;  5HA0 A;  5AQ6 A;  2O62 A;  3WJC A;  1SXY A;  4BX6 B;  4GDZ A;  3BDR A;  3EM0 A;  3WI4 A;  3TGC A;  2Y3E A;  2POR A;  1SWG A;  3S60 A;  4EDE A;  4ORU A;  3FIQ A;  5D47 A;  1SLG B;  1AVD A;  3P6C A;  4AW8 A;  4FSP A;  2RA6 A;  2KT4 B;  2FHL A;  4GZV A;  1NQM A;  1OEK A;  4LKT A;  3C78 X;  3LK4 1;  2FGR A;  2X9K A;  1IIU A;  4YCE A;  5EEE A;  2G7B A;  1Q9G A;  4KII A;  1HXL A;  1TOW A;  1Y55 X;  4Y0S A;  2WQ9 A;  1ZND A;  3FA6 A;  3RDQ A;  4MVI A;  5B10 O;  3BRN A;  2KDY A;  4NV8 A;  3RDS A;  4OMX A;  1E54 A;  1MM4 A;  2ASN X;  2ZFG A;  2KTS A;  4QYN A;  3WZN A;  4OS8 A;  3HTY A;  2W2F A;  1I4U A;  2LB6 A;  1BSY A;  3VG7 A;  4GE1 A;  4YCH A;  1A18 A;  4ORR A;  3N91 A;  3MVF A;  2MO5 A;  1E02 A;  2KZ7 A;  2YG2 A;  3KVD D;  1KZW A;  1KOI A;  2OY8 A;  1GKA A;  1U0X A;  1SWR A;  5FQ8 E;  3TZS A;  1RXJ A;  2FTB A;  4XME A;  2QOM A;  2RTN B;  4IB7 A;  3VU1 A;  5T5F A;  1SRH A;  4L1N A;  2X55 A;  3B2H A;  1SWT A;  4D64 A;  4AFK A;  1ZHT A; 
#chains in the Genus database with same CATH homology
 1QAB E;  3BLG A;  1GM6 A;  4JGL A;  4ALO A;  3T24 A;  1X8O A;  1X8U A;  4XMH A;  3BSZ E;  1DZP A;  4Y0P A;  2QO4 A;  4TNN A;  3QRA A;  2AT6 X;  2CZT A;  3VG4 A;  2M07 A;  2X8T A;  5LJH A;  3NX2 A;  2WEW A;  4YKO A;  4DQ4 A;  1YS5 A;  5HCC C;  3F9D A;  3VZW X;  1BRP A;  1EQD A;  2AH7 X;  4A1H A;  1DZK A;  2N93 A;  1B0O A;  1SXU A;  3HOE A;  4HFO A;  1R0U A;  4NW4 A;  2M06 A;  2K4T A;  3VZT X;  4N7D A;  4I6S A;  2E4J A;  2W2A A;  3ZW0 B;  2RCQ A;  2Z4H A;  2JN3 A;  5HTE A;  4A1Y A;  1VPR A;  1GKA B;  1XKI A;  1E06 A;  3HWG A;  3KQ0 A;  3C77 X;  3PH6 A;  3VG6 A;  1OEJ A;  4PJ2 A;  4ZJ0 A;  1HBP A;  5GV0 A;  2FS7 A;  2QOS C;  4GK9 A;  4L3R A;  2O4V A;  4FZN A;  4XMG A;  3EBW A;  3GE2 A;  3AA6 A;  1JJJ A;  1PM1 X;  3CMP A;  3STM X;  3AA0 A;  3CQR A;  1QY0 A;  3O22 A;  3S26 A;  1YWC A;  1ZHX A;  1BH3 A;  1LIE A;  5HBS A;  4QZU A;  4Z3T A;  1BJ7 A;  5LJK A;  1RLB E;  3P6D A;  1ZHY A;  4FRT A;  3KZA A;  3FR4 A;  3ELX A;  4ZH9 A;  3UEX A;  3VPJ E;  1FEL A;  3AAA A;  3FW4 A;  4FUV A;  1KT6 A;  2QM9 A;  4GH7 A;  3ZUO A;  2BHV A;  3ZW2 A;  2NNE A;  2XKL A;  4GCS A;  1NGL A;  1SY2 A;  1QJ8 A;  2KW1 A;  4PUX A;  2OVE A;  4O49 A;  2HZR