4O4XA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
513
structure length
503
Chain Sequence
EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTALNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDINGKKMVAVACCSNLEYMKFGQLWQQTEKQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
molecule keywords TbpB
total genus 112
structure length 503
sequence length 513
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA02
4O49A 4AYEC 2KDYA 4U9CA 3VE2A 4O3YA 2W81C 2YPVA 3VE1A 5T5FA 3PQSA 4O4UA 4O3WA 2LFUA 4AYNA 4O3ZA 4O4XA 4AYID 2W80C 3V8UA 4Z3TA 2KC0A 3HOLA 1YS5A 5EE2A 3KVDD 4O3XB 4QQ1A 4AYDC 3PQUA 4AYMC 3HOEA 2Y7SA 3UAQA
chains in the Genus database with same CATH superfamily
5H9LA 1S5LO 3EYCA 5FVNA 2ZLDA 5HZ9A 2A3FX 4O4SA 3EMNX 2MWHA 5L8IA 5ADXL 5B2AO 2W80C 3RDOA 4CPEA 2FS6A 4YDBA 1Y9LA 3DWNA 4GF4A 4AZNA 3WJBA 4ZHFA 2A8GA 3VU1A 2A2GA 4AUIA 1PM1X 3ELZA 1SXYA 3OJYC 4FBVA 3AA7A 1HN2A 2LBAA 4GGRA 4ZHHA 3STKA 2OYBO 4BGFA 2KTDA 4E1TA 1X8QA 5CYBA 1JMZA 5IYUA 1GKAB 2RCTA 3NX1A 4O3YA 1SRJA 1QY1A 1VWAB 3STNA 7PRNA 1EXSA 2WWPA 4AZRA 5PRNA 2XG6A 2K23A 1SXXA 3P24A 1GFQA 5ADXK 1I78A 1ADLA 3K3LA 3HWEA 1HXZA 1UYNX 2G79A 4U9CA 4ZH6A 1T1LA 3T1DA 3AAEA 3G7XA 3OD9A 2DJFA 4NV8A 1ERXA 4PJ2A 1LCZA 1X8PA 3OBLA 5LKEA 4AW8A 3AA0A 4I6SA 4I9SA 1ICMA 5AJCA 2KZ7B 2WVPA 4AYEC 3AEHA 4EFGA 5HZ5A 4O4UA 1MDCA 1QJPA 1IFCA 4HPDA 2QTKA 4CDFA 3BY0A 5DL8A 1S44A 1SWAA 2OL6O 4ML7B 1TOUA 3CWKA 5K68A 1N9YA 3POUA 2Y7SA 3C76X 4B61A 3JTYA 2MJIA 3WYQA 3FDCA 1KL3A 3KFFA 1KL4A 2VDFA 4YFRA 5D5DA 2R4PA 3WZOA 1IKEA 1KZWA 2GTLO 1GT3A 3SLOA 1O1UA 5TISO 2RD7C 1VWPB 4KT5A 1YWAA 1KT5A 1UYOX 1B56A 1RLBE 3ZW1A 2JMMA 2C1QA 4ZCBA 3RDXA 1MM5A 3NQ3A 2NNEA 5D47A 2AKQA 1DZKA 5GV0A 2X4MA 2GC9A 1EQDA 4MVLA 4XMFA 2XTRA 2R73A 4COTA 3ZI8A 4FRTA 1NQMA 2OFMX 2XE5A 2IZHB 4AYID 4LSFA 3NP1A 1RSTB 5F58A 4LSEA 2OF8A 1LKEA 4FZNA 3Q34A 4GZVA 5F6BA 4NV7A 4RJWA 1E00A 2JOZA 3VHIA 3ZQ3A 1CBSA 1A57A 2PORA 1VWQB 1GT5A 2AH7X 1SWBA 1RAVA 1IKJA 3FMZA 3PECA 5D48A 3FYXA 5L8OA 1ZNLA 1MEPA 1SLDB 4Z6JA 2ACPX 2RTNB 4D65A 5LJBA 2FKGA 5B5EO 2UZ2A 4YCHA 4OS3A 3WZNA 2NNQA 3FYFA 3PGRA 5BVTA 1E2TA 4JGLA 2GTLM 1SWTA 5L8NA 2RTRB 4BQUA 2J4UP 1LFOA 1QJ9A 2Q2MA 3PGSA 2JN3A 1HXLA 1VPRA 3APUA 4ZHDA 4FBOA 3ZUOA 3A0BO 1CJ5A 1QFTA 3S26A 4K3CA 4AZLA 3VPJE 2WSJA 2N2MA 1UZ2X 4AKMA 2R88A 3PDFA 5K67A 1S2PA 4XMEA 1PTSA 2W2BA 3PPTA 1LF7A 3SOTA 3MVFA 1GFPA 4EKVA 4ZHCA 4GGTA 1A3YA 3NSGA 2A0AA 4RUUA 3PGUA 4CPHA 4CK4A 2IZCB 4MVIA 3P6DA 4I3CA 4KC7A 1OEKA 1CBQA 5FQ8E 2PI3O 4EDEA 1BBPA 3APXA 5IRUA 5KICA 4N58A 3BSZE 5EEEA 1A2DA 1HMRA 5BVSA 2Y32A 1VYOA 1BEBA 3B2HA 4QNIA 4YDAA 1GFNA 3ZW2A 2QM9A 2GTLN 1DZPA 4LZVA 1HMTA 2QO6A 5L3YA 1IJ8A 4G76A 5B10O 4IL6O 3LK41 3X00A 3SAOA 3EBKA 2I5ZO 4INNA 3VZUX 2ZAIA 4HPCA 4Y59A 1EIOA 3PEDA 1ZHTA 1IZNB 3FEKA 1IW2A 2R89A 3EW2A 1KT4A 3T20A 3D4RA 4YFPA 2A5BA 1KQWA 2Y3EA 3VG4A 1OSPO 3EC5A 2MO5A 1STPA 5JD2A 4TKJA 3IFBA 2AL0X 5IO6A 2ZAGA 3ZUIA 2LA7A 3WZQA 3NQ9A 5IRWA 1BLRA 1X8UA 5D45A 3VY9X 3H3IA 2OMFA 1SLGB 2QO4A 1VYFA 1BSYA 3UAQA 4MVEA 3A0HO 4BX7B 1WBIA 3FENA 1S7DA 2Z4HA 5HTEA 3F9DA 4AYNA 2X9KA 3VHHA 2UYWA 1JQPA 5HWZA 5G26A 4NLIA 4O3XB 3PQUA 2OY8A 1X71A 1N0SA 4BCSA 4AKRB 5H2FO 5IO5A 4N59A 4RL9A 1SWKA 4D64A 1GX8A 3RY2A 3RDUA 4OS0A 4Y5DA 4XMCA 1AQBA 2IZJA 4RLCA 3LK2A 3IA8A 1EI5A 4IABA 4ZHGA 1Z24A 3KVDD 4AYDC 1Y52X 1STSB 2DJGA 2GH7A 1SY3A 1JIWI 1GXAA 4O49A 1Q9GA 3RBHA 5IO7A 3VG6A 3HK1A 4CPHB 3TGCA 4ZJ0A 2JU7A 3HWBA 3PH6A 5IXGA 4O4XA 5D8JA 4GGZA 1LCWA 2YMSA 4BX6A 4PUXA 4U46A 4FT6A 4OMXA 1N9MA 2WR6A 3WI5A 2BS5A 1VWNB 4C4VB 2I5VO 1NP1A 1IFBA 2Z4IA 2LFUA 4IAXA 2NP1A 4WBKA 1KFFA 4ORRA 3HOLA 3K19A 2E4JA 5GTIO 2AT5X 3SLJA 1P4TA 4KCAA 3WJCA 2MNHA 1E54A 1ZHWA 2X8TA 1B0OA 1KQXA 4MIRA 4FESA 4FQBB 3AA1A 2N2LA 1JJXA 4DQ3A 4ZGFA 2IZAA 4C4VA 1E06A 1H91A 5FAZA 3FIQA 3NX2A 3DA4A 5HA0A 3KQ0A 2QO5A 1R0UA 1DZJA 3PQSA 4NNSA 1JV4A 1SRGA 1YWDA 4ODDA 3F8AA 3QRCA 2POAA 3MX7A 5HTDA 1G90A 2FR2A 1QJ8A 4F4BA 4U8UO 1XKIA 2P8GA 4IMNA 3SZHA 1VWEB 4QGWA 2OL7A 1VWJB 5CE4A 4GH7A 1YWCA 2JU8A 4KIIA 4RLBA 1L6MA 3BRZA 5EPQA 2IZLB 3CMPA 1JYJA 2Y2XA 4ES7A 1BWYA 5HAEA 2G78A 3DWOX 4MVKA 1SY2A 4JCHA 3BU9A 1I9HA 2NNDA 2IZEB 2XE2A 4A1YA 4IMOA 3LV4A 3S60A 1BXWA 1VWLB 2W2FA 4L3RA 3T24A 3HWGA 5D4AA 2KD2A 3RBYA 1AVDA 1LPJA 2R4OA 5DG4A 4U8UM 3BU1A 4LSIA 5FENA 8PRNA 5F2BA 5EZ2A 3RZYA 2L67A 2KXPB 1NDJA 3QKGA 4LZUA 5KIDA 1TW4A 3CBSA 3U0DA 1AELA 1U18A 4UB8O 1VWIB 1LELA 4BX6B 2M4LA 4GRJA 4Y0QA 1HQPA 3PP6A 3P6GA 2F1CX 1I04A 2RN4A 1ZNKA 3V8UA 1G74A 2FWVA 4GU8A 2AT8X 1BM5A 2AT6X 4YMYA 1FJ1E 2BLGA 2ASNX 2OVSA 3AKMA 1U0XA 1ACDA 4DQ4A 1VWDB 2Y0HA 3A2SX 2RTCB 4YBUA 4LKPA 4CDDA 3VY8X 2YNKA 4YKOA 2N93A 4JNJA 3DZMA 1LNMA 2ALLX 3RE6A 1MOYA 3FR2A 2G7BA 3S5XA 1ZNHA 4OKAA 4FMSA 1NP4A 4I3BA 5AFUK 1FELA 2IWVA 3UU2A 2RTGB 5DL5A 3TZSA 1LICA 3T2WA 5HZ6A 2WQAE 4XMHA 4KRAA 2XE1A 1DFVA 5HZ8A 4IB9A 3SYBA 4D6AA 2OFRX 4OS8A 4K3BA 1G5WA 3VG5A 4Y0SA 4YVBA 2FR3A 2LB6A 2GTFX 1K24A 4FZLA 1TVQA 1XCAA 3AA6A 4BOEA 2R4NA 4RJXA 3RWXA 4HWMA 4UU2A 4AYMC 5FFHA 3CKGA 1EPBA 4QAEA 4EEJA 3P6CA 3UEXA 4ZGUA 4GDAA 4FBRA 1OSMA 3D97A 4HPAA 2RTEB 4CV7A 2YG2A 4D5UA 4NYRA 4GK9A 3EMMA 3AA7B 3WZPA 2HZRA 1SWHA 