4O4XA

Crystal structure of the vaccine antigen transferrin binding protein b (tbpb) double mutant tyr-167-ala and trp-176-ala from haemophilus parasuis hp5
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
513
structure length
503
Chain Sequence
b'EYKDVETDKKVKEQLGELMEPALGYVVKVPVSQSGVKRTEISNPEAITDEDLNKIPNYEIIKGVAYPNYGELVDKTAAETMKYVRSGYVIDVYHSGTRDKGYVFYKGITPSKELPQGPALTYQGEWDFTSDANLNNEEGRPTALNDDYYTTAIGKRAGLVSGDAKPSKHKYTSQFKVDFATKKMTGKLSDKEKTIYTVNADIRGNRFTGSATASDKDKGKGASYNFFSVDSQSLEGGFYGPKAEEMAGKFVADDKSLFAVFSAKHNASNVNTVRIIDASKIDLTNFSISELTNFGDASVLIIDGKKMELAGSEFTNKHTIDINGKKMVAVACCSNLEYMKFGQLWQQTEKQVKDNSLFLQGERTATDKMPKDGNYKYIGTWDAQVSKENNYWVATADDDRKAGYRTEFDVDFGSKNLSGKLFDKNGVNPVFTVNAKIDGNGFTGEAKTSDAGFVLNVKFSDVAVSGGFYGPTAAELGGQFRYQSDNGSVGVGAVFGAKQQVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TbpB
publication title Nonbinding site-directed mutants of transferrin binding protein B exhibit enhanced immunogenicity and protective capabilities.
pubmed doi rcsb
source organism Haemophilus parasuis
molecule tags Metal transport
total genus 112
structure length 503
sequence length 513
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
A PF17483 TbpB_C C-lobe handle domain of Tf-binding protein B
A PF17484 TbpB_A N-Lobe handle Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.240 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA03
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4o4xA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA04
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4o4xA02
4O49A 4O3XB 4O3YA 2W80C 4U9CA 5EE2A 2KC0A 2YPVA 4O4XA 2W81C 3UAQA 5T5FA 4O4UA 3KVDD 3PQSA 2Y7SA 4O3ZA 4QQ1A 3V8UA 3HOLA 3VE2A 4AYNA 4AYDC 1YS5A 3HOEA 4O3WA 3VE1A 3PQUA 4AYMC 2LFUA 4AYEC 4Z3TA 2KDYA 4AYID
chains in the Genus database with same CATH superfamily
2G8CO 2FWVA 5EDBA 1TVQA 3P6EA 5ADXL 4O9SA 3P02A 1E00A 2FHNX 1SXUA 2JMMA 4JO6A 1EUOA 3STNA 4COTA 3WI4A 3F9DA 4LZVA 1SY3A 4CPHB 4ORYA 4MVEA 1JBHA 2AMMX 5DL7A 5LJDA 2BLGA 1BLRA 5H9NA 3Q6LA 2R88A 1SRGA 1GXAA 4OKAA 1YIVA 4OS8A 3WBGA 3FLLA 4HPAA 4LZUA 2L5PA 2DM5A 2GTFX 2GC9A 5L3YA 1QJPA 4I9RA 2GJ5A 3S26A 5FVNA 4TLJA 3BS2A 3BX8A 2HMBA 4BX7B 5JDPA 1LCWA 4Z2OA 1TOUA 3KQ0A 1I4UA 1RXHA 3ZW2A 1ZRYA 3PH6A 3UEUA 2AT3X 3N91A 5IO7A 2XG6A 3D95A 1RSTB 4NV7A 2YMSA 3WYQA 2Y32A 4K19A 1KXOA 2A0AA 3JSQA 2R8AA 1HXXA 3PP6A 1ACDA 4AZQA 3LTWA 1ML7A 2G79A 2HNXA 1MEPA 2RTLA 1GFNA 5IXGA 3L4RA 4HPCA 2BSZA 3O2YA 2W80C 3WZOA 3GP6A 1SY0A 2XSTA 1BSOA 5GTIO 1MK5A 1CBSA 1FJ1E 4AKRA 2JU3A 4YFQA 4CDDA 2O4VA 1DZKA 1XKIA 4FSOA 1G5WA 3STKA 2MWHA 1EIIA 3WOVA 3AAEB 3AKNA 1LF7A 3AA1B 2K62A 3UEWA 3F6ZB 1BEBA 5EDCA 3DA3A 4GETA 2K4TA 4GF4A 3WI5A 1SWFA 4XMCA 2LB6A 3VHIA 4NNTA 4Z6JA 1HQQA 1X8PA 1HMSA 2ZAGA 1X89A 3VG7A 3QQ2A 3D96A 5IRUA 2CZUA 3BRNA 3FENA 4JNJA 4NLIA 2RTEB 1HBQA 5DL8A 1MUPA 3D9WA 2WVPA 3IA8A 4I9SA 5TISO 4DCBA 2NP1A 3NX2A 5D47A 1ZHXA 2OY5O 2OY8A 1I78A 3AA0A 3SYSA 5IRWA 2OFRX 1IFBA 2C1QA 3T2XA 2WJRA 4KCAA 5IO5A 4MVLA 5HWZA 5BVSA 2A2GA 2AT6X 5B66O 1I05A 1GX9A 1SY1A 2R56A 3VPJE 1X8OA 3P6HA 1GKAA 2HZRA 2OMFA 4JGLA 3B2JA 4ZGFA 4Z27A 1BSQA 4ZHHA 1SWHA 5IO6A 4CV7A 4UB8O 4LSHA 1JJJA 2NNQA 1NP4A 3AAAA 2RTCB 5LJCA 4GCSA 5HCDC 3NSGA 3DA4A 5HTEA 2N93A 4BUMX 3PORA 1OBQA 2AF5A 3SOTA 3FYXA 4K3BA 2FKJA 4D6AA 1VPRA 3PRNA 4FBRA 2ZSCA 2FGRA 2RTPB 1S2PA 4B61A 4D6BA 4XNLA 2WPUA 5KHPA 1B0OA 4ZH6A 2LKKA 2XE3A 3BU9A 4ZGUA 3CQRA 2IWVA 2IZCB 2R4OA 3DWNA 4FGIB 5BVTA 4GGRA 1ICMA 1GT5A 2KT4B 2XTRA 3VGWA 1GM6A 4F4BA 4ID2A 5FQ6E 3VZWX 5CYBA 3EBWA 2KZ7B 2LFUA 4LSIA 1N9YA 4UB6O 5HZ8A 1BH3A 2WQAE 4FUVA 2KTDA 5B5EO 3B2LA 3EW1A 1S44A 2JOZA 4O3ZA 2Q4NA 2K23A 5F6ZA 1HN2A 4OELA 3P24A 3AKMA 4EDEA 4EEJA 4R0BA 2AXTO 4YKOA 3POXA 4GZVA 3KZAA 4CPEA 2OVEA 1O8VA 5HAEA 2ALLX 1XCAA 5D5DA 4O4XA 2C4IA 1X8UA 3LK3A 3OD9A 3VHMA 1EALA 3JTYA 4BX6B 4D5UA 3A0BO 4FZNA 1SWNA 5BVQA 2Q39A 3APXA 1EW3A 3PPTA 2POAA 4JCHA 4BX5A 2M4LA 1PRNA 1FDQA 4NYQA 1JMZA 3KVDD 2QMIA 2ACOA 2Y2XA 2JGSA 4N59A 1IKEA 3JQOA 2XTQA 1KOIA 2C1SA 4FSPA 1Q9GA 1MM5A 2P8GA 1VWNB 2XMXA 1VYOA 1VWRB 2RQ0A 3WJEA 5T5FA 5K68A 3FELA 1HY2A 3APVA 2R74A 1LNMA 4GDZA 3RDMA 1VWMB 2FGSA 3FYFA 4TKBA 8PRNA 3LHNA 1FE3A 5AJBA 3P6DA 3FEKA 1MM9A 3AUMO 3PDFA 1Z24A 2KTSA 3SZIA 4B55A 1HBPA 7PRNA 1YP7A 2Y0HA 1KFFA 3T1DA 3BX7A 4AYNA 5LKFA 4EKVA 5IYUA 1ZNKA 1ORMA 5G3AA 2GTLO 3MM0A 4L3RA 3CQNA 3BRZA 4O4OA 4RUNA 5D4AA 3T24A 5L8NA 4O4SA 2ACPX 4C4VB 2CZTA 3EYCA 2RTGB 3OJYC 1ZHTA 2XE2A 4C00A 3PQUA 1IKJA 4Y0QA 5B27A 1VWOB 2CM9A 1P4TA 3WJDA 3RDSA 4ZHFA 4G76A 1MVGA 3POQA 4BQUA 1SXYA 5B11O 4PJ0O 2JMBA 3SY7A 1PBOA 4O49A 4BJ8A 2WEXA 2HZQA 3RY1A 3S5XA 4GGZA 2Z4HA 5B2AO 1EXSA 4GE1A 3EW2A 4QQ1A 4N7CA 4KRAA 4K3CA 2F1VA 3EC5A 3C77X 4CPHA 5EEEA 1SWBA 4A8ZA 1UYNX 3TGBA 5K06A 1OEKA 3KFHA 2ASNX 1T0VA 3DTQA 4O3YA 1OPAA 5DL5A 4HWMA 3WYPA 1VWQB 2OL6O 5G26A 4WFVA 1EI5A 3NPOA 2ZAIA 4EXZA 1SLDB 4AYHA 5HCCC 1SRJA 2ZFGA 3CKGA 1D2UA 1YWDA 2X55A 1VWLB 3AA7B 2BHVA 3UEXA 4I3DA 3GE2A 4BX7A 1EPAA 5L8OA 3RDUA 2LBVA 4IB8A 2IWWA 3T6LA 2MF6A 2GH7A 1AB0A 4ORWA 3NQ9A 4TNNA 4YBPA 3VG3A 2JU8A 5D48A 1TXLA 2L68A 1OPBA 2W2AA 3O22A 1KQXA 2UYWA 3RBYA 2XKLA 4RJWA 4IMOA 1RSUB 4AZRA 3FIDA 4O3XB 2X4MA 2KC0A 3PGUA 2RTFB 3VZUX 4Y5DA 1G85A 2A5BA 1QABE 4O4UA 4RLBA 3HWEA 1ZNEA 1VYFA 1G90A 2MNHA 