A;  4YGH A;  1OEE A;  5HA1 A;  3RSW A;  1LF7 A;  3GAQ A;  4NP1 A;  2XMX A;  4TLJ A;  2GTL N;  4OS3 A;  2A13 A;  2MJI A;  1SMP I;  4RUU A;  3B2L A;  3S5X A;  2ACO A;  5HWZ A;  3DA4 A;  2K23 A;  5LKF A;  3NAD A;  4FZL A;  3HWE A;  2KTD A;  2L67 A;  2Q4N A;  3FA9 A;  4FT6 A;  4HWM A;  4LQZ A;  4RJX A;  5HZQ A;  1LIF A;  3LK4 2;  2CM9 A;  4F4B A;  4K19 A;  1KZX A;  1IKE A;  4ID2 A;  1SY1 A;  3OJY C;  2DM5 A;  1ADL A;  4BOE A;  3NSG A;  1UZ2 X;  3APU A;  1HMT A;  4O9S A;  3KFG A;  5HCD C;  3QRC A;  3LK2 B;  4N7C A;  2YMS A;  4GNW A;  3STK A;  3TF6 A;  3TZG A;  2XG6 A;  5H8T A;  2CBR A;  2MWH A;  4GF4 A;  3CBC A;  1B8E A;  4QRL A;  2JW1 A;  4IAW A;  5EDB A;  2OFR X;  4HPD A;  4AZO A;  3NQK A;  1QY1 A;  2G78 A;  4G75 A;  1OPA A;  4JFB A;  1DF3 A;  1TXL A;  3HWF A;  4AYN A;  5ADX K;  5AFU L;  5D8J A;  3PH5 A;  1QFT A;  4C69 X;  1FTP A;  3NR3 A;  1SXW A;  2CZU A;  3S5V A;  1QJP A;  1ERX A;  4FBV A;  4YFR A;  5HZ5 A;  1X8N A;  2XTR A;  3I17 A;  1KQW A;  1GFO A;  2ODJ A;  3SYB A;  1MDC A;  4AKR A;  1X8P A;  4ZGU A;  4FMS A;  5DL5 A;  5BVT A;  1D2U A;  2QMI A;  2J1N A;  4TKJ A;  1EPA A;  3KFF A;  3SOT A;  1EAL A;  1N0S A;  3WJB A;  1EII A;  4EEJ A;  1LIC A;  1E00 A;  3PPT A;  1KT3 A;  4COT A;  3POR A;  2A0A A;  1G85 A;  3G7X A;  4AZR A;  3HW9 A;  1SA8 A;  5KIC A;  5L8O A;  1QJ9 A;  3O2Y A;  3FLL A;  2YPV A;  4ZHF A;  4M7M A;  2JU3 A;  4YMY A;  1DFV A;  2L68 A;  3RKG A;  5L8N A;  1QWD A;  2Q2M A;  4MVK A;  2EU7 X;  3FYX A;  3K19 A;  3SZD A;  4XMC A;  4TKB A;  1IW2 A;  3FEP A;  3RBY A;  4UU3 A;  4LSF A;  1LKE A;  2HNX A;  5DPQ A;  4IAB A;  5L8I A;  2IFB A;  1OPB A;  2M4L A;  1AVG I;  3ZUI A;  4EQA C;  5IO5 A;  1A3Y A;  3RWX A;  3AA0 B;  2GTL M;  1GX8 A;  2RD7 C;  3PEC A;  3FEL A;  2Y0L A;  4YKM A;  1ZNH A;  5PRN A;  1L6M A;  4O4X A;  4IMO A;  2Y7S A;  2OVA A;  3T20 A;  1T0V A;  2LBA A;  2OZQ A;  2A2G A;  2WUT A;  3LHN A;  4AZN A;  4LSE A;  1GT4 A;  4M6S A;  2MM3 A;  3ZW0 A;  3B2I A;  3CR6 A;  3EBK A;  1PMP A;  2L9C A;  1VYF A;  3UAQ A;  1BT9 A;  1EUO A;  1GFP A;  2W81 C;  3VY8 X;  4ORX A;  4TJZ A;  3U03 A;  1EIO A;  3TGB A;  5G26 A;  4O3Z A;  3D96 A;  2K0L A;  5F6Z A;  1NP1 A;  3IFB A;  5AEO A;  4ZHC A;  4I3C A;  4IB6 A;  