3RSWA 2KDYA 1VWGB 2PRNA 2WJRA 4PR7A 3EW1A 1SMPI 1T0VA 5FQ7E 4ORUA 4N7CA 1LIFA 2DM5A 1SWRA 2OZQA 3AAAB 4KR4A 2BS6A 1DF3A 4U8UN 2RTBB 3FIDA 3ZZVA 2Y0LA 3U9PC 2IWWA 1JYDA 3WBGA 1LIDA 2OY1O 1NBXA 1VWFB 1SWDA 3L4RA 4GNYA 4DNEA 2X46A 1SWJA 3HTYA 2K0LA 1SWGA 4UU3A 2IFBA 5B11O 4O3ZA 3B2IA 3F6ZB 1EALA 2F1TA 4FRXA 4QZTA 4BX5B 3WOVA 3FW5A 1Y9TA 4GNWA 2Q9SA 1KL5A 2O62A 1ORMA 4Z2PA 2WEXA 2Y0KA 1JMXA 2EU7X 5EEDA 2RTLA 3NBXX 3O2YA 4L1NA 4U3QA 5DL7A 3C5OA 2IZFB 1MX7A 2ANSA 2M07A 1ZHYA 1O8VA 4GD9A 4AZPA 2RTJA 2J1NA 1CBRA 2HLVA 5LJGA 1THQA 1SXWA 2ZFGA 2IZKA 1PHOA 3B2JA 3BRYA 2QMIA 3PK2A 1OPBA 5E79O 1KGLA 3KFGA 3G7GA 1DV9A 1SREA 4IB8A 1ZHXA 4N75A 1HXXA 3GAQA 4XMDA 2X8SA 5HCEC 4TQ2A 4JO6A 3RDQA 1VWOB 2LHFA 1H6S1 2VFBA 1BH3A 2X45A 4FGIB 3TGAA 1GKAA 5B27A 5HCCC 1YS5A 1OBQA 1SLEB 4BBOA 3HWDA 3D95A 3AKNA 3SY7A 2A13A 5HA1A 1BJ7A 2W81C 5H9KA 4GDZA 2RTMA 4YKMA 1X89A 4IAWA 4ALBA 3QRAA 5H8TA 3LHNA 2HMBA 1I05A 1TOWA 3FA8A 3HWFA 2FGRA 3RDMA 3DTQA 1JZUA 3T0SA 3I17A 2CBSA 2JU3A 4Z27A 4BX7A 4FSPA 3WYPA 3PH5A 2K4TA 3PF1A 2BHVA 1X8OA 3FEPA 2WEWA 1FDQA 5FQ6E 4UB6O 2HYSA 1YWBA 1DC9A 1B8EA 2KXPA 2ODJA 2F73A 3MBTA 4IRWA 4YGHA 1STRB 1MK5A 5DPQA 1DZMA 3ZW0A 1K3BA 3JQOA 1PBYA 3KZIO 5LJCA 1OBPA 2Q2PA 2A2UA 2OY7A 1BSOA 1T16A 3WU2O 1NGLA 3AAEB 1OPFA 5AQ6A 2Q4NA 2F01A 4N74A 4DCBA 2MF6A 5CHKA 2JMBA 4ORXA 6PRNA 2IZDB 2RTHB 3FA9A 3AA0B 4CDCA 4OEMA 2WPUA 4M7MA 3ZW0B 4NW4A 2L9CA 2BT9A 4KH8A 3P6FA 2RCQA 4C69X 1SY0A 1AVGI 1VWRB 3SLTA 1LDQA 2XSTA 5LJHA 4LQZA 5C0NA 3P6HA 2R74A 3CKFA 4MEEA 1GFOA 1BRPA 3WJGA 1RXJA 5H9AA 3JCUO 1KOIA 2Q39A 1HY2A 3VGWA 1YUPA 4CPIA 3DSZA 3KFIA 5F1EA 4A8ZA 3C77X 1D2UA 5F7GA 5B5FA 1SLFB 4B55A 1SWUA 5F6ZA 1ZRYA 4K19A 2RTKA 2HZQA 4JHQA 2A5CA 3CQNA 4C5PA 1ALBA 2R8AA 2WUTA 1WUBA 1W4TA 3HPEA 5EDBA 3D96A 3VE2A 4XNKA 3SY9A 3FR5A 4Y0PA 4QYPA 3FA7A 4YBPA 2OFAA 3UPGA 3FLLA 3BX7A 1KT6A 2RTAA 1P6PA 3BRNA 3E3CA 2K62A 4QGVA 2RTIB 3BS0A 1OEJA 4RUNA 2LFOA 1DF8A 4QGXA 2IZBA 1IIUA 1OBUA 2KTSA 4YCEA 2X8FA 3BX8A 4ZR2A 1AVEA 1KT7A 5G3AA 2GJ5A 1IZNA 3LTWA 3O22A 2KC0A 1BT9A 5AFUL 1QABE 2RTDB 4C00A 2HNXA 3NJTA 3HOEA 4FZMA 4Z28A 3NR3A 3U03A 3P02A 3AAAA 4NLJA 4Y0RA 3WVMA 1PEEA 4N7DA 2JGSA 3WI4A 1NQNA 1ZNEA 3FELA 3BDRA 4BX5A 3WXQA 5JR8A 1YP7A 3S5VA 2WQ9A 1RBPA 1X8NA 3ELXA 4ORYA 1FTPA 2R4LA 4GCPA 2LKKA 2AT3X 3VZWX 2RA6A 2VFCA 2AT0X 1FE3A 4GJVA 4QYNA 1QG5A 2ERVA 1Y55X 4ZH9A 4I3DA 3P6EA 2QOMA 5IRAA 4AKRA 3FW4A 4LKTA 1MVGA 3B2LA 1E5PA 1MPFA 2W2AA 2FGQX 1RSUB 4FOZA 1LCVA 3ZWEA 3VG3A 1CRBA 2C4IA 2AMMX 3HW9A 2FRSA 4ORWA 3I0AA 3SZVA 4AZOA 2IZIA 1D3SA 2PY1A 1MUPA 1VWHB 4EXZA 3WJDA 1TXLA 1U17A 3SYSA 4JFBA 5B3MO 3VHMA 4KC8A 4ZFXA 4YGGA 3ZW1B 2RTPB 5T5FA 1LDOA 2QOSC 1QWDA 2BSZA 2OVEA 3Q6LA 3POQA 4TJZA 1ZNGA 5BYPA 5GTHO 2X27X 2ACOA 1SWCA 1CBIA 2GE4A 5LJDA 1SXUA 4A1HA 2FLJA 4WFVA 1HXTA 2CM4A 5CSEA 2XMXA 4NYQA 1A18A 3KVNA 4CTDA 2AXTO 4NP1A 4IBAA 2FKJA 1KXOA 3RKGA 5LJKA 1N4JA 1SWOA 5HCDC 3NPOA 2X56A 5H9NA 2AVIA 1HBPA 3VE1A 1JJJA 2OL8O 3O0EA 3POXA 2FT9A 2RTFB 1G85A 4QZUA 1B4MA 1G7NA 2ZSCA 2CZUA 5HBSA 1GGLA 3T6FA 1W5RA 3LK3A 2G8CO 2L5PA 1VWKB 5EDCA 1GT4A 4AZMA 1SWFA 1JJUA 2MM3A 2OVDA 1SY1A 3WJEA 3D9WA 3FA6A 1YP6A 4AZQA 3CBCA 4R0BA 1Y53X 4G75A 3VG2A 1AB0A 2KT4B 2OVAA 1N43A 5AEOA 2MHLA 3RY1A 4GE1A 3QQ2A 5BVQA 2C1SA 4TKBA 2KZ7A 4NNTA 2LBVA 3AA1B 4GHBA 3SZIA 4GCQA 3VZTX 2X32A 4OELA 1JBHA 1ERBA 2FHNX 4FQEA 1GX9A 3OE3A 1EW3A 5B29A 2CAMA 3T6LA 5LKFA 2CZTA 1VWMB 2FHLA 4PJ0O 4YFQA 2YPVA 4GCSA 3FR4A 2KW1A 4AYHA 3DA3A 1GM6A 2MHDA 3RDSA 4CDEA 3N91A 3UEWA 2O4VA 3EBWA 5G39A 2JW1A 1LUQA 3APVA 1MM4A 1MM9A 2M06A 2RTOB 4A60A 1N7YA 3UEUA 2L68A 1OPAA 1SRHA 1ICNA 1ZHZA 4YGZA 4Z3TA 3GP6A 3APWA 3RE5A 1SA8A 2F09A 3EM0A 1SWSA 4IB6A 3VG7A 4M6SA 3MG5A 3WJFA 2FS7A 2OF9A 2RQ0A 4Z2VA 2HKDA 5KAIO 3PORA 4CSBA 1SWEA 1QQSA 1T68X 4ON1A 3SZJA 4I95A 4I60A 1HBQA 4AFKA 1FEMA 4Z2OA 1HXUA 1RXKA 1VWBB 1FENA 5AJBA 1PRNA 3BLGA 1PBOA 1QY0A 4PSQA 1ZNDA 3LK3B 3T2XA 1SRFA 4XNLA 2FGSA 3KFHA 1ML7A 3PRNA 1QFVA 4O4OA 1I06A 3TF6A 3TGBA 5DL6A 4GUZA 5HZQA 2WJQA 3AA6B 3JSQA 4GKCA 5K06A 4HFOA 4O9SA 1Y0GA 4O3WA 4KR8A 3SZDA 1O1VA 4OMWA 1GX3A 4YH0A 3KZAA 4LSHA 2X55A 1UREA 4QRLA 5G38A 1EPAA 5B66O 3TZGA 4CPFA 3LK42 1NC9A 1SWQA 3UEVA 2AF5A 3C78X 4GETA 2R56A 2CM9A 1VWCB 4TKHA 2XTQA 4WFUA 2FTBA 4D6BA 3AUMO 2XE3A 3LK2B 1HQQA 5KHPA 4FUVA 2BC3A 2OFBA 1GFMA 1SRIA 1I4UA 3NADA 3STMX 4E1SA 2IZGB 1PMPA 3MM0A 4HPBA 2JQYA 3CQRA 1MX8A 1VYGA 1T8VA 1OEEA 2CBRA 1HMSA 4QQ1A 4FSOA 1BRQA 4ID2A 1SWNA 1EIIA 1KZXA 1SWLA 3BS2A 4WHIA 3O19A 4BJ8A 4BUMX 2RTQB 1EUOA 4EQAC 2X34A 4MISA 4ALOA 1BSQA 3CR6A 1LIBA 4GJSA 5B5GA 3GE2A 2XKLA 5EE2A 4IB7A 4I9RA 1YIVA 5KAFO 2Y3FA 4ORSA 4TNNA 4TLJA 1E02A 1KT3A 1W6FA 4XMGA 2QCBA 1SWPA 1RXHA 2OY5O 1GT1A 5LJEA 3JS1A 1QY2A 3B2KA 2G5LA 4ARHA 2F1VA 1LIEA 4BVMA 3NQKA 5JDPA 1Q9FA
chains in the Genus database with same CATH topology