2OF8A 5B10O 4OMWA 3ZW1B 1SWKA 4Y59A 1LFOA 3AAEA 2MJIA 3AA1A 2RA6A 1BSYA 3I0AA 1A2DA 1HQPA 3LK2B 3FEPA 1KT6A 5C0NA 2NNEA 1W6FA 1TOWA 3SLJA 3ZW0B 2E4JA 3BSZE 2BC3A 4GKCA 1LDOA 1QJ8A 1SXWA 1LIDA 1JQPA 3RKGA 5FQ7E 3VY9X 3VG2A 6PRNA 1SMPI 3PEDA 1RXJA 2OFBA 3C5OA 3AEHA 2QCBA 1BXWA 5L8IA 4QRLA 3WJGA 1SREA 4YGGA 2R4LA 2CBRA 4MVIA 4CK4A 3WJCA 1KL5A 1L6MA 3EBKA 4QNIA 4IBAA 1DC9A 2JW1A 1Y0GA 4QGXA 1BT9A 3K3LA 2QM9A 3FDCA 4IRWA 2FRSA 1ZNDA 1GT1A 2AT5X 5FENA 1MX8A 2HLVA 1IZNB 1SWTA 1U0XA 5CE4A 4I3CA 2F1TA 3RSWA 4EQAC 2M07A 2OY1O 3BU1A 4YCHA 5AEOA 3FR2A 2WEWA 1KT7A 2KXPB 2R4NA 1SRFA 2KD2A 2Y3EA 2IZEB 1E06A 4LKTA 2MM3A 2PI3O 2KDYA 1W5RA 3ZUIA 1VYGA 2X32A 3QKGA 4GCQA 2Q2PA 4CPIA 4ODDA 1T68X 4NW4A 4FESA 1OSMA 1HXTA 1ERXA 3TGAA 2R73A 4FT6A 4D64A 5K67A 5H9AA 1RBPA 1VWDB 3SZDA 2I5VO 5H9KA 1JIWI 1YWCA 4XMEA 1JZUA 2RCQA 5LJHA 4GJSA 3IFBA 1ERBA 3RZYA 4U3QA 2CM4A 1QJ9A 4N74A 4GHBA 2AL0X 2R89A 5GTHO 2OVAA 3DZMA 2BS5A 2RTMA 4Z3TA 1I04A 3T0SA 2PORA 4ZHGA 4Z28A 4GGTA 3PQSA 3VY8X 2IZGB 2Y0LA 1E02A 2Q2MA 3HOLA 2KZ7A 4FRXA 2L9CA 2KW1A 2HKDA 3D4RA 4HFOA 5HA0A 1PM1X 4GRJA 4I3BA 5HCEC 3FR4A 4KH8A 4WHIA 1R0UA 3PGSA 4PR7A 3HWDA 1MOYA 3RDXA 4ZFXA 3NADA 4AZNA 4XNKA 1Y52X 1RAVA 4IMNA 4L1NA 2WWPA 1AVEA 4AYID 3H3IA 1P6PA 2GE4A 1ZNGA 2RTNB 2AH7X 3CBCA 3NJTA 3TGCA 4MVKA 2F1CX 4CSBA 4BX6A 4XMHA 3C76X 3WJFA 3KZIO 2W2BA 1MM4A 3Q34A 5B5GA 4U8UM 2RTBB 2EU7X 5HTDA 2J1NA 4FZMA 4ZR2A 2LHFA 1BRQA 4ML7B 3SZJA 5F6BA 4RJXA 2FS6A 2XE5A 3BLGA 3FA8A 4YCEA 1MX7A 1GFOA 4IAWA 3PECA 2QO5A 5HA1A 4YDBA 4TQ2A 4UU3A 3AA6B 1JMXA 4FOZA 4XMGA 4FBVA 1JYJA 2RTAA 4CDCA 2X8TA 3VE2A 1ICNA 1N7YA 4BBOA 4GNWA 4OS0A 1SWQA 4IB7A 4HPBA 4ALOA 4KT5A 1G74A 3JS1A 1STSB 4A1YA 1EIOA 2FS7A 1CBRA 2ODJA 1SWOA 2O62A 1QWDA 3ZQ3A 1DFVA 4IAXA 1QFTA 1JV4A 4NV8A 3P6GA 3PK2A 4QZTA 1UZ2X 1VWKB 2A3FX 4N58A 3FA7A 5LKEA 4XMFA 1THQA 1U17A 1T1LA 4C4VA 3RE5A 2WSJA 2IZJA 5F7GA 1LIEA 2HYSA 3ZWEA 2Z4IA 4ORSA 2GTLM 3VU1A 3U0DA 1IJ8A 3KFFA 2A5CA 4GJVA 2IZAA 2JN3A 5D8JA 4BCSA 3D97A 1G7NA 4D65A 5HZQA 5LJGA 2FGQX 4YH0A 3HK1A 4MEEA 2AT0X 4C69X 2Y0KA 1Y53X 1AELA 3NQKA 2LBAA 4LKPA 5F2BA 1VWAB 3NP1A 1DF3A 3B2IA 3TZSA 3LK42 3WVMA 5KAFO 1BRPA 1ZHYA 4OEMA 3UPGA 4KR8A 3UU2A 1ADLA 4EFGA 2IZKA 4PUXA 4WBKA 1YS5A 1NP1A 4U8UN 2AT8X 1T16A 4C5PA 1LDQA 2LFOA 3FA9A 2OVDA 1PMPA 2OYBO 1NQNA 1JJUA 4G75A 1DZPA 4ZCBA 1NBXA 1E5PA 1N9MA 3AA7A 1VWHB 1SLEB 2OVSA 1OEJA 3PGRA 1LUQA 4KC8A 1B56A 3APWA 5LJBA 1BM5A 2JU7A 4M6SA 3B2HA 1T8VA 5BYPA 1SXXA 4IABA 2FLJA 1HXLA 4PSQA 4LSFA 1QY0A 5G39A 1QG5A 2W81C 2QOSC 3SZHA 4FZLA 2J4UP 3ELXA 4KC7A 1STRB 1O1UA 4YVBA 2QOMA 4E1SA 3BS0A 2K0LA 3C78X 2AVIA 4Y0SA 4U46A 2XE1A 2RTRB 1YWBA 4BOEA 1PTSA 1QFVA 3BRYA 1GT3A 4JHQA 1A57A 3RDQA 4N7DA 4YGZA 4ORRA 1SWDA 1KT3A 3FIQA 4RLCA 3SYBA 1YUPA 3MG5A 4ZJ0A 3ZW1A 1AVDA 2GTLN 3TF6A 1DZMA 2FTBA 1OBUA 1NC9A 1VWBB 1YP6A 2G7BA 4IB9A 3LK2A 1MDCA 2X8FA 2UZ2A 3WU2O 3ZW0A 2OL7A 1GT4A 4RUUA 2ERVA 4BGFA 2RTQB 1SWRA 2IZFB 4ZHDA 3CBSA 1EPBA 1QY1A 3SY9A 4I60A 5KAIO 2FHLA 1VWCB 4RL9A 3HWBA 2OY7A 3GAQA 2PY1A 1JYDA 5GV0A 5H2FO 4AYDC 3HOEA 1LELA 5G38A 4QGVA 4AZPA 4YFPA 4TKHA 3T2WA 1Q9FA 2BS6A 3EMNX 2YPVA 3HW9A 1K3BA 1B4MA 1HXUA 1HMTA 1A18A 2VDFA 1CBQA 1VWPB 1Y9TA 1IZNA 4ARHA 1YWAA 2IZLB 2RCTA 2CBSA 4OS3A 1SLFB 3F8AA 3UAQA 4DQ3A 4QYNA 4A1HA 2KXPA 1GGLA 4GCPA 5DG4A 2N2MA 3HWFA 3O19A 4BVMA 5H9LA 4YDAA 2QO6A 3ELZA 4AKMA 4MIRA 1UYOX 1UREA 3MBTA 4GUZA 1OPFA 1SWCA 1Y55X 2FR2A 1BBPA 4CDFA 4YFRA 4QYPA 2PRNA 2DJGA 1KQWA 1K24A 2RD7C 5DPQA 1D3SA 3T6FA 4YGHA 3RWXA 2MHLA 4KIIA 5AFUK 1DF8A 1RXKA 1WBIA 2F09A 2F73A 2YG2A 3HWGA 3MVFA 3SAOA 1KT4A 1ZNHA 3CR6A 4ZH9A 5H8TA 1TW4A 1QQSA 5B29A 3G7XA 3WZQA 5F1EA 2LA7A 3QRAA 4NYRA 4MISA 1KGLA 4AW8A 1OEEA 4Y0PA 4AKRB 1PEEA 1U18A 1GX8A 1OSPO 2IZHB 3DSZA 1GFQA 4Z2PA 1ZHZA 1N43A 1VWGB 4AZOA 1N4JA 2Y3FA 5EZ2A 5AJCA 1PHOA 2L67A 4OMXA 5LJEA 4QZUA 4GD9A 1FEMA 1MPFA 1FELA 3RBHA 1NGLA 3STMX 3A2SX 4ES7A 2QTKA 2R4PA 1VWIB 3I17A 2G78A 4ORXA 3NBXX 4CTDA 2F01A 3FA6A 3NX1A 5DL6A 3POUA 4E1TA 1QY2A 3V8UA 4Y0RA 3KFGA 1CJ5A 4DQ4A 4FQEA 1IFCA 4GH7A 3BY0A 4AUIA 1LCZA 1SWUA 1DV9A 1CRBA 5JR8A 5ADXK 1A3YA 1I06A 3P6FA 5CHKA 1AVGI 5KIDA 2IZDB 1GFPA 3DWOX 1DZJA 2X34A 1VWFB 4INNA 3AA0B 2JQYA 4YKMA 2WJQA 4QAEA 4NP1A 3WZNA 5B3MO 3AA6A 1JJXA 3RE6A 1ZHWA 1LKEA 3WJBA 1CBIA 3FR5A 4GDAA 3EM0A 4GNYA 1WUBA 1SLGB 1GKAB 1S7DA 5JD2A 1KZWA 3PH5A 4AYMC 5FFHA 1ALBA 4DNEA 5F58A 4IL6O 4CPFA 1EQDA 3APUA 3U9PC 1SWPA 1FENA 2A13A 4CDEA 2WR6A 3AAAB 2A8GA 1H91A 3CWKA 3WXQA 4ORUA 5IRAA 4FMSA 2X9KA 3G7GA 1SWJA 2OF9A 2YNKA 1E2TA 4AYEC 4FRTA 3VG4A 4LQZA 1GX3A 4HPDA 4GU8A 3CKFA 1SWEA 3P6CA 2Q9SA 2FR3A 1SRIA 4ZHCA 1HXZA 2M06A 4Z2VA 2X46A 3FMZA 4O3WA 2FT9A 1LICA 2A2UA 3B2KA 5HZ6A 4N75A 1KL3A 4LSEA 3KFIA 5EE2A 4U8UO 1X71A 1IIUA 4YMYA 4ON1A 2X56A 3PF1A 5EEDA 3HPEA 3S5VA 3OBLA 4M7MA 3HTYA 4XMDA 2IZBA 1KT5A 4UU2A 3OE3A 5HZ5A 3UEVA 1SWAA 5PRNA 4NLJA 5B5FA 2MHDA 2RTOB 4FQBB 3KVNA 3NR3A 3JCUO 2WQ9A 5AQ6A 1SWGA 2OFMX 2IFBA 1H6S1 2OL8O 4JFBA 2RTJA 5D45A 2RN4A 2ANSA 2N2LA 5FQ8E 5CSEA 4KR4A 2DJFA 3T20A 3LK3B 2VFBA 4GK9A 1X8NA 3E3CA 3K19A 4FBOA 3LK41 3VE1A 1SY2A 4WFUA 2X27X 3QRCA 3FW4A 4A60A 4PJ2A 2FKGA 5E79O 3VG6A 2OFAA 1SWLA 3A0HO 4BX5B 2Y7SA 1NQMA 3FW5A 1BJ7A 3BDRA 1VWJB 4YBUA 3WZPA 2I5ZO 1NDJA 2IZIA 3U03A 4TKJA 1N0SA 4I6SA 3RY2A 1LIFA 2RTKA 2X8SA 1O1VA 1KZXA 1LPJA 3X00A 4NNSA 3ZUOA 5KICA 5AFUL 3O0EA 1LIBA 2G5LA 4AZLA 3SLTA 1HMRA 3ZI8A 3SZVA 1I9HA 2AKQA 4AFKA 3RDOA 1S5LO 5EPQA 4IB6A 2WUTA 2NNDA 3VZTX 5LJKA 5HZ9A 2VFCA 1OBPA 1SWSA 4QGWA 3LV4A 1BWYA 1GFMA 3VG5A 2OZQA 1W4TA 3VHHA 4AZMA 3TZGA 1LCVA 1VWEB 3MX7A 2RTHB 2QO4A 5HBSA 1STPA 4I95A 1PBYA 1Y9LA 1E54A 2W2FA 2ZLDA 2RTDB 1AQBA 3NQ3A 3CMPA 2X45A 3EMMA 1IW2A 1SA8A 2MO5A 2CAMA 4U9CA 3ZZVA 1SRHA 4ALBA 2BT9A 1FTPA 1ZNLA 1KL4A 2RTIB 3S60A 1X8QA 4TJZA 1B8EA 1RLBE 5FAZA 3SLOA
