2O4VA

An arginine ladder in oprp mediates phosphate specific transfer across the outer membrane
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
411
structure length
411
Chain Sequence
GTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYGRFDGYYTNNGNTADAAYFRRAYLEFGGTAYRDWKYQINYDLSRNVGNDSAGYFDEASVTYTGFNPVNLKFGRFYTDFGLEKATSSKWVTALERNLTYDIADWVNDNVGTGIQASSVVGGMAFLSGSVFSENNNDTDGDSVKRYNLRGVFAPLHEPGNVVHLGLQYAYRDLEDSAVDTRIRPRMGMRGVSTNGGNDAGSNGNRGLFGGSSAVEGLWKDDSVWGLEGAWALGAFSAQAEYLRRTVKAERDREDLKASGYYAQLAYTLTGEPRLYKLDGAKFDTIKPENKEIGAWELFYRYDSIKVEDDNIVVDSATREVGDAKGKTHTLGVNWYANEAVKVSANYVKAKTDKISNANGDDSGDGLVMRLQYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porin P
publication title An arginine ladder in OprP mediates phosphate-specific transfer across the outer membrane.
pubmed doi rcsb
molecule tags Membrane protein
total genus 116
structure length 411
sequence length 411
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2o4vA00
3VZWX 4KR4A 2FGQX 3A2SX 2OMFA 3HWBA 3T0SA 3VZTX 1PHOA 3WI5A 1GFQA 1OSMA 1GFMA 2XE2A 3SY7A 3VY9X 4D5UA 2ODJA 2J1NA 4C69X 2FGRA 1HXXA 3SZDA 4FT6A 8PRNA 3T20A 2QTKA 1H6S1 1MPFA 4JFBA 3K19A 2PRNA 5FVNA 5DL6A 3FYXA 7PRNA 3JTYA 3PRNA 2J4UP 3NSGA 3UPGA 3VY8X 1OPFA 4AUIA 1HXTA 1BH3A 3O0EA 1PRNA 4FRXA 3T24A 2Y0LA 2PORA 4FMSA 4RJWA 3HW9A 4LSFA 1E54A 4FSOA 4KR8A 5DL5A 4LSIA 2XE3A 3WI4A 2Y2XA 2XG6A 4GCPA 2O4VA 3POXA 3SYBA 5PRNA 3PORA 2XE5A 3VZUX 4LSHA 3POUA 4D65A 1GFOA 1GFPA 2K4TA 4GCSA 2Y0HA 5DL7A 5JDPA 3POQA 4FSPA 2ZLDA 3SY9A 4FOZA 4D64A 1GFNA 4FRTA 4LSEA 5DL8A 3UU2A 4GCQA 3EMNX 1BT9A 2ZFGA 2Y0KA 4BUMX 4KRAA 4RJXA 3SYSA 2XE1A 1HXUA 3SZVA 6PRNA
chains in the Genus database with same CATH superfamily