5H9LA 3ZWEA 3FENA 3EYCA 1S7DA 3HTYA 3VG3A 5HZ9A 2K0LA 1CRBA 2ZLDA 5FVNA 2A3FX 4O4SA 2AMMX 3EMNX 4UU3A 2MWHA 3HW9A 2Z4HA 2FRSA 5HTEA 3F9DA 5L8IA 5ADXL 4ORWA 3I0AA 3SZVA 2IFBA 4AZOA 4AYNA 4O3ZA 3B2IA 3F6ZB 1EALA 2F1TA 2W80C 1D3SA 2PY1A 1MUPA 4QZTA 5HWZA 4FRXA 3WOVA 5G26A 2FS6A 4NLIA 4EXZA 3WJDA 1TXLA 1Y9TA 3FW5A 1U17A 2Q9SA 4GNWA 4YDBA 1Y9LA 4O3XB 4JFBA 2O62A 3SYSA 3PQUA 1ORMA 1X71A 1N0SA 4AKRB 4GF4A 2WEXA 5IO5A 4KC8A 4N59A 4RL9A 4AZNA 2Y0KA 2EU7X 4ZFXA 4D64A 3WJBA 5EEDA 1GX8A 4YGGA 4ZHFA 3ZW1B 3VU1A 3NBXX 3O2YA 2A2GA 4L1NA 4U3QA 5DL7A 4AUIA 4OS0A 3C5OA 5T5FA 1PM1X 3ELZA 1AQBA 1SXYA 2QOSC 3OJYC 4FBVA 4XMCA 1MX7A 1QWDA 4RLCA 3AA7A 1HN2A 2LBAA 2ANSA 3IA8A 2M07A 2OVEA 1ZHYA 3Q6LA 3LK2A 3POQA 4ZHHA 1O8VA 1EI5A 4IABA 3STKA 4ZHGA 4AZPA 4TJZA 2KTDA 1Z24A 1ZNGA 2J1NA 5BYPA 3KVDD 1CBRA 2HLVA 5LJGA 2X27X 4AYDC 2ACOA 1THQA 1SXWA 1CBIA 4E1TA 1X8QA 5CYBA 2GE4A 2ZFGA 5IYUA 5LJDA 1SXUA 1JIWI 1GKAB 1SY3A 4A1HA 1GXAA 4O49A 2FLJA 1Q9GA 3RBHA 4WFVA 5IO7A 3VG6A 3HK1A 1HXTA 1PHOA 2RCTA 3NX1A 3B2JA 4O3YA 2CM4A 4ZJ0A 2JU7A 2QMIA 3TGCA 3HWBA 1OPBA 1KGLA 1QY1A 3PH6A 2XMXA 3KFGA 3G7GA 3STNA 1DV9A 7PRNA 1EXSA 4NYQA 4O4XA 1A18A 5D8JA 4IB8A 2WWPA 4AZRA 5PRNA 2XG6A 2K23A 1SXXA 2YMSA 1ZHXA 3P24A 4NP1A 1GFQA 4PUXA 4IBAA 4FT6A 5ADXK 1KXOA 4OMXA 3RKGA 1HXXA 1ADLA 3GAQA 4XMDA 2X8SA 5HCEC 5LJKA 3K3LA 4TQ2A 3HWEA 2WR6A 3WI5A 5HCDC 2LHFA 2BS5A 2G79A 3NPOA 1H6S1 5H9NA 1BH3A 4U9CA 1HBPA 4ZH6A 2X45A 3VE1A 1JJJA 3T1DA 3AAEA 3O0EA 3POXA 1NP1A 1IFBA 3G7XA 4FGIB 3OD9A 2Z4IA 2FT9A 1G85A 4QZUA 2LFUA 1ERXA 4PJ2A 4IAXA 3TGAA 1X8PA 1B4MA 2NP1A 3OBLA 1G7NA 4WBKA 4ORRA 1GKAA 3HOLA 5B27A 5HCCC 5LKEA 3K19A 1YS5A 2CZUA 5HBSA 1OBQA 4AW8A 1GGLA 3AA0A 2E4JA 3HWDA 2AT5X 3D95A 1P4TA 4I6SA 4I9SA 3LK3A 1ICMA 5AJCA 3AKNA 2KZ7B 4KCAA 3WJCA 4AYEC 3SY7A 2A13A 2MNHA 5HA1A 1E54A 2L5PA 5EDCA 1BJ7A 2X8TA 1ZHWA 2W81C 1B0OA 1GT4A 1KQXA 5H9KA 4AZMA 4EFGA 5HZ5A 4MIRA 4GDZA 4O4UA 4FESA 4FQBB 4YKMA 1MDCA 1QJPA 1X89A 1IFCA 3AA1A 4HPDA 2MM3A 2N2LA 1JJXA 2QTKA 4IAWA 4DQ3A 2OVDA 4ALBA 3QRAA 5H8TA 1SY1A 3BY0A 3LHNA 4ZGFA 5DL8A 2HMBA 1E06A 1H91A 1I05A 1S44A 1TOWA 3FA8A 3HWFA 5FAZA 2FGRA 3FIQA 1TOUA 3CWKA 4ML7B 3NX2A 3WJEA 3DTQA 3POUA 3DA4A 2Y7SA 1JZUA 3T0SA 3C76X 3I17A 2CBSA 1YP6A 2JU3A 3FA6A 3KQ0A 5HA0A 4AZQA 2QO5A 4FSPA 3CBCA 4R0BA 4B61A 1R0UA 3JTYA 4G75A 3VG2A 2MJIA 3PH5A 1AB0A 2KT4B 2K4TA 1DZJA 2BHVA 3PQSA 1X8OA 4NNSA 3KFFA 3FEPA 2OVAA 1JV4A 2WEWA 5AEOA 1FDQA 1YWDA 2MHLA 5FQ6E 4YFRA 5D5DA 4ODDA 3F8AA 2HYSA 1YWBA 3QRCA 4GE1A 1IKEA 2POAA 1KZWA 2GTLO 1GT3A 1DC9A 1B8EA 2KXPA 2ODJA 1O1UA 2F73A 3MBTA 5BVQA 3MX7A 2RD7C 4KT5A 1YWAA 4TKBA 1KT5A 2KZ7A 4YGHA 4NNTA 2LBVA 3AA1B 4GHBA 5DPQA 5HTDA 1DZMA 1G90A 1B56A 1RLBE 2FR2A 3ZW1A 3ZW0A 1QJ8A 2JMMA 4ZCBA 4GCQA 4U8UO 1XKIA 2P8GA 4IMNA 4F4BA 3VZTX 1JBHA 3JQOA 1MM5A 3NQ3A 4QGWA 2NNEA 5LJCA 1ERBA 5CE4A 1OBPA 2Q2PA 1GX9A 5D47A 2A2UA 2AKQA 3OE3A 4GH7A 1DZKA 1BSOA 1YWCA 5GV0A 2JU8A 1EW3A 2GC9A 1NGLA 5B29A 3AAEB 4KIIA 1OPFA 1L6MA 4RLBA 5AQ6A 5EPQA 1EQDA 4MVLA 4XMFA 2XTRA 2R73A 5LKFA 2CZTA 2Q4NA 4COTA 3CMPA 1JYJA 2Y2XA 3ZI8A 4FRTA 2OFMX 4ES7A 1BWYA 4YFQA 2XE5A 5HAEA 2JMBA 4ORXA 2G78A 2YPVA 6PRNA 4MVKA 4GCSA 3FA9A 3FR4A 3AA0B 2KW1A 4AYHA 1SY2A 4JCHA 3DA3A 1GM6A 2MHDA 3BU9A 4AYID 3NP1A 4LSFA 2NNDA 3N91A 4M7MA 5F58A 3UEWA 4LSEA 3ZW0B 2XE2A 4NW4A 1LKEA 2O4VA 2L9CA 4FZNA 4A1YA 2BT9A 3EBWA 3LV4A 4IMOA 4GZVA 5F6BA 4KH8A 3S60A 4RJWA 2JW1A 1BXWA 3P6FA 2RCQA 4C69X 1E00A 1SY0A 3APVA 1AVGI 2JOZA 1MM4A 2W2FA 4L3RA 3ZQ3A 1CBSA 1A57A 2M06A 4A60A 2PORA 3T24A 2XSTA 1GT5A 2L68A 3HWGA 5D4AA 1OPAA 2KD2A 2AH7X 3UEUA 4LQZA 5LJHA 3RBYA 5C0NA 3P6HA 1IKJA 2R74A 1ICNA 1LPJA 1ZHZA 5DG4A 4YGZA 3FMZA 3PECA 4U8UM 3BU1A 4LSIA 4Z3TA 5FENA 1GFOA 1BRPA 3WJGA 8PRNA 3GP6A 5D48A 5EZ2A 3RZYA 2L67A 3APWA 5H9AA 2KXPB 3FYXA 5L8OA 1KOIA 1ZNLA 3QKGA 2Q39A 4LZUA 1SA8A 2F09A 1TW4A 3CBSA 3EM0A 5KIDA 1YUPA 4IB6A 3U0DA 1AELA 3DSZA 2ACPX 3VG7A 4M6SA 1U18A 3KFIA 5F1EA 3WJFA 2FS7A 4A8ZA 3C77X 4D65A 2M4LA 5LJBA 1D2UA 4GRJA 5F7GA 4Y0QA 1HQPA 3PP6A 4YCHA 2RQ0A 3P6GA 1I04A 2RN4A 5F6ZA 1ZRYA 4K19A 4OS3A 2HZQA 3PORA 1ZNKA 4CSBA 3V8UA 2NNQA 3FYFA 1G74A 2FWVA 4GU8A 3CQNA 5BVTA 2AT8X 1BM5A 1QQSA 1ALBA 4JGLA 2AT6X 1T68X 4ON1A 2WUTA 2GTLM 4I95A 5L8NA 4BQUA 4YMYA 2J4UP 1HBQA 1LFOA 2BLGA 2ASNX 1QJ9A 2OVSA 4AFKA 1FEMA 5EDBA 3AKMA 1HXUA 1U0XA 1ACDA 3D96A 4DQ4A 3VE2A 2Q2MA 1FENA 5AJBA 1PRNA 3BLGA 2Y0HA 4XNKA 1PBOA 2JN3A 3SY9A 1QY0A 1VPRA 3APUA 3FR5A 4QYPA 4PSQA 3FA7A 4Y0PA 4ZHDA 1ZNDA 4FBOA 3ZUOA 3A2SX 1CJ5A 1QFTA 3LK3B 4YBUA 4LKPA 4XNLA 3S26A 4YBPA 3UPGA 3FLLA 1ML7A 3BX7A 3KFHA 3PRNA 1QFVA 3VY8X 1KT6A 4AZLA 3VPJE 1P6PA 2WSJA 2YNKA 3BRNA 3E3CA 2K62A 2N93A 4O4OA 1I06A 1UZ2X 4YKOA 3TF6A 4QGVA 3TGBA 2N2MA 1LNMA 2ALLX 5HZQA 5DL6A 1S2PA 3FR2A 4XMEA 2G7BA 3AA6B 3S5XA 2W2BA 1ZNHA 3PPTA 3JSQA 4GKCA 5K06A 4HFOA 1LF7A 3SOTA 3MVFA 1GFPA 4FMSA 4O9SA 1OEJA 4RUNA 4O3WA 4ZHCA 4KR8A 1A3YA 1NP4A 2LFOA 1FELA 4I3BA 1O1VA 4OMWA 3NSGA 3SZDA 5AFUK 4QGXA 3UU2A 5DL5A 3TZSA 2A0AA 1LICA 4RUUA 4YH0A 3KZAA 4LSHA 1UREA 4QRLA 2WQAE 5HZ6A 4CK4A 1EPAA 4MVIA 4XMHA 3P6DA 3TZGA 1IIUA 3LK42 4I3CA 1OBUA 4KC7A 2XE1A 4KRAA 2KTSA 4YCEA 2X8FA 1DFVA 1OEKA 3UEVA 1CBQA 5FQ8E 5HZ8A 3BX8A 4IB9A 3SYBA 4D6AA 2OFRX 3C78X 4OS8A 4GETA 4EDEA 1BBPA 2R56A 2CM9A 3APXA 5KICA 1G5WA 4TKHA 4ZR2A 3VG5A 2XTQA 4N58A 1KT7A 3BSZE 5EEEA 4WFUA 1A2DA 2FTBA 4Y0SA 4AKMA 1HMRA 5BVSA 2GJ5A 4D6BA 1IZNA 2FR3A 2XE3A 3LK2B 2LB6A 3O22A 2GTFX 4FZLA 1TVQA 1XCAA 2KC0A 1BT9A 3AA6A 1BEBA 3B2HA 4QNIA 4YDAA 4BOEA 3ZW2A 5KHPA 