chains in the Genus database with same CATH topology
3FEKA 3H3IA 1P6PA 2GE4A 1ZNGA 1KQWA 1Z24A 2FWVA 2RD7C 5EDBA 5DPQA 1TVQA 2KTSA 2AH7X 3P6EA 5ADXL 4O9SA 3CBCA 1D3SA 3P02A 2JMMA 3TGCA 4MVKA 1E00A 4YGHA 3RWXA 1HBPA 4CSBA 4KIIA 2MHLA 7PRNA 5AFUK 1YP7A 4XMHA 2Y0HA 1SXUA 2YG2A 2F73A 2F09A 3C76X 3HWGA 1EUOA 3MVFA 3SAOA 3WJFA 1KT4A 1ZNHA 2W2BA 3AA1A 3CR6A 3T1DA 3BX7A 3STNA 4COTA 3WI4A 4AYNA 5LKFA 3F9DA 4LZVA 4ZH9A 5H8TA 1MM4A 1TW4A 5IYUA 1QQSA 1ZNKA 1ORMA 4U8UM 5B29A 2GTLO 1SY3A 4ORYA 2EU7X 3G7XA 4L3RA 4MVEA 1JBHA 2AMMX 5HTDA 3CQNA 2J1NA 4FZMA 5F1EA 5DL7A 4ZR2A 4O4OA 5LJDA 4RUNA 2BLGA 1BLRA 2LHFA 1BRQA 4E1SA 5H9NA 4ML7B 3Q6LA 5D4AA 3T24A 2LA7A 5F6BA 5L8NA 3QRAA 4O4SA 2ACPX 4NYRA 4RJXA 1GXAA 2CZTA 2FS6A 4MISA 2XE5A 3EYCA 1KGLA 3OJYC 1YIVA 4OS8A 1ZHTA 3WBGA 3FLLA 4HPAA 4LZUA 4AW8A 1OEEA 3BLGA 2XE2A 2L5PA 2DM5A 3FA8A 4Y0PA 4YCEA 4AKRB 2GTFX 1MX7A 3PQUA 1U18A 1GX8A 1PEEA 3DSZA 1GFOA 1IKJA 4Y0QA 5B27A 4IAWA 3PECA 1GFQA 2QO5A 2GC9A 5HA1A 4AZOA 4YDBA 4TQ2A 4UU3A 3AA6B 1QJPA 4I9RA 2CM9A 2GJ5A 4FOZA 4XMGA 1P4TA 3S26A 3WJDA 5FVNA 4FBVA 1JYJA 4TLJA 5EZ2A 5AJCA 4ZHFA 3BS2A 3BX8A 1PHOA 2L67A 4G76A 1MVGA 3POQA 4OMXA 2HMBA 5LJEA 2X8TA 1SXYA 4QZUA 4BQUA 1FEMA 3VE2A 1ICNA 5JDPA 1MPFA 1TOUA 1FELA 3KQ0A 1I4UA 3RBHA 4GNWA 4OS0A 4IB7A 3ZW2A 1ZRYA 1NGLA 2JMBA 3PH6A 4HPBA 3STMX 4ES7A 3A2SX 3UEUA 4ALOA 2QTKA 3SY7A 4AYID 1PBOA 2AT3X 4KT5A 3N91A 5IO7A 1G74A 3JS1A 4O49A 2XG6A 3D95A 2WEXA 2HZQA 2YMSA 3I17A 4A1YA 3S5XA 4K19A 1EIOA 2G78A 2FS7A 3NBXX 4ORXA 3FA6A 1KXOA 2Z4HA 1CBRA 1EXSA 2A0AA 3JSQA 3NX1A 4GE1A 2ODJA 3POUA 2O62A 5DL6A 4E1TA 1HXXA 1QWDA 4QQ1A 3PP6A 1ACDA 1QY2A 4N7CA 3V8UA 1DFVA 3ZQ3A 4Y0RA 4IAXA 1ML7A 1QFTA 4AZQA 2G79A 4KRAA 1JV4A 2HNXA 3P6GA 2F1VA 3C77X 3KFGA 1CJ5A 5EEEA 4QZTA 4DQ4A 1GFNA 4A8ZA 1UZ2X 2A3FX 1IFCA 3L4RA 4GH7A 3BY0A 4HPCA 3TGBA 4N58A 5K06A 4AUIA 1OEKA 3FA7A 1DV9A 1CRBA 3KFHA 3O2YA 2ASNX 1T0VA 3DTQA 4O3YA 1A3YA 5JR8A 5LKEA 2W80C 1OPAA 3GP6A 1I06A 5ADXK 3P6FA 1SY0A 4XMFA 1THQA 2XSTA 1BSOA 1U17A 5DL5A 1AVGI 5KIDA 2WSJA 4HWMA 5F7GA 1GFPA 1LIEA 5G26A 4WFVA 1CBSA 1DZJA 2HYSA 1EI5A 3ZWEA 2Z4IA 4ORSA 2GTLM 3VU1A 3NPOA 2ZAIA 4EXZA 4AKRA 3U0DA 4AYHA 4INNA 5HCCC 3AA0B 2JU3A 4YKMA 4QAEA 4NP1A 4YFQA 3KFFA 2ZFGA 3AA6A 2JN3A 1JJXA 2O4VA 1DZKA 5D8JA 1D2UA 1ZHWA 3D97A 1G7NA 1LKEA 3WJBA 1XKIA 4FSOA 1G5WA 1YWDA 3STKA 1CBIA 3FR5A 4D65A 5HZQA 2BHVA 5LJGA 3UEXA 3AA7B 4I3DA 2MWHA 3GE2A 4YH0A 2FGQX 1EIIA 3HK1A 3EM0A 4GNYA 3WOVA 3AAEB 2AT0X 3AKNA 1EPAA 1LF7A 4C69X 1GKAB 5L8OA 3AA1B 2Y0KA 1S7DA 2K62A 3UEWA 2LBVA 4IB8A 3F6ZB 1BEBA 1AELA 3NQKA 1AB0A 2LBAA 4LKPA 5EDCA 4ORWA 3PH5A 1KZWA 3DA3A 4AYMC 5FFHA 1ALBA 3NQ9A 4GETA 4TNNA 2K4TA 3NP1A 4YBPA 4GF4A 3VG3A 3WI5A 1DF3A 3B2IA 5F58A 4XMCA 3TZSA 3LK42 3WVMA 2JU8A 1BRPA 2LB6A 1EQDA 5D48A 3APUA 4NNTA 3U9PC 1ZHYA 1TXLA 2L68A 3UPGA 1FENA 4KR8A 2A13A 1OPBA 1X8PA 3UU2A 2W2AA 1ADLA 2WR6A 1HMSA 2ZAGA 3O22A 1KQXA 3RBYA 3AAAB 1X89A 1H91A 3CWKA 4EFGA 3WXQA 3VG7A 4ORUA 2XKLA 4RJWA 3D96A 4IMOA 4FMSA 3G7GA 4PUXA 1ZHZA 4WBKA 1YS5A 2CZUA 1NP1A 3BRNA 2YNKA 4AZRA 4AYEC 3FENA 4FRTA 3VG4A 4NLIA 4KC8A 1HBQA 4O3XB 4U8UN 1MUPA 4LQZA 5DL8A 2AT8X 2KC0A 4HPDA 4GU8A 3VZUX 3P6CA 1G85A 3IA8A 2Q9SA 4I9SA 1QABE 2LFOA 2NP1A 3NX2A 3FA9A 2FR3A 2OVDA 4O4UA 5D47A 4RLBA 3HWEA 1ZHXA 1PMPA 4ZHCA 2M06A 3AA0A 1ZNEA 3SYSA 1VYFA 1G90A 2X46A 2MNHA 3FMZA 4O3WA 4G75A 2OFRX 1DZPA 1IFBA 2FT9A 1LICA 4OMWA 4KCAA 4ZCBA 5IO5A 2A2UA 3B2KA 5HZ6A 3ZW1B 4MVLA 5HWZA 1E5PA 3AA7A 4LSEA 3KFIA 5EE2A 4U8UO 5BVSA 1LFOA 2A2GA 2AT6X 1X71A 1IIUA 4YMYA 1I05A 1GX9A 1SY1A 4ON1A 2R56A 3AAEA 2OVSA 1OEJA 3VPJE 5EEDA 1B56A 1X8OA 2MJIA 1GKAA 3APWA 3P6HA 2HZRA 1BSYA 2RA6A 3I0AA 3S5VA 5LJBA 2OMFA 1A2DA 1BM5A 1HQPA 3LK2B 3FEPA 2JU7A 3OBLA 1KT6A 4JGLA 4M7MA 4M6SA 3HTYA 3B2JA 3B2HA 4XMDA 5C0NA 2NNEA 4ZGFA 1TOWA 1T8VA 5BYPA 1SXXA 3ZW0B 1BSQA 2E4JA 4IABA 4ZHHA 3BSZE 1KT5A 2FLJA 4GKCA 4UU2A 3OE3A 5HZ5A 5IO6A 4PSQA 3UEVA 4CV7A 1SXWA 1QJ8A 4LSFA 1LIDA 1QY0A 4NLJA 5PRNA 2MHDA 4LSHA 3RKGA 1QG5A 4FQBB 1JJJA 2NNQA 5FQ7E 2W81C 3VY9X 1NP4A 2QOSC 3NR3A 3VG2A 4FZLA 6PRNA 3AAAA 2J4UP 1SMPI 3ELXA 3PEDA 5LJCA 4KC7A 4GCSA 5HCDC 1O1UA 3C5OA 3NSGA 3DA4A 1BXWA 5HTEA 2N93A 2WQ9A 4QRLA 5L8IA 2K0LA 3PORA 4BUMX 5AQ6A 3WJGA 1OBQA 4YGGA 3C78X 2CBRA 4Y0SA 3SOTA 2OFMX 3FYXA 2IFBA 1H6S1 4JFBA 2XE1A 4D6AA 5D45A 1YWBA 2RN4A 1VPRA 4BOEA 2ANSA 4CK4A 2N2LA 5FQ8E 3PRNA 3WJCA 4FBRA 2FGRA 1QFVA 1L6MA 3EBKA 1GT3A 4QNIA 1S2PA 4IBAA 4B61A 4D6BA 1DC9A 2JW1A 4QGXA 1A57A 4XNLA 1BT9A 4N7DA 3K3LA 4YGZA 4ORRA 4KR4A 1KT3A 2QM9A 3FIQA 5KHPA 3T20A 4RLCA 3SYBA 3LK3B 1YUPA 4GK9A 1X8NA 1B0OA 3E3CA 4ZH6A 3K19A 2FRSA 2LKKA 4ZJ0A 2XE3A 3BU9A 1ZNDA 1GT1A 4FBOA 3ZW1A 3LK41 2GTLN 3VE1A 4ZGUA 1SY2A 3TF6A 2AT5X 4WFUA 1DZMA 2X27X 2FTBA 1OBUA 5FENA 3QRCA 1MX8A 2HLVA 1IZNB 1U0XA 3CQRA 5CE4A 3FW4A 4I3CA 4A60A 4PJ2A 1YP6A 2G7BA 3VG6A 