1GT3 A;  2ALL X;  5HZ6 A;  5AJC A;  2KZ7 B;  1YIV A;  3KFI A;  4D5U A;  1FEN A;  3HWD A;  2PY1 A;  4RLC A;  3B2J A;  1YP6 A;  2R56 A;  3L4R A;  3AAA B;  1O1U A;  2F1V A;  3QKG A;  4I3B A;  5FVN A;  3WJF A;  2BS6 A;  2BT9 A;  1IZN B;  1ERB A;  2J4U P;  1QY2 A;  2WR6 A;  2ZAG A;  4R0B A;  5IYU A;  1IFB A;  2RCT A;  2NP1 A;  4MVL A;  2X46 A;  3ELZ A;  3BX7 A;  3GP6 A;  2RN4 A;  1ACD A;  1TOU A;  3JTY A;  2ANS A;  1ZHW A;  2QTK A;  4LSI A;  2HMB A;  1Y9T A;  3EMM A;  1URE A;  1HXX A;  4N58 A;  4D65 A;  3CBS A;  4ML7 B;  2PRN A;  2P8G A;  1JZU A;  5AFU K;  4KCA A;  1SY0 A;  2Y0K A;  2LHF A;  1PBO A;  2WWP A;  1P4T A;  4FQB B;  1O1V A;  1MM5 A;  4CK4 A;  1I04 A;  4O3W A;  2AMM X;  2N2M A;  3LK3 B;  1QFV A;  2ERV A;  2W2B A;  4GRJ A;  2X8F A;  1Y9L A;  5D48 A;  3APX A;  1JYJ A;  5EDC A;  4N59 A;  4ORW A;  1QG5 A;  3F6Z B;  4CV7 A;  2JU8 A;  3BU9 A;  3IA8 A;  2JU7 A;  2N2L A;  1X8Q A;  1GT1 A;  4MVE A;  5LJG A;  1ORM A;  1ZNG A;  1YWA A;  5H9A A;  4AYM C;  2CM4 A;  1I05 A;  2MNH A;  2KXP A;  1EXS A;  3WVM A;  1HQP A;  3FEN A;  2AT0 X;  2GC9 A;  2AT5 X;  1PRN A;  1BXW A;  4XNL A;  4AZQ A;  3NPO A;  3JS1 A;  3ZW1 B;  1EI5 A;  3C76 X;  2XE5 A;  4HPB A;  3VG5 A;  1KGL A;  3SY7 A;  5JDP A;  2ZAI A;  4ORS A;  4JCH A;  5K06 A;  3RZY A;  1LNM A;  4FES A;  4ZR2 A;  3P6E A;  2Y0H A;  1BSQ A;  1CJ5 A;  1OPF A;  1BRQ A;  4ON1 A;  1GT5 A;  4ZHG A;  3P6H A;  4U9C A;  4YGZ A;  3T0S A;  2Z4I A;  2LBV A;  3WBG A;  4KR4 A;  3AKN A;  3E3C A;  4I9S A;  4RUN A;  3T1D A;  1ICN A;  2LA7 A;  4FBO A;  5H9N A;  1MVG A;  2A2U A;  3FYF A;  3P02 A;  3DSZ A;  5H9L A;  3AAE A;  2WSJ A;  3NQ9 A;  4NNS A;  5CYB A;  2KXP B;  1MX8 A;  3PP6 A;  1G5W A;  3RBH A;  5LJD A;  2FRS A;  3PQU A;  1AEL A;  1YWB A;  2Q9S A;  3WI5 A;  1AQB A;  2NND A;  2R74 A;  5IO6 A;  4LKP A;  4A60 A;  1B4M A;  3STN A;  2X45 A;  1T68 X;  1XCA A;  5FFH A;  2GTL O;  1Q9F A;  1FDQ A;  3AA7 B;  4O3X B;  1ZNE A;  1JIW I;  1BM5 A;  2Q39 A;  5F7G A;  4ALB A;  1X89 A;  2POA A;  5ADX L;  3NP1 A;  1VYG A;  2JOZ A;  1EW3 A;  2HLV A;  2GTF X;  4NLJ A;  4KC7 A;  3VE2 A;  5LJE A;  4ARH A;  4FSO A;  1RBP A;  2OFM X;  2XE3 A;  1DZJ A;  2RQ0 A;  1KXO A;  4BQU A;  3NX1 A;  2HZQ A;  4QNI A;  