1GFNA 5AFUL 4RJXA 3RWXA 4FUVA 1QABE 2QM9A 4HWMA 2GTLN 4UU2A 2HNXA 1DZPA 4AYMC 3HOEA 4FZMA 4LZVA 1GFMA 3U03A 3NR3A 3P02A 3AAAA 1HMTA 2QO6A 5FFHA 1I4UA 1EPBA 4G76A 3NADA 4NLJA 4Y0RA 4QAEA 4EEJA 3P6CA 3UEXA 3STMX 3WVMA 4E1SA 1PEEA 4ZGUA 1PMPA 4HPBA 4FBRA 4N7DA 1OSMA 3CQRA 3D97A 4HPAA 3LK41 1MX8A 1VYGA 3WI4A 3SAOA 3EBKA 1T8VA 1ZNEA 1OEEA 3FELA 4INNA 3VZUX 2ZAIA 4CV7A 2CBRA 1HMSA 3BDRA 2YG2A 4HPCA 4QQ1A 3WXQA 4FSOA 4D5UA 4NYRA 4GK9A 5JR8A 1YP7A 1BRQA 3S5VA 3EMMA 1EIOA 3AA7B 2WQ9A 1RBPA 3PEDA 4ID2A 1X8NA 1IZNB 3ELXA 2HZRA 1ZHTA 3RSWA 1EIIA 1KZXA 3FEKA 1IW2A 1FTPA 3BS2A 4ORYA 1KT4A 4WHIA 4GCPA 2LKKA 2KDYA 3T20A 3D4RA 3O19A 2AT3X 3VZWX 2PRNA 4BUMX 4YFPA 2RA6A 2AT0X 1EUOA 1FE3A 4EQAC 1KQWA 4MISA 4QYNA 3VG4A 1QG5A 4ALOA 1BSQA 3CR6A 1LIBA 1SMPI 1T0VA 5FQ7E 3GE2A 2MO5A 2XKLA 2ERVA 5EE2A 4ORUA 4N7CA 1LIFA 4IB7A 2DM5A 4I9RA 4TKJA 1YIVA 3IFBA 4ZH9A 2OZQA 4I3DA 3P6EA 3AAAB 2AL0X 4ORSA 5IO6A 2ZAGA 3ZUIA 4KR4A 2BS6A 1DF3A 4U8UN 4TNNA 4TLJA 4AKRA 1E02A 2LA7A 3NQ9A 1KT3A 3FW4A 4LKTA 3ZZVA 4XMGA 2Y0LA 1MVGA 1BLRA 3U9PC 3B2LA 1E5PA 1JYDA 3WBGA 1X8UA 5D45A 1MPFA 3VY9X 1GT1A 1LIDA 2W2AA 3H3IA 2OMFA 5LJEA 2FGQX 3JS1A 2QO4A 1QY2A 1VYFA 3B2KA 4ARHA 1BSYA 3L4RA 1LIEA 4BVMA 2F1VA 4FOZA 4GNYA 3NQKA 5JDPA 3UAQA 1Q9FA 4MVEA 2X46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O49 A;  4AYE C;  2KDY A;  4U9C A;  3VE2 A;  4O3Y A;  2W81 C;  2YPV A;  3VE1 A;  5T5F A;  3PQS A;  4O4U A;  4O3W A;  2LFU A;  4AYN A;  4O3Z A;  4O4X A;  4AYI D;  2W80 C;  3V8U A;  4Z3T A;  2KC0 A;  3HOL A;  1YS5 A;  5EE2 A;  3KVD D;  4O3X B;  4QQ1 A;  4AYD C;  3PQU A;  4AYM C;  3HOE A;  2Y7S A;  3UAQ A; 
#chains in the Genus database with same CATH topology
 5H9L A;  1S5L O;  3EYC A;  5FVN A;  2ZLD A;  5HZ9 A;  2A3F X;  4O4S A;  3EMN X;  2MWH A;  5L8I A;  5ADX L;  5B2A O;  2W80 C;  3RDO A;  4CPE A;  2FS6 A;  4YDB A;  1Y9L A;  3DWN A;  4GF4 A;  4AZN A;  3WJB A;  4ZHF A;  2A8G A;  3VU1 A;  2A2G A;  4AUI A;  1PM1 X;  3ELZ A;  1SXY A;  3OJY C;  4FBV A;  3AA7 A;  1HN2 A;  2LBA A;  4GGR A;  4ZHH A;  3STK A;  2OYB O;  4BGF A;  2KTD A;  4E1T A;  1X8Q A;  5CYB A;  1JMZ A;  5IYU A;  1GKA B;  2RCT A;  3NX1 A;  4O3Y A;  1SRJ A;  1QY1 A;  1VWA B;  3STN A;  7PRN A;  1EXS A;  2WWP A;  4AZR A;  5PRN A;  2XG6 A;  2K23 A;  1SXX A;  3P24 A;  1GFQ A;  5ADX K;  1I78 A;  1ADL A;  3K3L A;  3HWE A;  1HXZ A;  1UYN X;  2G79 A;  4U9C A;  4ZH6 A;  1T1L A;  3T1D A;  3AAE A;  3G7X A;  3OD9 A;  2DJF A;  4NV8 A;  1ERX A;  4PJ2 A;  1LCZ A;  1X8P A;  3OBL A;  5LKE A;  4AW8 A;  3AA0 A;  4I6S A;  4I9S A;  1ICM A;  5AJC A;  2KZ7 B;  2WVP A;  4AYE C;  3AEH A;  4EFG A;  5HZ5 A;  4O4U A;  1MDC A;  1QJP A;  1IFC A;  4HPD A;  2QTK A;  4CDF A;  3BY0 A;  5DL8 A;  1S44 A;  1SWA A;  2OL6 O;  4ML7 B;  1TOU A;  3CWK A;  5K68 A;  1N9Y A;  3POU A;  2Y7S A;  3C76 X;  4B61 A;  3JTY A;  2MJI A;  3WYQ A;  3FDC A;  1KL3 A;  3KFF A;  1KL4 A;  2VDF A;  4YFR A;  5D5D A;  2R4P A;  3WZO A;  1IKE A;  1KZW A;  2GTL O;  1GT3 A;  3SLO A;  1O1U A;  5TIS O;  2RD7 C;  1VWP B;  4KT5 A;  1YWA A;  1KT5 A;  1UYO X;  1B56 A;  1RLB E;  3ZW1 A;  2JMM A;  2C1Q A;  4ZCB A;  3RDX A;  1MM5 A;  3NQ3 A;  2NNE A;  5D47 A;  2AKQ A;  1DZK A;  5GV0 A;  2X4M A;  2GC9 A;  1EQD A;  4MVL A;  4XMF A;  2XTR A;  2R73 A;  4COT A;  3ZI8 A;  4FRT A;  1NQM A;  2OFM X;  2XE5 A;  2IZH B;  4AYI D;  4LSF A;  3NP1 A;  1RST B;  5F58 A;  4LSE A;  2OF8 A;  1LKE A;  4FZN A;  3Q34 A;  4GZV A;  5F6B A;  4NV7 A;  4RJW A;  1E00 A;  2JOZ A;  3VHI A;  3ZQ3 A;  1CBS A;  1A57 A;  2POR A;  1VWQ B;  1GT5 A;  2AH7 X;  1SWB A;  1RAV A;  1IKJ A;  3FMZ A;  3PEC A;  5D48 A;  3FYX A;  5L8O A;  1ZNL A;  1MEP A;  1SLD B;  4Z6J A;  2ACP X;  2RTN B;  4D65 A;  5LJB A;  2FKG A;  5B5E O;  2UZ2 A;  4YCH A;  4OS3 A;  3WZN A;  2NNQ A;  3FYF A;  3PGR A;  5BVT A;  1E2T A;  4JGL A;  2GTL M;  1SWT A;  5L8N A;  2RTR B;  4BQU A;  2J4U P;  1LFO A;  1QJ9 A;  2Q2M A;  3PGS A;  2JN3 A;  1HXL A;  1VPR A;  3APU A;  4ZHD A;  4FBO A;  3ZUO A;  3A0B O;  1CJ5 A;  1QFT A;  3S26 A;  4K3C A;  4AZL A;  3VPJ E;  2WSJ A;  2N2M A;  1UZ2 X;  4AKM A;  2R88 A;  3PDF A;  5K67 A;  1S2P A;  4XME A;  1PTS A;  2W2B A;  3PPT A;  1LF7 A;  3SOT A;  3MVF A;  1GFP A;  4EKV A;  4ZHC A;  4GGT A;  1A3Y A;  3NSG A;  2A0A A;  4RUU A;  3PGU A;  4CPH A;  4CK4 A;  2IZC B;  4MVI A;  3P6D A;  4I3C A;  4KC7 A;  1OEK A;  1CBQ A;  5FQ8 E;  2PI3 O;  4EDE A;  1BBP A;  3APX A;  5IRU A;  5KIC A;  4N58 A;  3BSZ E;  5EEE A;  1A2D A;  1HMR A;  5BVS A;  2Y32 A;  1VYO A;  1BEB A;  3B2H A;  4QNI A;  4YDA A;  1GFN A;  3ZW2 A;  2QM9 A;  2GTL N;  1DZP A;  4LZV A;  1HMT A;  2QO6 A;  5L3Y A;  1IJ8 A;  4G76 A;  5B10 O;  4IL6 O;  3LK4 1;  3X00 A;  3SAO A;  3EBK A;  2I5Z O;  4INN A;  3VZU X;  2ZAI A;  4HPC A;  4Y59 A;  1EIO A;  3PED A;  1ZHT A;  1IZN B;  3FEK A;  1IW2 A;  2R89 A;  3EW2 A;  1KT4 A;  3T20 A;  3D4R A;  4YFP A;  2A5B A;  1KQW A;  2Y3E A;  3VG4 A;  1OSP O;  3EC5 A;  2MO5 A;  1STP A;  5JD2 A;  4TKJ A;  3IFB A;  2AL0 X;  5IO6 A;  2ZAG A;  3ZUI A;  2LA7 A;  3WZQ A;  3NQ9 A;  5IRW A;  1BLR A;  1X8U A;  5D45 A;  3VY9 X;  3H3I A;  2OMF A;  1SLG B;  2QO4 