2F1TA 4IB9A 3RSWA 3LK2A 4EQAC 4FGIB 1MDCA 5BVTA 2X8FA 2Y7SA 2M07A 1ICMA 1GT5A 3FW5A 3BU1A 4YCHA 2KT4B 1BJ7A 3FR2A 5AEOA 2WEWA 2XTRA 1KT7A 3ZW0A 1GM6A 4F4BA 4ID2A 5FQ6E 2KXPB 3VZWX 3BDRA 5CYBA 1GT4A 2KD2A 3EBWA 4RUUA 4YBUA 2ERVA 1E06A 2KZ7B 4LKTA 2LFUA 4LSIA 4ZHDA 2MM3A 5HZ8A 3CBSA 1EPBA 3ZUIA 1BH3A 2KDYA 1VYGA 2WQAE 3QKGA 3U03A 4GCQA 4TKJA 1QY1A 4FUVA 2KTDA 1N0SA 4I6SA 3SY9A 1LIFA 2Q2PA 4ODDA 2X8SA 3B2LA 1S44A 1T68X 4RL9A 1O1VA 3HWBA 4NW4A 2JOZA 1KZXA 1OSMA 4FESA 4O3ZA 1HXTA 2Q4NA 3GAQA 1LPJA 2K23A 4NNSA 3ZUOA 1ERXA 5F6ZA 1HN2A 2R73A 3TGAA 5KICA 3O0EA 2PY1A 1JYDA 5AFUL 1LIBA 3P24A 5GV0A 4FT6A 4D64A 3AKMA 4EDEA 4AZLA 4AYDC 4EEJA 3HOEA 4R0BA 5H9AA 1RBPA 4YKOA 3POXA 4GZVA 3SZDA 1HMRA 3ZI8A 3SZVA 3KZAA 4QGVA 4AZPA 2OVEA 1O8VA 4YFPA 5HAEA 4TKHA 2ALLX 2AKQA 5H9KA 1JIWI 4AFKA 1YWCA 4XMEA 1JZUA 1Q9FA 1XCAA 5EPQA 2BS6A 4IB6A 2RCQA 3EMNX 5D5DA 2WUTA 2NNDA 3VZTX 5LJHA 2YPVA 3HW9A 4O4XA 5LJKA 5HZ9A 1B4MA 3IFBA 1ERBA 1HXUA 1HMTA 1X8UA 1A18A 1OBPA 3LK3A 2PRNA 4QGWA 3OD9A 3RZYA 4U3QA 1EALA 2CM4A 1QJ9A 3JTYA 1CBQA 3LV4A 4D5UA 4GHBA 2AL0X 2OVAA 1BWYA 4FZNA 1Y9TA 1IZNA 2BS5A 5BVQA 4ARHA 2Q39A 1GFMA 3VG5A 4Z3TA 2OZQA 3APXA 1YWAA 1EW3A 1I04A 2RCTA 2CBSA 3PPTA 3T0SA 2PORA 2POAA 4AZMA 3TZGA 4ZHGA 4JCHA 4OS3A 2M4LA 3MX7A 1PRNA 1FDQA 3F8AA 2QO4A 4NYQA 3UAQA 4DQ3A 3KVDD 4QYNA 2QMIA 3PQSA 3VY8X 2ACOA 5HBSA 4A1HA 2KXPA 2Y2XA 2Y0LA 4I95A 1E02A 1IKEA 4N59A 3JQOA 1GGLA 4GCPA 2Q2MA 1Y9LA 3HOLA 2KZ7A 1E54A 2W2FA 2XTQA 2ZLDA 1KOIA 4FRXA 1AQBA 5DG4A 4FSPA 3NQ3A 1MM5A 2P8GA 1Q9GA 2L9CA 3CMPA 2X45A 3EMMA 2KW1A 2N2MA 3HWFA 3D4RA 1IW2A 3O19A 4BVMA 1SA8A 2MO5A 4HFOA 5H9LA 4YDAA 5HA0A 2QO6A 1PM1X 4GRJA 4U9CA 3ELZA 4I3BA 5HCEC 4AKMA 3ZZVA 4MIRA 2XMXA 3FR4A 4ALBA 2RQ0A 1UREA 3MBTA 4KH8A 4WHIA 3WJEA 1R0UA 2BT9A 3FELA 5T5FA 3APVA 1FTPA 1ZNLA 2R74A 1OPFA 1LNMA 4GDZA 3HWDA 4ZFXA 3NADA 2FR2A 1BBPA 3FYFA 4TKBA 4AZNA 8PRNA 3S60A 1X8QA 3LHNA 4QYPA 4YFRA 4XNKA 1FE3A 4IMNA 4L1NA 4TJZA 1B8EA 1RLBE 2WWPA 5AJBA 3P6DA 5FAZA 4MVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O49 A;  4O3X B;  4O3Y A;  2W80 C;  4U9C A;  5EE2 A;  2KC0 A;  2YPV A;  4O4X A;  2W81 C;  3UAQ A;  5T5F A;  4O4U A;  3KVD D;  3PQS A;  2Y7S A;  4O3Z A;  4QQ1 A;  3V8U A;  3HOL A;  3VE2 A;  4AYN A;  4AYD C;  1YS5 A;  3HOE A;  4O3W A;  3VE1 A;  3PQU A;  4AYM C;  2LFU A;  4AYE C;  4Z3T A;  2KDY A;  4AYI D; 
#chains in the Genus database with same CATH topology
 2G8C O;  2FWV A;  5EDB A;  1TVQ A;  3P6E A;  5ADX L;  4O9S A;  3P02 A;  1E00 A;  2FHN X;  1SXU A;  2JMM A;  4JO6 A;  1EUO A;  3STN A;  4COT A;  3WI4 A;  3F9D A;  4LZV A;  1SY3 A;  4CPH B;  4ORY A;  4MVE A;  1JBH A;  2AMM X;  5DL7 A;  5LJD A;  2BLG A;  1BLR A;  5H9N A;  3Q6L A;  2R88 A;  1SRG A;  1GXA A;  4OKA A;  1YIV A;  4OS8 A;  3WBG A;  3FLL A;  4HPA A;  4LZU A;  2L5P A;  2DM5 A;  2GTF X;  2GC9 A;  5L3Y A;  1QJP A;  4I9R A;  2GJ5 A;  3S26 A;  5FVN A;  4TLJ A;  3BS2 A;  3BX8 A;  2HMB A;  4BX7 B;  5JDP A;  1LCW A;  4Z2O A;  1TOU A;  3KQ0 A;  1I4U A;  1RXH A;  3ZW2 A;  1ZRY A;  3PH6 A;  3UEU A;  2AT3 X;  3N91 A;  5IO7 A;  2XG6 A;  3D95 A;  1RST B;  4NV7 A;  2YMS A;  3WYQ A;  2Y32 A;  4K19 A;  1KXO A;  2A0A A;  3JSQ A;  2R8A A;  1HXX A;  3PP6 A;  1ACD A;  4AZQ A;  3LTW A;  1ML7 A;  2G79 A;  2HNX A;  1MEP A;  2RTL A;  1GFN A;  5IXG A;  3L4R A;  4HPC A;  2BSZ A;  3O2Y A;  2W80 C;  3WZO A;  3GP6 A;  1SY0 A;  2XST A;  1BSO A;  5GTI O;  1MK5 A;  1CBS A;  1FJ1 E;  4AKR A;  2JU3 A;  4YFQ A;  4CDD A;  2O4V A;  1DZK A;  1XKI A;  4FSO A;  1G5W A;  3STK A;  2MWH A;  1EII A;  3WOV A;  3AAE B;  3AKN A;  1LF7 A;  3AA1 B;  2K62 A;  3UEW A;  3F6Z B;  1BEB A;  5EDC A;  3DA3 A;  4GET A;  2K4T A;  4GF4 A;  3WI5 A;  1SWF A;  4XMC A;  2LB6 A;  3VHI A;  4NNT A;  4Z6J A;  1HQQ A;  1X8P A;  1HMS A;  2ZAG A;  1X89 A;  3VG7 A;  3QQ2 A;  3D96 A;  5IRU A;  2CZU A;  3BRN A;  3FEN A;  4JNJ A;  4NLI A;  2RTE B;  1HBQ A;  5DL8 A;  1MUP A;  3D9W A;  2WVP A;  3IA8 A;  4I9S A;  5TIS O;  4DCB A;  2NP1 A;  3NX2 A;  5D47 A;  1ZHX A;  2OY5 O;  2OY8 A;  1I78 A;  3AA0 A;  3SYS A;  5IRW A;  2OFR X;  1IFB A;  2C1Q A;  3T2X A;  2WJR A;  4KCA A;  5IO5 A;  4MVL A;  5HWZ A;  5BVS A;  2A2G A;  2AT6 X;  5B66 O;  1I05 A;  1GX9 A;  1SY1 A;  2R56 A;  3VPJ E;  1X8O A;  3P6H A;  1GKA A;  2HZR A;  2OMF A;  4JGL A;  3B2J A;  4ZGF A;  4Z27 A;  1BSQ A;  4ZHH A;  1SWH A;  5IO6 A;  4CV7 A;  4UB8 O;  4LSH A;  1JJJ A;  2NNQ A;  1NP4 A;  3AAA A;  2RTC B;  5LJC A;  4GCS A;  5HCD C;  3NSG A;  3DA4 A;  5HTE A;  2N93 A;  4BUM X;  3POR A;  1OBQ A;  2AF5 A;  3SOT A;  3FYX A;  4K3B A;  2FKJ A;  4D6A A;  1VPR A;  3PRN A;  4FBR A;  2ZSC A;  2FGR A;  2RTP B;  1S2P A;  4B61 A;  4D6B A;  4XNL A;  2WPU A;  5KHP A;  1B0O A;  4ZH6 A;  2LKK A;  2XE3 A;  3BU9 A;  4ZGU A;  3CQR A;  2IWV A;  2IZC B;  2R4O A;  3DWN A;  4FGI B;  5BVT A;  4GGR A;  1ICM A;  1GT5 A;  2KT4 B;  2XTR A;  3VGW A;  1GM6 A;  4F4B A;  4ID2 A;  5FQ6 E;  3VZW X;  5CYB A;  3EBW A;  2KZ7 B;  2LFU A;  4LSI A;  1N9Y A;  4UB6 O;  5HZ8 A;  1BH3 A;  2WQA E;  4FUV A;  2KTD A;  5B5E O;  3B2L A;  3EW1 A;  1S44 A;  2JOZ A;  4O3Z A;  2Q4N A;  2K23 A;  5F6Z A;  1HN2 A;  4OEL A;  3P24 A;  3AKM A;  4EDE A;  4EEJ A;  4R0B A;  2AXT O;  4YKO A;  3POX A;  4GZV A;  3KZA A;  4CPE A;  2OVE A;  1O8V A;  