3Q6L A;  4YH0 A;  2OMF A;  2LKK A;  2FLJ A;  4XMD A;  3OBL A;  1H91 A;  1JJX A;  1ZNL A;  4AYE C;  3FR5 A;  3FW5 A;  4RJW A;  3WXQ A;  2XE2 A;  3WJD A;  1MPF A;  1LIB A;  4E1T A;  5BVQ A;  5DL7 A;  4EFG A;  2BS5 A;  2FR3 A;  3AA1 A;  1CBQ A;  4CSB A;  4QGV A;  4NLI A;  1THQ A;  1CBR A;  1LFO A;  5D5D A;  4AZL A;  4HPA A;  4YFP A;  5F1E A;  2X8S A;  2BLG A;  1JBH A;  4GCQ A;  3MX7 A;  1KT5 A;  2FGQ X;  4FZM A;  5DG4 A;  3OE3 A;  4FGI B;  3B2K A;  4INN A;  4Y0R A;  4ZH6 A;  1A57 A;  2CBS A;  3TGA A;  4KRA A;  2JMM A;  1BLR A;  4Y0Q A;  1KQX A;  5EED A;  2MHL A;  4ZHH A;  4YDB A;  5F58 A;  4B61 A;  1HMS A;  1FEM A;  4YBU A;  7PRN A;  3KFH A;  3VZU X;  1U18 A;  4D6B A;  4IAX A;  5F6B A;  1HMR A;  2AT8 X;  1S2P A;  8PRN A;  2XST A;  4MIS A;  3DTQ A;  2A3F X;  3MBT A;  5B29 A;  1CBS A;  4ZFX A;  4ES7 A;  1KT4 A;  1B56 A;  1SXX A;  3UEW A;  4O4S A;  2AT3 X;  2LFO A;  1I06 A;  4BUM X;  1U17 A;  1HXU A;  2W80 C;  4BVM A;  3HOL A;  1JV4 A;  4TKH A;  2R73 A;  4KR8 A;  2OVS A;  3F8A A;  4E1S A;  3FA8 A;  5H9K A;  5EE2 A;  3D4R A;  5HCE C;  3AA1 B;  2AKQ A;  2AL0 X;  1YWD A;  4NYQ A;  3DA3 A;  4GHB A;  1EPB A;  1PEE A;  3U0D A;  2NNQ A;  4IMN A;  3BY0 A;  4TQ2 A;  2FR2 A;  4NNT A;  4LSH A;  1JYD A;  4FBR A;  5LKE A;  2F1T A;  3BU1 A;  1SY3 A;  1GFN A;  5HA0 A;  1DC9 A;  4RLB A;  5AQ6 A;  5DL8 A;  4ZCB A;  2JMB A;  4YDA A;  2O62 A;  3PRN A;  3WJC A;  3CWK A;  4U8U M;  4AKR B;  1SXY A;  2GJ5 A;  2FS6 A;  4GDZ A;  3BDR A;  3EM0 A;  3P6G A;  3SY9 A;  3JSQ A;  4IBA A;  3WI4 A;  3G7G A;  4WFV A;  5D4A A;  4KH8 A;  2GE4 A;  5FQ7 E;  1KT7 A;  1QQS A;  1S44 A;  4KC8 A;  3K3L A;  3P24 A;  4U3Q A;  1OBP A;  3TGC A;  3A2S X;  1TW4 A;  3POQ A;  4QAE A;  2KD2 A;  1MX7 A;  3D97 A;  2POR A;  4I95 A;  3EMN X;  3S60 A;  4O4U A;  1BBP A;  3AA7 A;  4EDE A;  4ORU A;  5FQ6 E;  1E5P A;  1ZHZ A;  4O3Y A;  3FIQ A;  5D47 A;  3P6C A;  4PSQ A;  4HPC A;  4AW8 A;  1DV9 A;  1H6S 1;  1HN2 A;  2G79 A;  1A2D A;  4AZM A;  1IZN A;  1S7D A;  3V8U A;  4FSP A;  3ZW1 A;  3HK1 A;  4WFU A;  2RA6 A;  3CQN A;  2KT4 B;  4QGW A;  5AJB A;  4U8U O;  4GZV A;  5EPQ A;  5LJC A;  1OEK A;  5DL6 A;  3H3I A;  5BYP A;  4LKT A;  3C78 X;  5KID A;  3HWB A;  1GFQ A;  3AAE B;  4AYD