A;  1VYF A;  1BSY A;  3UAQ A;  4MVE A;  3A0H O;  4BX7 B;  1WBI A;  3FEN A;  1S7D A;  2Z4H A;  5HTE A;  3F9D A;  4AYN A;  2X9K A;  3VHH A;  2UYW A;  1JQP A;  5HWZ A;  5G26 A;  4NLI A;  4O3X B;  3PQU A;  2OY8 A;  1X71 A;  1N0S A;  4BCS A;  4AKR B;  5H2F O;  5IO5 A;  4N59 A;  4RL9 A;  1SWK A;  4D64 A;  1GX8 A;  3RY2 A;  3RDU A;  4OS0 A;  4Y5D A;  4XMC A;  1AQB A;  2IZJ A;  4RLC A;  3LK2 A;  3IA8 A;  1EI5 A;  4IAB A;  4ZHG A;  1Z24 A;  3KVD D;  4AYD C;  1Y52 X;  1STS B;  2DJG A;  2GH7 A;  1SY3 A;  1JIW I;  1GXA A;  4O49 A;  1Q9G A;  3RBH A;  5IO7 A;  3VG6 A;  3HK1 A;  4CPH B;  3TGC A;  4ZJ0 A;  2JU7 A;  3HWB A;  3PH6 A;  5IXG A;  4O4X A;  5D8J A;  4GGZ A;  1LCW A;  2YMS A;  4BX6 A;  4PUX A;  4U46 A;  4FT6 A;  4OMX A;  1N9M A;  2WR6 A;  3WI5 A;  2BS5 A;  1VWN B;  4C4V B;  2I5V O;  1NP1 A;  1IFB A;  2Z4I A;  2LFU A;  4IAX A;  2NP1 A;  4WBK A;  1KFF A;  4ORR A;  3HOL A;  3K19 A;  2E4J A;  5GTI O;  2AT5 X;  3SLJ A;  1P4T A;  4KCA A;  3WJC A;  2MNH A;  1E54 A;  1ZHW A;  2X8T A;  1B0O A;  1KQX A;  4MIR A;  4FES A;  4FQB B;  3AA1 A;  2N2L A;  1JJX A;  4DQ3 A;  4ZGF A;  2IZA A;  4C4V A;  1E06 A;  1H91 A;  5FAZ A;  3FIQ A;  3NX2 A;  3DA4 A;  5HA0 A;  3KQ0 A;  2QO5 A;  1R0U A;  1DZJ A;  3PQS A;  4NNS A;  1JV4 A;  1SRG A;  1YWD A;  4ODD A;  3F8A A;  3QRC A;  2POA A;  3MX7 A;  5HTD A;  1G90 A;  2FR2 A;  1QJ8 A;  4F4B A;  4U8U O;  1XKI A;  2P8G A;  4IMN A;  3SZH A;  1VWE B;  4QGW A;  2OL7 A;  1VWJ B;  5CE4 A;  4GH7 A;  1YWC A;  2JU8 A;  4KII A;  4RLB A;  1L6M A;  3BRZ A;  5EPQ A;  2IZL B;  3CMP A;  1JYJ A;  2Y2X A;  4ES7 A;  1BWY A;  5HAE A;  2G78 A;  3DWO X;  4MVK A;  1SY2 A;  4JCH A;  3BU9 A;  1I9H A;  2NND A;  2IZE B;  2XE2 A;  4A1Y A;  4IMO A;  3LV4 A;  3S60 A;  1BXW A;  1VWL B;  2W2F A;  4L3R A;  3T24 A;  3HWG A;  5D4A A;  2KD2 A;  3RBY A;  1AVD A;  1LPJ A;  2R4O A;  5DG4 A;  4U8U M;  3BU1 A;  4LSI A;  5FEN A;  8PRN A;  5F2B A;  5EZ2 A;  3RZY A;  2L67 A;  2KXP B;  1NDJ A;  3QKG A;  4LZU A;  5KID A;  1TW4 A;  3CBS A;  3U0D A;  1AEL A;  1U18 A;  4UB8 O;  1VWI B;  1LEL A;  4BX6 B;  2M4L A;  4GRJ A;  4Y0Q A;  1HQP A;  3PP6 A;  3P6G A;  2F1C X;  1I04 A;  2RN4 A;  1ZNK A;  3V8U A;  1G74 A;  2FWV A;  4GU8 A;  2AT8 X;  1BM5 A;  2AT6 X;  4YMY A;  1FJ1 E;  2BLG A;  2ASN X;  2OVS A;  3AKM A;  1U0X A;  1ACD A;  4DQ4 A;  1VWD B;  2Y0H A;  3A2S X;  2RTC B;  4YBU A;  4LKP A;  4CDD A;  3VY8 X;  2YNK A;  4YKO A;  2N93 A;  4JNJ A;  3DZM A;  1LNM A;  2ALL X;  3RE6 A;  1MOY A;  3FR2 A;  2G7B A;  3S5X A;  1ZNH A;  4OKA A;  4FMS A;  1NP4 A;  4I3B A;  5AFU K;  1FEL A;  2IWV A;  3UU2 A;  2RTG B;  5DL5 A;  3TZS A;  1LIC A;  3T2W A;  5HZ6 A;  2WQA E;  4XMH A;  4KRA A;  2XE1 A;  1DFV A;  5HZ8 A;  4IB9 A;  3SYB A;  4D6A A;  2OFR X;  4OS8 A;  4K3B A;  1G5W A;  3VG5 A;  4Y0S A;  4YVB A;  2FR3 A;  2LB6 A;  2GTF X;  1K24 A;  4FZL A;  1TVQ A;  1XCA A;  3AA6 A;  4BOE A;  2R4N A;  4RJX A;  3RWX A;  4HWM A;  4UU2 A;  4AYM C;  5FFH A;  3CKG A;  1EPB A;  4QAE A;  4EEJ A;  3P6C A;  3UEX A;  4ZGU A;  4GDA A;  4FBR A;  1OSM A;  3D97 A;  4HPA A;  2RTE B;  4CV7 A;  2YG2 A;  4D5U A;  4NYR A;  4GK9 A;  3EMM A;  3AA7 B;  3WZP A;  2HZR A;  1SWH A;  3RSW A;  2KDY A;  1VWG B;  2PRN A;  2WJR A;  4PR7 A;  3EW1 A;  1SMP I;  1T0V A;  5FQ7 E;  4ORU A;  4N7C A;  1LIF A;  2DM5 A;  1SWR A;  2OZQ A;  3AAA B;  4KR4 A;  2BS6 A;  1DF3 A;  4U8U N;  2RTB B;  3FID A;  3ZZV A;  2Y0L A;  3U9P C;  2IWW A;  1JYD A;  3WBG A;  1LID A;  2OY1 O;  1NBX A;  1VWF B;  1SWD A;  3L4R A;  4GNY A;  4DNE A;  2X46 A;  1SWJ A;  3HTY A;  2K0L A;  1SWG A;  4UU3 A;  2IFB A;  5B11 O;  4O3Z A;  3B2I A;  3F6Z B;  1EAL A;  2F1T A;  4FRX A;  4QZT A;  4BX5 B;  3WOV A;  3FW5 A;  1Y9T A;  4GNW A;  2Q9S A;  1KL5 A;  2O62 A;  1ORM A;  4Z2P A;  2WEX A;  2Y0K A;  1JMX A;  2EU7 X;  5EED A;  2RTL A;  3NBX X;  3O2Y A;  4L1N A;  4U3Q A;  5DL7 A;  3C5O A;  2IZF B;  1MX7 A;  2ANS A;  2M07 A;  1ZHY A;  1O8V A;  4GD9 A;  4AZP A;  2RTJ A;  2J1N A;  1CBR A;  2HLV A;  5LJG A;  1THQ A;  1SXW A;  2ZFG A;  2IZK A;  1PHO A;  3B2J A;  3BRY A;  2QMI A;  3PK2 A;  1OPB A;  5E79 O;  1KGL A;  3KFG A;  3G7G A;  1DV9 A;  1SRE A;  4IB8 A;  1ZHX A;  4N75 A;  1HXX A;  3GAQ A;  4XMD A;  2X8S A;  5HCE C;  4TQ2 A;  4JO6 A;  3RDQ A;  1VWO B;  2LHF A;  1H6S 1;  2VFB A;  1BH3 A;  2X45 A;  4FGI B;  3TGA A;  1GKA A;  5B27 A;  5HCC C;  1YS5 A;  1OBQ A;  1SLE B;  4BBO A;  3HWD A;  3D95 A;  3AKN A;  3SY7 A;  2A13 A;  5HA1 A;  1BJ7 A;  2W81 C;  5H9K A;  4GDZ A;  2RTM A;  4YKM A;  1X89 A;  4IAW A;  4ALB A;  3QRA A;  5H8T A;  3LHN A;  2HMB A;  1I05 A;  1TOW A;  3FA8 A;  3HWF A;  2FGR A;  3RDM A;  3DTQ A;  1JZU A;  3T0S A;  3I17 A;  2CBS A;  2JU3 A;  4Z27 A;  4BX7 A;  4FSP A;  3WYP A;  3PH5 A;  2K4T A;  3PF1 A;  2BHV A;  1X8O A;  3FEP A;  2WEW A;  1FDQ A;  5FQ6 E;  4UB6 O;  2HYS A;  1YWB A;  1DC9 A;  1B8E A;  2KXP A;  2ODJ A;  2F73 A;  3MBT A;  4IRW A;  4YGH A;  1STR B;  1MK5 A;  5DPQ A;  1DZM A;  3ZW0 A;  1K3B A;  3JQO A;  1PBY A;  3KZI O;  5LJC A;  1OBP A;  2Q2P A;  2A2U A;  2OY7 A;  1BSO A;  1T16 A;  3WU2 O;  1NGL A;  3AAE B;  1OPF A;  5AQ6 A;  2Q4N A;  2F01 