5HAE A;  2ALL X;  1XCA A;  5D5D A;  4O4X A;  2C4I A;  1X8U A;  3LK3 A;  3OD9 A;  3VHM A;  1EAL A;  3JTY A;  4BX6 B;  4D5U A;  3A0B O;  4FZN A;  1SWN A;  5BVQ A;  2Q39 A;  3APX A;  1EW3 A;  3PPT A;  2POA A;  4JCH A;  4BX5 A;  2M4L A;  1PRN A;  1FDQ A;  4NYQ A;  1JMZ A;  3KVD D;  2QMI A;  2ACO A;  2Y2X A;  2JGS A;  4N59 A;  1IKE A;  3JQO A;  2XTQ A;  1KOI A;  2C1S A;  4FSP A;  1Q9G A;  1MM5 A;  2P8G A;  1VWN B;  2XMX A;  1VYO A;  1VWR B;  2RQ0 A;  3WJE A;  5T5F A;  5K68 A;  3FEL A;  1HY2 A;  3APV A;  2R74 A;  1LNM A;  4GDZ A;  3RDM A;  1VWM B;  2FGS A;  3FYF A;  4TKB A;  8PRN A;  3LHN A;  1FE3 A;  5AJB A;  3P6D A;  3FEK A;  1MM9 A;  3AUM O;  3PDF A;  1Z24 A;  2KTS A;  3SZI A;  4B55 A;  1HBP A;  7PRN A;  1YP7 A;  2Y0H A;  1KFF A;  3T1D A;  3BX7 A;  4AYN A;  5LKF A;  4EKV A;  5IYU A;  1ZNK A;  1ORM A;  5G3A A;  2GTL O;  3MM0 A;  4L3R A;  3CQN A;  3BRZ A;  4O4O A;  4RUN A;  5D4A A;  3T24 A;  5L8N A;  4O4S A;  2ACP X;  4C4V B;  2CZT A;  3EYC A;  2RTG B;  3OJY C;  1ZHT A;  2XE2 A;  4C00 A;  3PQU A;  1IKJ A;  4Y0Q A;  5B27 A;  1VWO B;  2CM9 A;  1P4T A;  3WJD A;  3RDS A;  4ZHF A;  4G76 A;  1MVG A;  3POQ A;  4BQU A;  1SXY A;  5B11 O;  4PJ0 O;  2JMB A;  3SY7 A;  1PBO A;  4O49 A;  4BJ8 A;  2WEX A;  2HZQ A;  3RY1 A;  3S5X A;  4GGZ A;  2Z4H A;  5B2A O;  1EXS A;  4GE1 A;  3EW2 A;  4QQ1 A;  4N7C A;  4KRA A;  4K3C A;  2F1V A;  3EC5 A;  3C77 X;  4CPH A;  5EEE A;  1SWB A;  4A8Z A;  1UYN X;  3TGB A;  5K06 A;  1OEK A;  3KFH A;  2ASN X;  1T0V A;  3DTQ A;  4O3Y A;  1OPA A;  5DL5 A;  4HWM A;  3WYP A;  1VWQ B;  2OL6 O;  5G26 A;  4WFV A;  1EI5 A;  3NPO A;  2ZAI A;  4EXZ A;  1SLD B;  4AYH A;  5HCC C;  1SRJ A;  2ZFG A;  3CKG A;  1D2U A;  1YWD A;  2X55 A;  1VWL B;  3AA7 B;  2BHV A;  3UEX A;  4I3D A;  3GE2 A;  4BX7 A;  1EPA A;  5L8O A;  3RDU A;  2LBV A;  4IB8 A;  2IWW A;  3T6L A;  2MF6 A;  2GH7 A;  1AB0 A;  4ORW A;  3NQ9 A;  4TNN A;  4YBP A;  3VG3 A;  2JU8 A;  5D48 A;  1TXL A;  2L68 A;  1OPB A;  2W2A A;  3O22 A;  1KQX A;  2UYW A;  3RBY A;  2XKL A;  4RJW A;  4IMO A;  1RSU B;  4AZR A;  3FID A;  4O3X B;  2X4M A;  2KC0 A;  3PGU A;  2RTF B;  3VZU X;  4Y5D A;  1G85 A;  2A5B A;  1QAB E;  4O4U A;  4RLB A;  3HWE A;  1ZNE A;  1VYF A;  1G90 A;  2MNH A;  2OF8 A;  5B10 O;  4OMW A;  3ZW1 B;  1SWK A;  4Y59 A;  1LFO A;  3AAE A;  2MJI A;  3AA1 A;  2RA6 A;  1BSY A;  3I0A A;  1A2D A;  1HQP A;  3LK2 B;  3FEP A;  1KT6 A;  5C0N A;  2NNE A;  1W6F A;  1TOW A;  3SLJ A;  3ZW0 B;  2E4J A;  3BSZ E;  2BC3 A;  4GKC A;  1LDO A;  1QJ8 A;  1SXW A;  1LID A;  1JQP A;  3RKG A;  5FQ7 E;  3VY9 X;  3VG2 A;  6PRN A;  1SMP I;  3PED A;  1RXJ A;  2OFB A;  3C5O A;  3AEH A;  2QCB A;  1BXW A;  5L8I A;  4QRL A;  3WJG A;  1SRE A;  4YGG A;  2R4L A;  2CBR A;  4MVI A;  4CK4 A;  3WJC A;  1KL5 A;  1L6M A;  3EBK A;  4QNI A;  4IBA A;  1DC9 A;  2JW1 A;  1Y0G A;  4QGX A;  1BT9 A;  3K3L A;  2QM9 A;  3FDC A;  4IRW A;  2FRS A;  1ZND A;  1GT1 A;  2AT5 X;  5FEN A;  1MX8 A;  2HLV A;  1IZN B;  1SWT A;  1U0X A;  5CE4 A;  4I3C A;  2F1T A;  3RSW A;  4EQA C;  2M07 A;  2OY1 O;  3BU1 A;  4YCH A;  5AEO A;  3FR2 A;  2WEW A;  1KT7 A;  2KXP B;  2R4N A;  1SRF A;  2KD2 A;  2Y3E A;  2IZE B;  1E06 A;  4LKT A;  2MM3 A;  2PI3 O;  2KDY A;  1W5R A;  3ZUI A;  1VYG A;  2X32 A;  3QKG A;  4GCQ A;  2Q2P A;  4CPI A;  4ODD A;  1T68 X;  4NW4 A;  4FES A;  1OSM A;  1HXT A;  1ERX A;  3TGA A;  2R73 A;  4FT6 A;  4D64 A;  5K67 A;  5H9A A;  1RBP A;  1VWD B;  3SZD A;  2I5V O;  5H9K A;  1JIW I;  1YWC A;  4XME A;  1JZU A;  2RCQ A;  5LJH A;  4GJS A;  3IFB A;  1ERB A;  3RZY A;  4U3Q A;  2CM4 A;  1QJ9 A;  4N74 A;  4GHB A;  2AL0 X;  2R89 A;  5GTH O;  2OVA A;  3DZM A;  2BS5 A;  2RTM A;  4Z3T A;  1I04 A;  3T0S A;  2POR A;  4ZHG A;  4Z28 A;  4GGT A;  3PQS A;  3VY8 X;  2IZG B;  2Y0L A;  1E02 A;  2Q2M A;  3HOL A;  2KZ7 A;  4FRX A;  2L9C A;  2KW1 A;  2HKD A;  3D4R A;  4HFO A;  5HA0 A;  1PM1 X;  4GRJ A;  4I3B A;  5HCE C;  3FR4 A;  4KH8 A;  4WHI A;  1R0U A;  3PGS A;  4PR7 A;  3HWD A;  1MOY A;  3RDX A;  4ZFX A;  3NAD A;  4AZN A;  4XNK A;  1Y52 X;  1RAV A;  4IMN A;  4L1N A;  2WWP A;  1AVE A;  4AYI D;  3H3I A;  1P6P A;  2GE4 A;  1ZNG A;  2RTN B;  2AH7 X;  3CBC A;  3NJT A;  3TGC A;  4MVK A;  2F1C X;  4CSB A;  4BX6 A;  4XMH A;  3C76 X;  3WJF A;  3KZI O;  2W2B A;  1MM4 A;  3Q34 A;  5B5G A;  4U8U M;  2RTB B;  2EU7 X;  5HTD A;  2J1N A;  4FZM A;  4ZR2 A;  2LHF A;  1BRQ A;  4ML7 B;  3SZJ A;  5F6B A;  4RJX A;  2FS6 A;  2XE5 A;  3BLG A;  3FA8 A;  4YCE A;  1MX7 A;  1GFO A;  4IAW A;  3PEC A;  2QO5 A;  5HA1 A;  4YDB A;  4TQ2 A;  4UU3 A;  3AA6 B;  1JMX A;  4FOZ A;  4XMG A;  4FBV A;  1JYJ A;  2RTA A;  4CDC A;  2X8T A;  3VE2 A;  1ICN A;  1N7Y A;  4BBO A;  4GNW A;  4OS0 A;  1SWQ A;  4IB7 A;  4HPB A;  4ALO A;  4KT5 A;  1G74 A;  3JS1 A;  1STS B;  4A1Y A;  1EIO A;  2FS7 A;  1CBR A;  2ODJ A;  1SWO A;  2O62 A;  1QWD A;  3ZQ3 A;  1DFV A;  4IAX A;  1QFT A;  1JV4 A;  4NV8 A;  3P6G A;  3PK2 A;  4QZT A;  1UZ2 X;  1VWK B;  2A3F X;  4N58 A;  3FA7 A;  5LKE A;  4XMF A;  1THQ A;  1U17 A;  1T1L A;  4C4V A;  3RE5 A;  2WSJ A;  2IZJ A;  5F7G A;  1LIE A;  2HYS A;  3ZWE A;  2Z4I A;  4ORS A;  2GTL M;  3VU1 A;  3U0D A;  1IJ8 A;  3KFF A;  2A5C A;  4GJV A;  2IZA A;  2JN3 A;  5D8J A;  4BCS A;  3D97 A;  1G7N A;  4D65 A;  5HZQ A;  5LJG