C;  5LJB A;  3P6F A;  4IB9 A;  3ZZV A;  3U9P C;  1D3S A;  3LK4 1;  4QZT A;  2FGR A;  1IIU A;  3O19 A;  1GGL A;  4IB8 A;  4LZU A;  3ZQ3 A;  5HAE A;  4YCE A;  5IO7 A;  5C0N A;  5EEE A;  2G7B A;  5HZ8 A;  4ODD A;  3C5O A;  1Q9G A;  3LK3 A;  4ORY A;  5JR8 A;  4KII A;  2ZLD A;  2QO5 A;  1ZRY A;  3EYC A;  5KHP A;  4ZGF A;  3VE1 A;  1TOW A;  4YBP A;  4Y0S A;  1HBQ A;  2WQ9 A;  4YGG A;  1P6P A;  1X71 A;  1ZND A;  2OVD A;  5FEN A;  3SAO A;  4O4O A;  3FA6 A;  3VG3 A;  2LFU A;  5HZ9 A;  4XNK A;  5B27 A;  4I9R A;  1OSM A;  4MVI A;  4WBK A;  1ICM A;  3BRN A;  3NBX X;  4UU2 A;  3WJE A;  4DQ3 A;  4GNY A;  2KC0 A;  3LK2 A;  3LV4 A;  1FE3 A;  2QO6 A;  3APW A;  2KDY A;  3AA6 B;  3WOV A;  3PQS A;  1HXT A;  4OMX A;  1ALB A;  5BVS A;  3ZI8 A;  1E54 A;  1NP4 A;  3WJG A;  1MM4 A;  4GET A;  4GU8 A;  3UEU A;  3POX A;  2ACP X;  1GXA A;  2XE1 A;  6PRN A;  3UEV A;  4MIR A;  1AB0 A;  1BWY A;  2XTQ A;  2F73 A;  4FRX A;  2ASN X;  1MUP A;  4QGX A;  2ZFG A;  2Y2X A;  3UU2 A;  1IFC A;  2KTS A;  3ZWE A;  1LPJ A;  1YP7 A;  4QYN A;  4D6A A;  1ML7 A;  4OS8 A;  1ZNK A;  2F09 A;  3FMZ A;  4OMW A;  3HTY A;  1TVQ A;  4A8Z A;  4EXZ A;  4I3D A;  2FWV A;  3AKM A;  2W2F A;  1I4U A;  3POU A;  1DZM A;  4RL9 A;  2LB6 A;  1BSY A;  1G7N A;  3FEK A;  1O8V A;  4LZV A;  3VG7 A;  4GE1 A;  4AYI D;  4YCH A;  1A18 A;  5D45 A;  3OD9 A;  4AUI A;  4GCP A;  3FA7 A;  4ORR A;  3N91 A;  1CRB A;  3APV A;  3BX8 A;  3NQ3 A;  4FOZ A;  3MVF A;  1GFM A;  2MO5 A;  1E02 A;  2KZ7 A;  2YG2 A;  3I0A A;  3KVD D;  3VY9 X;  5HTD A;  4AZP A;  1IKJ A;  2YNK A;  1YUP A;  1BSO A;  3D95 A;  1BEB A;  5EZ2 A;  4XMF A;  1KZW A;  3SYS A;  4OS0 A;  2FT9 A;  4GKC A;  4G76 A;  3JQO A;  4NYR A;  2HYS A;  1T8V A;  3O0E A;  1PHO A;  4U8U N;  2L5P A;  2WQA E;  4WHI A;  1KOI A;  4ZHD A;  1G90 A;  1GKA A;  4QYP A;  3SZV A;  1GX9 A;  2WEX A;  1CBI A;  1U0X A;  4QQ1 A;  5FQ8 E;  5CE4 A;  4AYH A;  2X27 X;  4AKM A;  2MHD A;  3TZS A;  2FTB A;  3VG2 A;  4XME A;  3BS2 A;  3UPG A;  4IB7 A;  3VU1 A;  3PED A;  2Q2P A;  5T5F A;  1OBQ A;  4L1N A;  1Z24 A;  3B2H A;  1G74 A;  4D64 A;  1OBU A;  5FAZ A;  4YFQ A;  4AFK A;  1ZHT A;  4KT5 A;  1LID A;  3FR2 A;  2K62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...