A;  4N74 A;  4DCB A;  2MF6 A;  5CHK A;  2JMB A;  4ORX A;  6PRN A;  2IZD B;  2RTH B;  3FA9 A;  3AA0 B;  4CDC A;  4OEM A;  2WPU A;  4M7M A;  3ZW0 B;  4NW4 A;  2L9C A;  2BT9 A;  4KH8 A;  3P6F A;  2RCQ A;  4C69 X;  1SY0 A;  1AVG I;  1VWR B;  3SLT A;  1LDQ A;  2XST A;  5LJH A;  4LQZ A;  5C0N A;  3P6H A;  2R74 A;  3CKF A;  4MEE A;  1GFO A;  1BRP A;  3WJG A;  1RXJ A;  5H9A A;  3JCU O;  1KOI A;  2Q39 A;  1HY2 A;  3VGW A;  1YUP A;  4CPI A;  3DSZ A;  3KFI A;  5F1E A;  4A8Z A;  3C77 X;  1D2U A;  5F7G A;  5B5F A;  1SLF B;  4B55 A;  1SWU A;  5F6Z A;  1ZRY A;  4K19 A;  2RTK A;  2HZQ A;  4JHQ A;  2A5C A;  3CQN A;  4C5P A;  1ALB A;  2R8A A;  2WUT A;  1WUB A;  1W4T A;  3HPE A;  5EDB A;  3D96 A;  3VE2 A;  4XNK A;  3SY9 A;  3FR5 A;  4Y0P A;  4QYP A;  3FA7 A;  4YBP A;  2OFA A;  3UPG A;  3FLL A;  3BX7 A;  1KT6 A;  2RTA A;  1P6P A;  3BRN A;  3E3C A;  2K62 A;  4QGV A;  2RTI B;  3BS0 A;  1OEJ A;  4RUN A;  2LFO A;  1DF8 A;  4QGX A;  2IZB A;  1IIU A;  1OBU A;  2KTS A;  4YCE A;  2X8F A;  3BX8 A;  4ZR2 A;  1AVE A;  1KT7 A;  5G3A A;  2GJ5 A;  1IZN A;  3LTW A;  3O22 A;  2KC0 A;  1BT9 A;  5AFU L;  1QAB E;  2RTD B;  4C00 A;  2HNX A;  3NJT A;  3HOE A;  4FZM A;  4Z28 A;  3NR3 A;  3U03 A;  3P02 A;  3AAA A;  4NLJ A;  4Y0R A;  3WVM A;  1PEE A;  4N7D A;  2JGS A;  3WI4 A;  1NQN A;  1ZNE A;  3FEL A;  3BDR A;  4BX5 A;  3WXQ A;  5JR8 A;  1YP7 A;  3S5V A;  2WQ9 A;  1RBP A;  1X8N A;  3ELX A;  4ORY A;  1FTP A;  2R4L A;  4GCP A;  2LKK A;  2AT3 X;  3VZW X;  2RA6 A;  2VFC A;  2AT0 X;  1FE3 A;  4GJV A;  4QYN A;  1QG5 A;  2ERV A;  1Y55 X;  4ZH9 A;  4I3D A;  3P6E A;  2QOM A;  5IRA A;  4AKR A;  3FW4 A;  4LKT A;  1MVG A;  3B2L A;  1E5P A;  1MPF A;  2W2A A;  2FGQ X;  1RSU B;  4FOZ A;  1LCV A;  3ZWE A;  3VG3 A;  1CRB A;  2C4I A;  2AMM X;  3HW9 A;  2FRS A;  4ORW A;  3I0A A;  3SZV A;  4AZO A;  2IZI A;  1D3S A;  2PY1 A;  1MUP A;  1VWH B;  4EXZ A;  3WJD A;  1TXL A;  1U17 A;  3SYS A;  4JFB A;  5B3M O;  3VHM A;  4KC8 A;  4ZFX A;  4YGG A;  3ZW1 B;  2RTP B;  5T5F A;  1LDO A;  2QOS C;  1QWD A;  2BSZ A;  2OVE A;  3Q6L A;  3POQ A;  4TJZ A;  1ZNG A;  5BYP A;  5GTH O;  2X27 X;  2ACO A;  1SWC A;  1CBI A;  2GE4 A;  5LJD A;  1SXU A;  4A1H A;  2FLJ A;  4WFV A;  1HXT A;  2CM4 A;  5CSE A;  2XMX A;  4NYQ A;  1A18 A;  3KVN A;  4CTD A;  2AXT O;  4NP1 A;  4IBA A;  2FKJ A;  1KXO A;  3RKG A;  5LJK A;  1N4J A;  1SWO A;  5HCD C;  3NPO A;  2X56 A;  5H9N A;  2AVI A;  1HBP A;  3VE1 A;  1JJJ A;  2OL8 O;  3O0E A;  3POX A;  2FT9 A;  2RTF B;  1G85 A;  4QZU A;  1B4M A;  1G7N A;  2ZSC A;  2CZU A;  5HBS A;  1GGL A;  3T6F A;  1W5R A;  3LK3 A;  2G8C O;  2L5P A;  1VWK B;  5EDC A;  1GT4 A;  4AZM A;  1SWF A;  1JJU A;  2MM3 A;  2OVD A;  1SY1 A;  3WJE A;  3D9W A;  3FA6 A;  1YP6 A;  4AZQ A;  3CBC A;  4R0B A;  1Y53 X;  4G75 A;  3VG2 A;  1AB0 A;  2KT4 B;  2OVA A;  1N43 A;  5AEO A;  2MHL A;  3RY1 A;  4GE1 A;  3QQ2 A;  5BVQ A;  2C1S A;  4TKB A;  2KZ7 A;  4NNT A;  2LBV A;  3AA1 B;  4GHB A;  3SZI A;  4GCQ A;  3VZT X;  2X32 A;  4OEL A;  1JBH A;  1ERB A;  2FHN X;  4FQE A;  1GX9 A;  3OE3 A;  1EW3 A;  5B29 A;  2CAM A;  3T6L A;  5LKF A;  2CZT A;  1VWM B;  2FHL A;  4PJ0 O;  4YFQ A;  2YPV A;  4GCS A;  3FR4 A;  2KW1 A;  4AYH A;  3DA3 A;  1GM6 A;  2MHD A;  3RDS A;  4CDE A;  3N91 A;  3UEW A;  2O4V A;  3EBW A;  5G39 A;  2JW1 A;  1LUQ A;  3APV A;  1MM4 A;  1MM9 A;  2M06 A;  2RTO B;  4A60 A;  1N7Y A;  3UEU A;  2L68 A;  1OPA A;  1SRH A;  1ICN A;  1ZHZ A;  4YGZ A;  4Z3T A;  3GP6 A;  3APW A;  3RE5 A;  1SA8 A;  2F09 A;  3EM0 A;  1SWS A;  4IB6 A;  3VG7 A;  4M6S A;  3MG5 A;  3WJF A;  2FS7 A;  2OF9 A;  2RQ0 A;  4Z2V A;  2HKD A;  5KAI O;  3POR A;  4CSB A;  1SWE A;  1QQS A;  1T68 X;  4ON1 A;  3SZJ A;  4I95 A;  4I60 A;  1HBQ A;  4AFK A;  1FEM A;  4Z2O A;  1HXU A;  1RXK A;  1VWB B;  1FEN A;  5AJB A;  1PRN A;  3BLG A;  1PBO A;  1QY0 A;  4PSQ A;  1ZND A;  3LK3 B;  3T2X A;  1SRF A;  4XNL A;  2FGS A;  3KFH A;  1ML7 A;  3PRN A;  1QFV A;  4O4O A;  1I06 A;  3TF6 A;  3TGB A;  5DL6 A;  4GUZ A;  5HZQ A;  2WJQ A;  3AA6 B;  3JSQ A;  4GKC A;  5K06 A;  4HFO A;  4O9S A;  1Y0G A;  4O3W A;  4KR8 A;  3SZD A;  1O1V A;  4OMW A;  1GX3 A;  4YH0 A;  3KZA A;  4LSH A;  2X55 A;  1URE A;  4QRL A;  5G38 A;  1EPA A;  5B66 O;  3TZG A;  4CPF A;  3LK4 2;  1NC9 A;  1SWQ A;  3UEV A;  2AF5 A;  3C78 X;  4GET A;  2R56 A;  2CM9 A;  1VWC B;  4TKH A;  2XTQ A;  4WFU A;  2FTB A;  4D6B A;  3AUM O;  2XE3 A;  3LK2 B;  1HQQ A;  5KHP A;  4FUV A;  2BC3 A;  2OFB A;  1GFM A;  1SRI A;  1I4U A;  3NAD A;  3STM X;  4E1S A;  2IZG B;  1PMP A;  3MM0 A;  4HPB A;  2JQY A;  3CQR A;  1MX8 A;  1VYG A;  1T8V A;  1OEE A;  2CBR A;  1HMS A;  4QQ1 A;  4FSO A;  1BRQ A;  4ID2 A;  1SWN A;  1EII A;  1KZX A;  1SWL A;  3BS2 A;  4WHI A;  3O19 A;  4BJ8 A;  4BUM X;  2RTQ B;  1EUO A;  4EQA C;  2X34 A;  4MIS A;  4ALO A;  1BSQ A;  3CR6 A;  1LIB A;  4GJS A;  5B5G A;  3GE2 A;  2XKL A;  5EE2 A;  4IB7 A;  4I9R A;  1YIV A;  5KAF O;  2Y3F A;  4ORS A;  4TNN A;  4TLJ A;  1E02 A;  1KT3 A;  1W6F A;  4XMG A;  2QCB A;  1SWP A;  1RXH A;  2OY5 O;  1GT1 A;  5LJE A;  3JS1 A;  1QY2 A;  3B2K A;  2G5L A;  4ARH A;  2F1V A;  1LIE A;  4BVM A;  3NQK A;  5JDP A;  1Q9F A; 