A;  2FGQ X;  4YH0 A;  3HK1 A;  4MEE A;  2AT0 X;  4C69 X;  2Y0K A;  1Y53 X;  1AEL A;  3NQK A;  2LBA A;  4LKP A;  5F2B A;  1VWA B;  3NP1 A;  1DF3 A;  3B2I A;  3TZS A;  3LK4 2;  3WVM A;  5KAF O;  1BRP A;  1ZHY A;  4OEM A;  3UPG A;  4KR8 A;  3UU2 A;  1ADL A;  4EFG A;  2IZK A;  4PUX A;  4WBK A;  1YS5 A;  1NP1 A;  4U8U N;  2AT8 X;  1T16 A;  4C5P A;  1LDQ A;  2LFO A;  3FA9 A;  2OVD A;  1PMP A;  2OYB O;  1NQN A;  1JJU A;  4G75 A;  1DZP A;  4ZCB A;  1NBX A;  1E5P A;  1N9M A;  3AA7 A;  1VWH B;  1SLE B;  2OVS A;  1OEJ A;  3PGR A;  1LUQ A;  4KC8 A;  1B56 A;  3APW A;  5LJB A;  1BM5 A;  2JU7 A;  4M6S A;  3B2H A;  1T8V A;  5BYP A;  1SXX A;  4IAB A;  2FLJ A;  1HXL A;  4PSQ A;  4LSF A;  1QY0 A;  5G39 A;  1QG5 A;  2W81 C;  2QOS C;  3SZH A;  4FZL A;  2J4U P;  3ELX A;  4KC7 A;  1STR B;  1O1U A;  4YVB A;  2QOM A;  4E1S A;  3BS0 A;  2K0L A;  3C78 X;  2AVI A;  4Y0S A;  4U46 A;  2XE1 A;  2RTR B;  1YWB A;  4BOE A;  1PTS A;  1QFV A;  3BRY A;  1GT3 A;  4JHQ A;  1A57 A;  3RDQ A;  4N7D A;  4YGZ A;  4ORR A;  1SWD A;  1KT3 A;  3FIQ A;  4RLC A;  3SYB A;  1YUP A;  3MG5 A;  4ZJ0 A;  3ZW1 A;  1AVD A;  2GTL N;  3TF6 A;  1DZM A;  2FTB A;  1OBU A;  1NC9 A;  1VWB B;  1YP6 A;  2G7B A;  4IB9 A;  3LK2 A;  1MDC A;  2X8F A;  2UZ2 A;  3WU2 O;  3ZW0 A;  2OL7 A;  1GT4 A;  4RUU A;  2ERV A;  4BGF A;  2RTQ B;  1SWR A;  2IZF B;  4ZHD A;  3CBS A;  1EPB A;  1QY1 A;  3SY9 A;  4I60 A;  5KAI O;  2FHL A;  1VWC B;  4RL9 A;  3HWB A;  2OY7 A;  3GAQ A;  2PY1 A;  1JYD A;  5GV0 A;  5H2F O;  4AYD C;  3HOE A;  1LEL A;  5G38 A;  4QGV A;  4AZP A;  4YFP A;  4TKH A;  3T2W A;  1Q9F A;  2BS6 A;  3EMN X;  2YPV A;  3HW9 A;  1K3B A;  1B4M A;  1HXU A;  1HMT A;  1A18 A;  2VDF A;  1CBQ A;  1VWP B;  1Y9T A;  1IZN A;  4ARH A;  1YWA A;  2IZL B;  2RCT A;  2CBS A;  4OS3 A;  1SLF B;  3F8A A;  3UAQ A;  4DQ3 A;  4QYN A;  4A1H A;  2KXP A;  1GGL A;  4GCP A;  5DG4 A;  2N2M A;  3HWF A;  3O19 A;  4BVM A;  5H9L A;  4YDA A;  2QO6 A;  3ELZ A;  4AKM A;  4MIR A;  1UYO X;  1URE A;  3MBT A;  4GUZ A;  1OPF A;  1SWC A;  1Y55 X;  2FR2 A;  1BBP A;  4CDF A;  4YFR A;  4QYP A;  2PRN A;  2DJG A;  1KQW A;  1K24 A;  2RD7 C;  5DPQ A;  1D3S A;  3T6F A;  4YGH A;  3RWX A;  2MHL A;  4KII A;  5AFU K;  1DF8 A;  1RXK A;  1WBI A;  2F09 A;  2F73 A;  2YG2 A;  3HWG A;  3MVF A;  3SAO A;  1KT4 A;  1ZNH A;  3CR6 A;  4ZH9 A;  5H8T A;  1TW4 A;  1QQS A;  5B29 A;  3G7X A;  3WZQ A;  5F1E A;  2LA7 A;  3QRA A;  4NYR A;  4MIS A;  1KGL A;  4AW8 A;  1OEE A;  4Y0P A;  4AKR B;  1PEE A;  1U18 A;  1GX8 A;  1OSP O;  2IZH B;  3DSZ A;  1GFQ A;  4Z2P A;  1ZHZ A;  1N43 A;  1VWG B;  4AZO A;  1N4J A;  2Y3F A;  5EZ2 A;  5AJC A;  1PHO A;  2L67 A;  4OMX A;  5LJE A;  4QZU A;  4GD9 A;  1FEM A;  1MPF A;  1FEL A;  3RBH A;  1NGL A;  3STM X;  3A2S X;  4ES7 A;  2QTK A;  2R4P A;  1VWI B;  3I17 A;  2G78 A;  4ORX A;  3NBX X;  4CTD A;  2F01 A;  3FA6 A;  3NX1 A;  5DL6 A;  3POU A;  4E1T A;  1QY2 A;  3V8U A;  4Y0R A;  3KFG A;  1CJ5 A;  4DQ4 A;  4FQE A;  1IFC A;  4GH7 A;  3BY0 A;  4AUI A;  1LCZ A;  1SWU A;  1DV9 A;  1CRB A;  5JR8 A;  5ADX K;  1A3Y A;  1I06 A;  3P6F A;  5CHK A;  1AVG I;  5KID A;  2IZD B;  1GFP A;  3DWO X;  1DZJ A;  2X34 A;  1VWF B;  4INN A;  3AA0 B;  2JQY A;  4YKM A;  2WJQ A;  4QAE A;  4NP1 A;  3WZN A;  5B3M O;  3AA6 A;  1JJX A;  3RE6 A;  1ZHW A;  1LKE A;  3WJB A;  1CBI A;  3FR5 A;  4GDA A;  3EM0 A;  4GNY A;  1WUB A;  1SLG B;  1GKA B;  1S7D A;  5JD2 A;  1KZW A;  3PH5 A;  4AYM C;  5FFH A;  1ALB A;  4DNE A;  5F58 A;  4IL6 O;  4CPF A;  1EQD A;  3APU A;  3U9P C;  1SWP A;  1FEN A;  2A13 A;  4CDE A;  2WR6 A;  3AAA B;  2A8G A;  1H91 A;  3CWK A;  3WXQ A;  4ORU A;  5IRA A;  4FMS A;  2X9K A;  3G7G A;  1SWJ A;  2OF9 A;  2YNK A;  1E2T A;  4AYE C;  4FRT A;  3VG4 A;  4LQZ A;  1GX3 A;  4HPD A;  4GU8 A;  3CKF A;  1SWE A;  3P6C A;  2Q9S A;  2FR3 A;  1SRI A;  4ZHC A;  1HXZ A;  2M06 A;  4Z2V A;  2X46 A;  3FMZ A;  4O3W A;  2FT9 A;  1LIC A;  2A2U A;  3B2K A;  5HZ6 A;  4N75 A;  1KL3 A;  4LSE A;  3KFI A;  5EE2 A;  4U8U O;  1X71 A;  1IIU A;  4YMY A;  4ON1 A;  2X56 A;  3PF1 A;  5EED A;  3HPE A;  3S5V A;  3OBL A;  4M7M A;  3HTY A;  4XMD A;  2IZB A;  1KT5 A;  4UU2 A;  3OE3 A;  5HZ5 A;  3UEV A;  1SWA A;  5PRN A;  4NLJ A;  5B5F A;  2MHD A;  2RTO B;  4FQB B;  3KVN A;  3NR3 A;  3JCU O;  2WQ9 A;  5AQ6 A;  1SWG A;  2OFM X;  2IFB A;  1H6S 1;  2OL8 O;  4JFB A;  2RTJ A;  5D45 A;  2RN4 A;  2ANS A;  2N2L A;  5FQ8 E;  5CSE A;  4KR4 A;  2DJF A;  3T20 A;  3LK3 B;  2VFB A;  4GK9 A;  1X8N A;  3E3C A;  3K19 A;  4FBO A;  3LK4 1;  3VE1 A;  1SY2 A;  4WFU A;  2X27 X;  3QRC A;  3FW4 A;  4A60 A;  4PJ2 A;  2FKG A;  5E79 O;  3VG6 A;  2OFA A;  1SWL A;  3A0H O;  4BX5 B;  2Y7S A;  1NQM A;  3FW5 A;  1BJ7 A;  3BDR A;  1VWJ B;  4YBU A;  3WZP A;  2I5Z O;  1NDJ A;  2IZI A;  3U03 A;  4TKJ A;  1N0S A;  4I6S A;  3RY2 A;  1LIF A;  2RTK A;  2X8S A;  1O1V A;  1KZX A;  1LPJ A;  3X00 A;  4NNS A;  3ZUO A;  5KIC A;  5AFU L;  3O0E A;  1LIB A;  2G5L A;  4AZL A;  3SLT A;  1HMR A;  3ZI8 A;  3SZV A;  1I9H A;  2AKQ A;  4AFK A;  3RDO A;  1S5L O;  5EPQ A;  4IB6 A;  2WUT A;  2NND A;  3VZT X;  5LJK A;  5HZ9 A;  2VFC A;  1OBP A;  1SWS A;  4QGW A;  3LV4 A;  1BWY A;  1GFM A;  3VG5 A;  2OZQ A;  1W4T A;  3VHH A;  4AZM A;  3TZG A;  1LCV A;  1VWE B;  3MX7 A;  2RTH B;  2QO4 A;  5HBS A;  1STP A;  4I95 A;  1PBY A;  1Y9L A;  1E54 A;  2W2F A;  2ZLD A;  2RTD B;  1AQB A;  3NQ3 A;  3CMP A;  2X45 A;  3EMM A;  1IW2 A;  1SA8 A;  2MO5 A;  2CAM A;  4U9C A;  3ZZV A;  1SRH A;  4ALB A;  2BT9 A;  1FTP A;  1ZNL A;  1KL4 A;  2RTI B;  3S60 A;  1X8Q A;  4TJZ A;  1B8E A;  1RLB E;  5FAZ A;  3SLO A; 
#chains in the Genus database with same CATH homology
 3FEK A;  3H3I A;  1P6P A;  2GE4 A;  1ZNG A;  1KQW A;  1Z24 A;  2FWV A;  2RD7 C;  5EDB A;  5DPQ A;  1TVQ A;  2KTS A;  2AH7 X;  3P6E A;  5ADX L;  4O9S A;  3CBC A;  1D3S A;  3P02 A;  2JMM A;  3TGC A;  4MVK A;  1E00 A;  4YGH A;  3RWX A;  1HBP A;  4CSB A;  4KII A;  2MHL A;  7PRN A;  5AFU K;  1YP7 A;  4XMH A;  2Y0H A;  1SXU A;  2YG2 A;  2F73 A;  2F09 A;  3C76 X;  3HWG A;  1EUO A;  3MVF A;  3SAO A;  3WJF A;  1KT4 A;  1ZNH A;  2W2B A;  3AA1 A;  3CR6 A;  3T1D A;  3BX7 A;  3STN A;  4COT A;  3WI4 A;  4AYN A;  5LKF A;  3F9D A;  4LZV A;  4ZH9 A;  5H8T A;  1MM4 A;  1TW4 A;  5IYU A;  1QQS A;  1ZNK A;  1ORM A;  4U8U M;  5B29 A;  2GTL O;  1SY3 A;  4ORY A;  2EU7 X;  3G7X A;  4L3R A;  4MVE A;  1JBH A;  2AMM X;  5HTD A;  3CQN A;  2J1N A;  4FZM A;  5F1E A;  5DL7 A;  4ZR2 A;  4O4O A;  5LJD A;  4RUN A;  2BLG A;  1BLR A;  2LHF A;  1BRQ A;  4E1S A;  5H9N A;  4ML7 B;  3Q6L A;  5D4A A;  3T24 A;  2LA7 A;  5F6B A;  5L8N A;  3QRA A;  4O4S A;  2ACP X;  4NYR A;  4RJX A;  1GXA A;  2CZT A;  2FS6 A;  4MIS A;  2XE5 A;  3EYC A;  1KGL A;  3OJY C;  1YIV A;  4OS8 A;  1ZHT A;  3WBG A;  3FLL A;  4HPA A;  4LZU A;  4AW8 A;  1OEE A;  3BLG A;  2XE2 A;  2L5P A;  2DM5 A;  3FA8 A;  4Y0P A;  4YCE A;  4AKR B;  2GTF X;  1MX7 A;  3PQU A;  1U18 A;  1GX8 A;  1PEE A;  3DSZ A;  1GFO A;  1IKJ A;  4Y0Q A;  5B27 A;  4IAW A;  3PEC A;  1GFQ A;  2QO5 A;  2GC9 A;  5HA1 A;  4AZO A;  4YDB A;  4TQ2 A;  4UU3 A;  3AA6 B;  1QJP A;  4I9R A;  2CM9 A;  2GJ5 A;  4FOZ A;  4XMG A;  1P4T A;  3S26 A;  3WJD A;  5FVN A;  4FBV A;  1JYJ A;  4TLJ A;  5EZ2 A;  5AJC A;  4ZHF A;  3BS2 A;  3BX8 A;  1PHO A;  2L67 A;  4G76 A;  1MVG A;  3POQ A;  4OMX A;  2HMB A;  5LJE A;  2X8T A;  1SXY A;  4QZU A;  4BQU A;  1FEM A;  3VE2 A;  1ICN A;  5JDP A;  1MPF A;  1TOU A;  1FEL A;  3KQ0 A;  1I4U A;  3RBH A;  4GNW A;  4OS0 A;  4IB7 A;  3ZW2 A;  1ZRY A;  1NGL A;  2JMB A;  3PH6 A;  4HPB A;  3STM X;  4ES7 A;  3A2S X;  3UEU A;  4ALO A;  2QTK A;  3SY7 A;  4AYI D;  1PBO A;  2AT3 X;  4KT5 A;  3N91 A;  5IO7 A;  1G74 A;  3JS1 A;  4O49 A;  2XG6 A;  3D95 A;  2WEX A;  2HZQ A;  2YMS A;  3I17 A;  4A1Y A;  3S5X A;  4K19 A;  1EIO A;  2G78 A;  2FS7 A;  3NBX X;  4ORX A;  3FA6 A;  1KXO A;  2Z4H A;  1CBR A;  1EXS A;  2A0A A;  3JSQ A;  3NX1 A;  4GE1 A;  2ODJ A;  3POU A;  2O62 A;  5DL6 A;  4E1T A;  1HXX A;  1QWD A;  4QQ1 A;  3PP6 A;  1ACD A;  1QY2 A;  4N7C A;  3V8U A;  1DFV A;  3ZQ3 A;  4Y0R A;  4IAX A;  1ML7 A;  1QFT A;  4AZQ A;  2G79 A;  4KRA A;  1JV4 A;  2HNX A;  3P6G A;  2F1V A;  3C77 X;  3KFG A;  1CJ5 A;  5EEE A;  4QZT A;  4DQ4 A;  1GFN A;  4A8Z A;  1UZ2 X;  2A3F X;  1IFC A;  3L4R A;  4GH7 A;  3BY0 A;  4HPC A;  3TGB A;  4N58 A;  5K06 A;  4AUI A;  1OEK A;  3FA7 A;  1DV9 A;  1CRB A;  3KFH A;  3O2Y A;  2ASN X;  1T0V A;  3DTQ A;  4O3Y A;  1A3Y A;  5JR8 A;  5LKE A;  2W80 C;  1OPA A;  3GP6 A;  1I06 A;  5ADX K;  3P6F A;  1SY0 A;  4XMF A;  1THQ A;  2XST A;  1BSO A;  1U17 A;  5DL5 A;  1AVG I;  5KID A;  2WSJ A;  4HWM A;  5F7G A;  1GFP A;  1LIE A;  5G26 A;  4WFV A;  1CBS A;  1DZJ A;  2HYS A;  1EI5 A;  3ZWE A;  2Z4I A;  4ORS A;  2GTL M;  3VU1 A;  3NPO A;  2ZAI A;  4EXZ A;  4AKR A;  3U0D A;  4AYH A;  4INN A;  5HCC C;  3AA0 B;  2JU3 A;  4YKM A;  4QAE A;  4NP1 A;  4YFQ A;  3KFF A;  2ZFG A;  3AA6 A;  2JN3 A;  1JJX A;  2O4V A;  1DZK A;  5D8J A;  1D2U A;  1ZHW A;  3D97 A;  1G7N A;  1LKE A;  3WJB A;  1XKI A;  4FSO A;  1G5W A;  1YWD A;  3STK A;  1CBI A;  3FR5 A;  4D65 A;  5HZQ A;  2BHV A;  5LJG A;  3UEX A;  3AA7 B;  4I3D A;  2MWH A;  3GE2 A;  4YH0 A;  2FGQ X;  1EII A;  3HK1 A;  3EM0 A;  4GNY A;  3WOV A;  3AAE B;  2AT0 X;  3AKN A;  1EPA A;  1LF7 A;  4C69 X;  1GKA B;  5L8O A;  3AA1 B;  2Y0K A;  1S7D A;  2K62 A;  3UEW A;  2LBV A;  4IB8 A;  3F6Z B;  1BEB A;  1AEL A;  3NQK A;  1AB0 A;  2LBA A;  4LKP A;  5EDC A;  4ORW A;  3PH5 A;  1KZW A;  3DA3 A;  4AYM C;  5FFH A;  1ALB A;  3NQ9 A;  4GET A;  4TNN A;  2K4T A;  3NP1 A;  4YBP A;  4GF4 A;  3VG3 A;  3WI5 A;  1DF3 A;  3B2I A;  5F58 A;  4XMC A;  3TZS A;  3LK4 2;  3WVM A;  2JU8 A;  1BRP A;  2LB6 A;  1EQD A;  5D48 A;  3APU A;  4NNT A;  3U9P C;  1ZHY A;  1TXL A;  2L68 A;  3UPG A;  1FEN A;  4KR8 A;  2A13 A;  1OPB A;  1X8P A;  3UU2 A;  2W2A A;  1ADL A;  2WR6 A;  1HMS A;  2ZAG A;  3O22 A;  1KQX A;  3RBY A;  3AAA B;  1X89 A;  1H91 A;  3CWK A;  4EFG A;  3WXQ A;  3VG7 A;  4ORU A;  2XKL A;  4RJW A;  3D96 A;  4IMO A;  4FMS A;  3G7G A;  4PUX A;  1ZHZ A;  4WBK A;  1YS5 A;  2CZU A;  1NP1 A;  3BRN A;  2YNK A;  4AZR A;  4AYE C;  3FEN A;  4FRT A;  3VG4 A;  4NLI A;  4KC8 A;  1HBQ A;  4O3X B;  4U8U N;  1MUP A;  4LQZ A;  5DL8 A;  2AT8 X;  2KC0 A;  4HPD A;  4GU8 A;  3VZU X;  3P6C A;  1G85 A;  3IA8 A;  2Q9S A;  4I9S A;  1QAB E;  2LFO A;  2NP1 A;  3NX2 A;  3FA9 A;  2FR3 A;  2OVD A;  4O4U A;  5D47 A;  4RLB A;  3HWE A;  1ZHX A;  1PMP A;  4ZHC A;  2M06 A;  3AA0 A;  1ZNE A;  3SYS A;  1VYF A;  1G90 A;  2X46 A;  2MNH