#chains in the Genus database with same CATH homology
 5H9L A;  3ZWE A;  3FEN A;  3EYC A;  1S7D A;  3HTY A;  3VG3 A;  5HZ9 A;  2K0L A;  1CRB A;  2ZLD A;  5FVN A;  2A3F X;  4O4S A;  2AMM X;  3EMN X;  4UU3 A;  2MWH A;  3HW9 A;  2Z4H A;  2FRS A;  5HTE A;  3F9D A;  5L8I A;  5ADX L;  4ORW A;  3I0A A;  3SZV A;  2IFB A;  4AZO A;  4AYN A;  4O3Z A;  3B2I A;  3F6Z B;  1EAL A;  2F1T A;  2W80 C;  1D3S A;  2PY1 A;  1MUP A;  4QZT A;  5HWZ A;  4FRX A;  3WOV A;  5G26 A;  2FS6 A;  4NLI A;  4EXZ A;  3WJD A;  1TXL A;  1Y9T A;  3FW5 A;  1U17 A;  2Q9S A;  4GNW A;  4YDB A;  1Y9L A;  4O3X B;  4JFB A;  2O62 A;  3SYS A;  3PQU A;  1ORM A;  1X71 A;  1N0S A;  4AKR B;  4GF4 A;  2WEX A;  5IO5 A;  4KC8 A;  4N59 A;  4RL9 A;  4AZN A;  2Y0K A;  2EU7 X;  4ZFX A;  4D64 A;  3WJB A;  5EED A;  1GX8 A;  4YGG A;  4ZHF A;  3ZW1 B;  3VU1 A;  3NBX X;  3O2Y A;  2A2G A;  4L1N A;  4U3Q A;  5DL7 A;  4AUI A;  4OS0 A;  3C5O A;  5T5F A;  1PM1 X;  3ELZ A;  1AQB A;  1SXY A;  2QOS C;  3OJY C;  4FBV A;  4XMC A;  1MX7 A;  1QWD A;  4RLC A;  3AA7 A;  1HN2 A;  2LBA A;  2ANS A;  3IA8 A;  2M07 A;  2OVE A;  1ZHY A;  3Q6L A;  3LK2 A;  3POQ A;  4ZHH A;  1O8V A;  1EI5 A;  4IAB A;  3STK A;  4ZHG A;  4AZP A;  4TJZ A;  2KTD A;  1Z24 A;  1ZNG A;  2J1N A;  5BYP A;  3KVD D;  1CBR A;  2HLV A;  5LJG A;  2X27 X;  4AYD C;  2ACO A;  1THQ A;  1SXW A;  1CBI A;  4E1T A;  1X8Q A;  5CYB A;  2GE4 A;  2ZFG A;  5IYU A;  5LJD A;  1SXU A;  1JIW I;  1GKA B;  1SY3 A;  4A1H A;  1GXA A;  4O49 A;  2FLJ A;  1Q9G A;  3RBH A;  4WFV A;  5IO7 A;  3VG6 A;  3HK1 A;  1HXT A;  1PHO A;  2RCT A;  3NX1 A;  3B2J A;  4O3Y A;  2CM4 A;  4ZJ0 A;  2JU7 A;  2QMI A;  3TGC A;  3HWB A;  1OPB A;  1KGL A;  1QY1 A;  3PH6 A;  2XMX A;  3KFG A;  3G7G A;  3STN A;  1DV9 A;  7PRN A;  1EXS A;  4NYQ A;  4O4X A;  1A18 A;  5D8J A;  4IB8 A;  2WWP A;  4AZR A;  5PRN A;  2XG6 A;  2K23 A;  1SXX A;  2YMS A;  1ZHX A;  3P24 A;  4NP1 A;  1GFQ A;  4PUX A;  4IBA A;  4FT6 A;  5ADX K;  1KXO A;  4OMX A;  3RKG A;  1HXX A;  1ADL A;  3GAQ A;  4XMD A;  2X8S A;  5HCE C;  5LJK A;  3K3L A;  4TQ2 A;  3HWE A;  2WR6 A;  3WI5 A;  5HCD C;  2LHF A;  2BS5 A;  2G79 A;  3NPO A;  1H6S 1;  5H9N A;  1BH3 A;  4U9C A;  1HBP A;  4ZH6 A;  2X45 A;  3VE1 A;  1JJJ A;  3T1D A;  3AAE A;  3O0E A;  3POX A;  1NP1 A;  1IFB A;  3G7X A;  4FGI B;  3OD9 A;  2Z4I A;  2FT9 A;  1G85 A;  4QZU A;  2LFU A;  1ERX A;  4PJ2 A;  4IAX A;  3TGA A;  1X8P A;  1B4M A;  2NP1 A;  3OBL A;  1G7N A;  4WBK A;  4ORR A;  1GKA A;  3HOL A;  5B27 A;  5HCC C;  5LKE A;  3K19 A;  1YS5 A;  2CZU A;  5HBS A;  1OBQ A;  4AW8 A;  1GGL A;  3AA0 A;  2E4J A;  3HWD A;  2AT5 X;  3D95 A;  1P4T A;  4I6S A;  4I9S A;  3LK3 A;  1ICM A;  5AJC A;  3AKN A;  2KZ7 B;  4KCA A;  3WJC A;  4AYE C;  3SY7 A;  2A13 A;  2MNH A;  5HA1 A;  1E54 A;  2L5P A;  5EDC A;  1BJ7 A;  2X8T A;  1ZHW A;  2W81 C;  1B0O A;  1GT4 A;  1KQX A;  5H9K A;  4AZM A;  4EFG A;  5HZ5 A;  4MIR A;  4GDZ A;  4O4U A;  4FES A;  4FQB B;  4YKM A;  1MDC A;  1QJP A;  1X89 A;  1IFC A;  3AA1 A;  4HPD A;  2MM3 A;  2N2L A;  1JJX A;  2QTK A;  4IAW A;  4DQ3 A;  2OVD A;  4ALB A;  3QRA A;  5H8T A;  1SY1 A;  3BY0 A;  3LHN A;  4ZGF A;  5DL8 A;  2HMB A;  1E06 A;  1H91 A;  1I05 A;  1S44 A;  1TOW A;  3FA8 A;  3HWF A;  5FAZ A;  2FGR A;  3FIQ A;  1TOU A;  3CWK A;  4ML7 B;  3NX2 A;  3WJE A;  3DTQ A;  3POU A;  3DA4 A;  2Y7S A;  1JZU A;  3T0S A;  3C76 X;  3I17 A;  2CBS A;  1YP6 A;  2JU3 A;  3FA6 A;  3KQ0 A;  5HA0 A;  4AZQ A;  2QO5 A;  4FSP A;  3CBC A;  4R0B A;  4B61 A;  1R0U A;  3JTY A;  4G75 A;  3VG2 A;  2MJI A;  3PH5 A;  1AB0 A;  2KT4 B;  2K4T A;  1DZJ A;  2BHV A;  3PQS A;  1X8O A;  4NNS A;  3KFF A;  3FEP A;  2OVA A;  1JV4 A;  2WEW A;  5AEO A;  1FDQ A;  1YWD A;  2MHL A;  5FQ6 E;  4YFR A;  5D5D A;  4ODD A;  3F8A A;  2HYS A;  1YWB A;  3QRC A;  4GE1 A;  1IKE A;  2POA A;  1KZW A;  2GTL O;  1GT3 A;  1DC9 A;  1B8E A;  2KXP A;  2ODJ A;  1O1U A;  2F73 A;  3MBT A;  5BVQ A;  3MX7 A;  2RD7 C;  4KT5 A;  1YWA A;  4TKB A;  1KT5 A;  2KZ7 A;  4YGH A;  4NNT A;  2LBV A;  3AA1 B;  4GHB A;  5DPQ A;  5HTD A;  1DZM A;  1G90 A;  1B56 A;  1RLB E;  2FR2 A;  3ZW1 A;  3ZW0 A;  1QJ8 A;  2JMM A;  4ZCB A;  4GCQ A;  4U8U O;  1XKI A;  2P8G A;  4IMN A;  4F4B A;  3VZT X;  1JBH A;  3JQO A;  1MM5 A;  3NQ3 A;  4QGW A;  2NNE A;  5LJC A;  1ERB A;  5CE4 A;  1OBP A;  2Q2P A;  1GX9 A;  5D47 A;  2A2U A;  2AKQ A;  3OE3 A;  4GH7 A;  1DZK A;  1BSO A;  1YWC A;  5GV0 A;  2JU8 A;  1EW3 A;  2GC9 A;  1NGL A;  5B29 A;  3AAE B;  4KII A;  1OPF A;  1L6M A;  4RLB A;  5AQ6 A;  5EPQ A;  1EQD A;  4MVL A;  4XMF A;  2XTR A;  2R73 A;  5LKF A;  2CZT A;  2Q4N A;  4COT A;  3CMP A;  1JYJ A;  2Y2X A;  3ZI8 A;  4FRT A;  2OFM X;  4ES7 A;  1BWY A;  4YFQ A;  2XE5 A;  5HAE A;  2JMB A;  4ORX A;  2G78 A;  2YPV A;  6PRN A;  4MVK A;  4GCS A;  3FA9 A;  3FR4 A;  3AA0 B;  2KW1 A;  4AYH A;  1SY2 A;  4JCH A;  3DA3 A;  1GM6 A;  2MHD A;  3BU9 A;  4AYI D;  3NP1 A;  4LSF A;  2NND A;  3N91 A;  4M7M A;  5F58 A;  3UEW A;  4LSE A;  3ZW0 B;  2XE2 A;  4NW4 A;  1LKE A;  2O4V A;  2L9C A;  4FZN A;  4A1Y A;  2BT9 A;  3EBW A;  3LV4 A;  4IMO A;  4GZV A;  