A;  3FMZ A;  4O3W A;  4G75 A;  2OFR X;  1DZP A;  1IFB A;  2FT9 A;  1LIC A;  4OMW A;  4KCA A;  4ZCB A;  5IO5 A;  2A2U A;  3B2K A;  5HZ6 A;  3ZW1 B;  4MVL A;  5HWZ A;  1E5P A;  3AA7 A;  4LSE A;  3KFI A;  5EE2 A;  4U8U O;  5BVS A;  1LFO A;  2A2G A;  2AT6 X;  1X71 A;  1IIU A;  4YMY A;  1I05 A;  1GX9 A;  1SY1 A;  4ON1 A;  2R56 A;  3AAE A;  2OVS A;  1OEJ A;  3VPJ E;  5EED A;  1B56 A;  1X8O A;  2MJI A;  1GKA A;  3APW A;  3P6H A;  2HZR A;  1BSY A;  2RA6 A;  3I0A A;  3S5V A;  5LJB A;  2OMF A;  1A2D A;  1BM5 A;  1HQP A;  3LK2 B;  3FEP A;  2JU7 A;  3OBL A;  1KT6 A;  4JGL A;  4M7M A;  4M6S A;  3HTY A;  3B2J A;  3B2H A;  4XMD A;  5C0N A;  2NNE A;  4ZGF A;  1TOW A;  1T8V A;  5BYP A;  1SXX A;  3ZW0 B;  1BSQ A;  2E4J A;  4IAB A;  4ZHH A;  3BSZ E;  1KT5 A;  2FLJ A;  4GKC A;  4UU2 A;  3OE3 A;  5HZ5 A;  5IO6 A;  4PSQ A;  3UEV A;  4CV7 A;  1SXW A;  1QJ8 A;  4LSF A;  1LID A;  1QY0 A;  4NLJ A;  5PRN A;  2MHD A;  4LSH A;  3RKG A;  1QG5 A;  4FQB B;  1JJJ A;  2NNQ A;  5FQ7 E;  2W81 C;  3VY9 X;  1NP4 A;  2QOS C;  3NR3 A;  3VG2 A;  4FZL A;  6PRN A;  3AAA A;  2J4U P;  1SMP I;  3ELX A;  3PED A;  5LJC A;  4KC7 A;  4GCS A;  5HCD C;  1O1U A;  3C5O A;  3NSG A;  3DA4 A;  1BXW A;  5HTE A;  2N93 A;  2WQ9 A;  4QRL A;  5L8I A;  2K0L A;  3POR A;  4BUM X;  5AQ6 A;  3WJG A;  1OBQ A;  4YGG A;  3C78 X;  2CBR A;  4Y0S A;  3SOT A;  2OFM X;  3FYX A;  2IFB A;  1H6S 1;  4JFB A;  2XE1 A;  4D6A A;  5D45 A;  1YWB A;  2RN4 A;  1VPR A;  4BOE A;  2ANS A;  4CK4 A;  2N2L A;  5FQ8 E;  3PRN A;  3WJC A;  4FBR A;  2FGR A;  1QFV A;  1L6M A;  3EBK A;  1GT3 A;  4QNI A;  1S2P A;  4IBA A;  4B61 A;  4D6B A;  1DC9 A;  2JW1 A;  4QGX A;  1A57 A;  4XNL A;  1BT9 A;  4N7D A;  3K3L A;  4YGZ A;  4ORR A;  4KR4 A;  1KT3 A;  2QM9 A;  3FIQ A;  5KHP A;  3T20 A;  4RLC A;  3SYB A;  3LK3 B;  1YUP A;  4GK9 A;  1X8N A;  1B0O A;  3E3C A;  4ZH6 A;  3K19 A;  2FRS A;  2LKK A;  4ZJ0 A;  2XE3 A;  3BU9 A;  1ZND A;  1GT1 A;  4FBO A;  3ZW1 A;  3LK4 1;  2GTL N;  3VE1 A;  4ZGU A;  1SY2 A;  3TF6 A;  2AT5 X;  4WFU A;  1DZM A;  2X27 X;  2FTB A;  1OBU A;  5FEN A;  3QRC A;  1MX8 A;  2HLV A;  1IZN B;  1U0X A;  3CQR A;  5CE4 A;  3FW4 A;  4I3C A;  4A60 A;  4PJ2 A;  1YP6 A;  2G7B A;  3VG6 A;  2F1T A;  4IB9 A;  3RSW A;  3LK2 A;  4EQA C;  4FGI B;  1MDC A;  5BVT A;  2X8F A;  2Y7S A;  2M07 A;  1ICM A;  1GT5 A;  3FW5 A;  3BU1 A;  4YCH A;  2KT4 B;  1BJ7 A;  3FR2 A;  5AEO A;  2WEW A;  2XTR A;  1KT7 A;  3ZW0 A;  1GM6 A;  4F4B A;  4ID2 A;  5FQ6 E;  2KXP B;  3VZW X;  3BDR A;  5CYB A;  1GT4 A;  2KD2 A;  3EBW A;  4RUU A;  4YBU A;  2ERV A;  1E06 A;  2KZ7 B;  4LKT A;  2LFU A;  4LSI A;  4ZHD A;  2MM3 A;  5HZ8 A;  3CBS A;  1EPB A;  3ZUI A;  1BH3 A;  2KDY A;  1VYG A;  2WQA E;  3QKG A;  3U03 A;  4GCQ A;  4TKJ A;  1QY1 A;  4FUV A;  2KTD A;  1N0S A;  4I6S A;  3SY9 A;  1LIF A;  2Q2P A;  4ODD A;  2X8S A;  3B2L A;  1S44 A;  1T68 X;  4RL9 A;  1O1V A;  3HWB A;  4NW4 A;  2JOZ A;  1KZX A;  1OSM A;  4FES A;  4O3Z A;  1HXT A;  2Q4N A;  3GAQ A;  1LPJ A;  2K23 A;  4NNS A;  3ZUO A;  1ERX A;  5F6Z A;  1HN2 A;  2R73 A;  3TGA A;  5KIC A;  3O0E A;  2PY1 A;  1JYD A;  5AFU L;  1LIB A;  3P24 A;  5GV0 A;  4FT6 A;  4D64 A;  3AKM A;  4EDE A;  4AZL A;  4AYD C;  4EEJ A;  3HOE A;  4R0B A;  5H9A A;  1RBP A;  4YKO A;  3POX A;  4GZV A;  3SZD A;  1HMR A;  3ZI8 A;  3SZV A;  3KZA A;  4QGV A;  4AZP A;  2OVE A;  1O8V A;  4YFP A;  5HAE A;  4TKH A;  2ALL X;  2AKQ A;  5H9K A;  1JIW I;  4AFK A;  1YWC A;  4XME A;  1JZU A;  1Q9F A;  1XCA A;  5EPQ A;  2BS6 A;  4IB6 A;  2RCQ A;  3EMN X;  5D5D A;  2WUT A;  2NND A;  3VZT X;  5LJH A;  2YPV A;  3HW9 A;  4O4X A;  5LJK A;  5HZ9 A;  1B4M A;  3IFB A;  1ERB A;  1HXU A;  1HMT A;  1X8U A;  1A18 A;  1OBP A;  3LK3 A;  2PRN A;  4QGW A;  3OD9 A;  3RZY A;  4U3Q A;  1EAL A;  2CM4 A;  1QJ9 A;  3JTY A;  1CBQ A;  3LV4 A;  4D5U A;  4GHB A;  2AL0 X;  2OVA A;  1BWY A;  4FZN A;  1Y9T A;  1IZN A;  2BS5 A;  5BVQ A;  4ARH A;  2Q39 A;  1GFM A;  3VG5 A;  4Z3T A;  2OZQ A;  3APX A;  1YWA A;  1EW3 A;  1I04 A;  2RCT A;  2CBS A;  3PPT A;  3T0S A;  2POR A;  2POA A;  4AZM A;  3TZG A;  4ZHG A;  4JCH A;  4OS3 A;  2M4L A;  3MX7 A;  1PRN A;  1FDQ A;  3F8A A;  2QO4 A;  4NYQ A;  3UAQ A;  4DQ3 A;  3KVD D;  4QYN A;  2QMI A;  3PQS A;  3VY8 X;  2ACO A;  5HBS A;  4A1H A;  2KXP A;  2Y2X A;  2Y0L A;  4I95 A;  1E02 A;  1IKE A;  4N59 A;  3JQO A;  1GGL A;  4GCP A;  2Q2M A;  1Y9L A;  3HOL A;  2KZ7 A;  1E54 A;  2W2F A;  2XTQ A;  2ZLD A;  1KOI A;  4FRX A;  1AQB A;  5DG4 A;  4FSP A;  3NQ3 A;  1MM5 A;  2P8G A;  1Q9G A;  2L9C A;  3CMP A;  2X45 A;  3EMM A;  2KW1 A;  2N2M A;  3HWF A;  3D4R A;  1IW2 A;  3O19 A;  4BVM A;  1SA8 A;  2MO5 A;  4HFO A;  5H9L A;  4YDA A;  5HA0 A;  2QO6 A;  1PM1 X;  4GRJ A;  4U9C A;  3ELZ A;  4I3B A;  5HCE C;  4AKM A;  3ZZV A;  4MIR A;  2XMX A;  3FR4 A;  4ALB A;  2RQ0 A;  1URE A;  3MBT A;  4KH8 A;  4WHI A;  3WJE A;  1R0U A;  2BT9 A;  3FEL A;  5T5F A;  3APV A;  1FTP A;  1ZNL A;  2R74 A;  1OPF A;  1LNM A;  4GDZ A;  3HWD A;  4ZFX A;  3NAD A;  2FR2 A;  1BBP A;  3FYF A;  4TKB A;  4AZN A;  8PRN A;  3S60 A;  1X8Q A;  3LHN A;  4QYP A;  4YFR A;  4XNK A;  1FE3 A;  4IMN A;  4L1N A;  4TJZ A;  1B8E A;  1RLB E;  2WWP A;  5AJB A;  3P6D A;  5FAZ A;  4MVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...