5F6B A;  4KH8 A;  3S60 A;  4RJW A;  2JW1 A;  1BXW A;  3P6F A;  2RCQ A;  4C69 X;  1E00 A;  1SY0 A;  3APV A;  1AVG I;  2JOZ A;  1MM4 A;  2W2F A;  4L3R A;  3ZQ3 A;  1CBS A;  1A57 A;  2M06 A;  4A60 A;  2POR A;  3T24 A;  2XST A;  1GT5 A;  2L68 A;  3HWG A;  5D4A A;  1OPA A;  2KD2 A;  2AH7 X;  3UEU A;  4LQZ A;  5LJH A;  3RBY A;  5C0N A;  3P6H A;  1IKJ A;  2R74 A;  1ICN A;  1LPJ A;  1ZHZ A;  5DG4 A;  4YGZ A;  3FMZ A;  3PEC A;  4U8U M;  3BU1 A;  4LSI A;  4Z3T A;  5FEN A;  1GFO A;  1BRP A;  3WJG A;  8PRN A;  3GP6 A;  5D48 A;  5EZ2 A;  3RZY A;  2L67 A;  3APW A;  5H9A A;  2KXP B;  3FYX A;  5L8O A;  1KOI A;  1ZNL A;  3QKG A;  2Q39 A;  4LZU A;  1SA8 A;  2F09 A;  1TW4 A;  3CBS A;  3EM0 A;  5KID A;  1YUP A;  4IB6 A;  3U0D A;  1AEL A;  3DSZ A;  2ACP X;  3VG7 A;  4M6S A;  1U18 A;  3KFI A;  5F1E A;  3WJF A;  2FS7 A;  4A8Z A;  3C77 X;  4D65 A;  2M4L A;  5LJB A;  1D2U A;  4GRJ A;  5F7G A;  4Y0Q A;  1HQP A;  3PP6 A;  4YCH A;  2RQ0 A;  3P6G A;  1I04 A;  2RN4 A;  5F6Z A;  1ZRY A;  4K19 A;  4OS3 A;  2HZQ A;  3POR A;  1ZNK A;  4CSB A;  3V8U A;  2NNQ A;  3FYF A;  1G74 A;  2FWV A;  4GU8 A;  3CQN A;  5BVT A;  2AT8 X;  1BM5 A;  1QQS A;  1ALB A;  4JGL A;  2AT6 X;  1T68 X;  4ON1 A;  2WUT A;  2GTL M;  4I95 A;  5L8N A;  4BQU A;  4YMY A;  2J4U P;  1HBQ A;  1LFO A;  2BLG A;  2ASN X;  1QJ9 A;  2OVS A;  4AFK A;  1FEM A;  5EDB A;  3AKM A;  1HXU A;  1U0X A;  1ACD A;  3D96 A;  4DQ4 A;  3VE2 A;  2Q2M A;  1FEN A;  5AJB A;  1PRN A;  3BLG A;  2Y0H A;  4XNK A;  1PBO A;  2JN3 A;  3SY9 A;  1QY0 A;  1VPR A;  3APU A;  3FR5 A;  4QYP A;  4PSQ A;  3FA7 A;  4Y0P A;  4ZHD A;  1ZND A;  4FBO A;  3ZUO A;  3A2S X;  1CJ5 A;  1QFT A;  3LK3 B;  4YBU A;  4LKP A;  4XNL A;  3S26 A;  4YBP A;  3UPG A;  3FLL A;  1ML7 A;  3BX7 A;  3KFH A;  3PRN A;  1QFV A;  3VY8 X;  1KT6 A;  4AZL A;  3VPJ E;  1P6P A;  2WSJ A;  2YNK A;  3BRN A;  3E3C A;  2K62 A;  2N93 A;  4O4O A;  1I06 A;  1UZ2 X;  4YKO A;  3TF6 A;  4QGV A;  3TGB A;  2N2M A;  1LNM A;  2ALL X;  5HZQ A;  5DL6 A;  1S2P A;  3FR2 A;  4XME A;  2G7B A;  3AA6 B;  3S5X A;  2W2B A;  1ZNH A;  3PPT A;  3JSQ A;  4GKC A;  5K06 A;  4HFO A;  1LF7 A;  3SOT A;  3MVF A;  1GFP A;  4FMS A;  4O9S A;  1OEJ A;  4RUN A;  4O3W A;  4ZHC A;  4KR8 A;  1A3Y A;  1NP4 A;  2LFO A;  1FEL A;  4I3B A;  1O1V A;  4OMW A;  3NSG A;  3SZD A;  5AFU K;  4QGX A;  3UU2 A;  5DL5 A;  3TZS A;  2A0A A;  1LIC A;  4RUU A;  4YH0 A;  3KZA A;  4LSH A;  1URE A;  4QRL A;  2WQA E;  5HZ6 A;  4CK4 A;  1EPA A;  4MVI A;  4XMH A;  3P6D A;  3TZG A;  1IIU A;  3LK4 2;  4I3C A;  1OBU A;  4KC7 A;  2XE1 A;  4KRA A;  2KTS A;  4YCE A;  2X8F A;  1DFV A;  1OEK A;  3UEV A;  1CBQ A;  5FQ8 E;  5HZ8 A;  3BX8 A;  4IB9 A;  3SYB A;  4D6A A;  2OFR X;  3C78 X;  4OS8 A;  4GET A;  4EDE A;  1BBP A;  2R56 A;  2CM9 A;  3APX A;  5KIC A;  1G5W A;  4TKH A;  4ZR2 A;  3VG5 A;  2XTQ A;  4N58 A;  1KT7 A;  3BSZ E;  5EEE A;  4WFU A;  1A2D A;  2FTB A;  4Y0S A;  4AKM A;  1HMR A;  5BVS A;  2GJ5 A;  4D6B A;  1IZN A;  2FR3 A;  2XE3 A;  3LK2 B;  2LB6 A;  3O22 A;  2GTF X;  4FZL A;  1TVQ A;  1XCA A;  2KC0 A;  1BT9 A;  3AA6 A;  1BEB A;  3B2H A;  4QNI A;  4YDA A;  4BOE A;  3ZW2 A;  5KHP A;  1GFN A;  5AFU L;  4RJX A;  3RWX A;  4FUV A;  1QAB E;  2QM9 A;  4HWM A;  2GTL N;  4UU2 A;  2HNX A;  1DZP A;  4AYM C;  3HOE A;  4FZM A;  4LZV A;  1GFM A;  3U03 A;  3NR3 A;  3P02 A;  3AAA A;  1HMT A;  2QO6 A;  5FFH A;  1I4U A;  1EPB A;  4G76 A;  3NAD A;  4NLJ A;  4Y0R A;  4QAE A;  4EEJ A;  3P6C A;  3UEX A;  3STM X;  3WVM A;  4E1S A;  1PEE A;  4ZGU A;  1PMP A;  4HPB A;  4FBR A;  4N7D A;  1OSM A;  3CQR A;  3D97 A;  4HPA A;  3LK4 1;  1MX8 A;  1VYG A;  3WI4 A;  3SAO A;  3EBK A;  1T8V A;  1ZNE A;  1OEE A;  3FEL A;  4INN A;  3VZU X;  2ZAI A;  4CV7 A;  2CBR A;  1HMS A;  3BDR A;  2YG2 A;  4HPC A;  4QQ1 A;  3WXQ A;  4FSO A;  4D5U A;  4NYR A;  4GK9 A;  5JR8 A;  1YP7 A;  1BRQ A;  3S5V A;  3EMM A;  1EIO A;  3AA7 B;  2WQ9 A;  1RBP A;  3PED A;  4ID2 A;  1X8N A;  1IZN B;  3ELX A;  2HZR A;  1ZHT A;  3RSW A;  1EII A;  1KZX A;  3FEK A;  1IW2 A;  1FTP A;  3BS2 A;  4ORY A;  1KT4 A;  4WHI A;  4GCP A;  2LKK A;  2KDY A;  3T20 A;  3D4R A;  3O19 A;  2AT3 X;  3VZW X;  2PRN A;  4BUM X;  4YFP A;  2RA6 A;  2AT0 X;  1EUO A;  1FE3 A;  4EQA C;  1KQW A;  4MIS A;  4QYN A;  3VG4 A;  1QG5 A;  4ALO A;  1BSQ A;  3CR6 A;  1LIB A;  1SMP I;  1T0V A;  5FQ7 E;  3GE2 A;  2MO5 A;  2XKL A;  2ERV A;  5EE2 A;  4ORU A;  4N7C A;  1LIF A;  4IB7 A;  2DM5 A;  4I9R A;  4TKJ A;  1YIV A;  3IFB A;  4ZH9 A;  2OZQ A;  4I3D A;  3P6E A;  3AAA B;  2AL0 X;  4ORS A;  5IO6 A;  2ZAG A;  3ZUI A;  4KR4 A;  2BS6 A;  1DF3 A;  4U8U N;  4TNN A;  4TLJ A;  4AKR A;  1E02 A;  2LA7 A;  3NQ9 A;  1KT3 A;  3FW4 A;  4LKT A;  3ZZV A;  4XMG A;  2Y0L A;  1MVG A;  1BLR A;  3U9P C;  3B2L A;  1E5P A;  1JYD A;  3WBG A;  1X8U A;  5D45 A;  1MPF A;  3VY9 X;  1GT1 A;  1LID A;  2W2A A;  3H3I A;  2OMF A;  5LJE A;  2FGQ X;  3JS1 A;  2QO4 A;  1QY2 A;  1VYF A;  3B2K A;  4ARH A;  1BSY A;  3L4R A;  1LIE A;  4BVM A;  2F1V A;  4FOZ A;  4GNY A;  3NQK A;  5JDP A;  3UAQ A;  1Q9F A;  4MVE A;  2X46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...