3VZWX 1ZHXA 4KR4A 4PUXA 2FGQX 1QJ8A 3PGSA 3WU2O 3A2SX 5B66O 2OMFA 3DWNA 3HWBA 4C4VA 2F1VA 3T0SA 2KXPA 2LFUA 3AAAA 3AA0A 3VZTX 1ORMA 4AKRB 1PHOA 3WI5A 3V8UA 2YPVA 1GFQA 4FESA 4UB8O 4AYEC 1QJPA 5T5FA 4N74A 1OSMA 1GFMA 2XE2A 3QRAA 4FZNA 2R88A 2R4LA 5GTHO 3SY7A 3QRCA 3VY9X 4D5UA 2ODJA 1Q9GA 2KDYA 2J1NA 3G7GA 4G76A 2LHFA 2JQYA 4N59A 3LK3A 2FGRA 5E79O 4C69X 3NJTA 2X27X 5KAFO 1HXXA 4AYDC 3VE1A 2KZ7B 3SZDA 4O3ZA 4FT6A 3A0BO 4JCHA 1T16A 5EE2A 2XTQA 4GF4A 8PRNA 4UB6O 4U9CA 1ZHTA 3T20A 4AKRA 2JMMA 2M07A 2QTKA 1H6S1 1MPFA 3AA1B 3DWOX 4JFBA 4FZMA 3K19A 2PRNA 3HOLA 2IWVA 2W80C 2N2LA 2R8AA 3DZMA 2R4PA 3DA3A 4O4XA 4GHBA 3LK41 5FVNA 5DL6A 3FYXA 7PRNA 4AYNA 5GV0A 2MNHA 2R4NA 3JTYA 3PRNA 4QQ1A 4CTDA 2J4UP 3PF1A 1MM4A 1THQA 4PJ0O 2KZ7A 3NSGA 3UPGA 3LK42 4RLBA 3VY8X 4G75A 1OPFA 2GE4A 4AUIA 1HXTA 4PR7A 1BH3A 1QJ9A 2XTRA 4FQEA 2YNKA 2WJRA 3O0EA 5ADXK 1ZHWA 3AA6A 1PRNA 2KC0A 3BRYA 4RLCA 3AA1A 5KAIO 2K0LA 4FRXA 3T24A 1ZHZA 2Y0LA 2ERVA 4FUVA 3RBHA 1IZNB 2PORA 4XNKA 4FMSA 4RJWA 3AA6B 3HW9A 5G26A 4E1SA 3UAQA 1MM5A 4LSFA 2F1CX 5AFUK 1G90A 3TZGA 1P4TA 3KZIO 1E54A 3AA7A 4FSOA 4KR8A 5DL5A 5G38A 4AKMA 2R89A 2XE3A 4LSIA 3WI4A 2X9KA 5ADXL 2MHLA 2IWWA 3AA7B 4C00A 2Y2XA 3PGUA 3PQUA 5AFUL 4AZLA 4F4BA 4O4UA 5G3AA 4FZLA 4B61A 2XG6A 4GCPA 2O4VA 3POXA 4N75A 3SYBA 5PRNA 4N58A 3PORA 3DA4A 3PQSA 2R4OA 2XE5A 3VZUX 2W81C 4LSHA 1IZNA 2AXTO 5D5DA 3POUA 4RL9A 4D65A 4O49A 3KVDD 1GFOA 3AAEB 3GP6A 3HOEA 1GFPA 2K4TA 4GCSA 4AYMC 4AYID 2Y0HA 5DL7A 2WJQA 3LK2B 4K3CA 5TISO 5IYUA 5JDPA 3PGRA 5GTIO 4O3XB 3POQA 3BS0A 4E1TA 1S5LO 4FSPA 4C4VB 2ZLDA 5H2FO 2N2MA 2M06A 4FOZA 2KXPB 3AAAB 3SY9A 2F1TA 1GFNA 3AA0B 4FRTA 1T1LA 4D64A 5B5EO 4O3WA 3VE2A 4O3YA 1Q9FA 2Y7SA 4AFKA 4Z3TA 3C5OA 4LSEA 5DL8A 5G39A 4GCQA 3UU2A 3EMNX 1BT9A 2ZFGA 3JCUO 3BRZA 4IL6O 1ZHYA 2XMXA 2Y0KA 3A0HO 4BUMX 4KRAA 4RJXA 3SYSA 3LK3B 4XNLA 2XE1A 1HXUA 3AAEA 1BXWA 1YS5A 3SZVA 2WVPA 3LK2A 4K3BA 6PRNA
chains in the Genus database with same CATH topology
3VZWX 1ZHXA 4KR4A 4PUXA 2FGQX 1QJ8A 3A2SX 2OMFA 3HWBA 2F1VA 3T0SA 2KXPA 2LFUA 3AAAA 3AA0A 3VZTX 1ORMA 4AKRB 1PHOA 3WI5A 3V8UA 2YPVA 1GFQA 4FESA 4AYEC 1QJPA 5T5FA 1OSMA 1GFMA 2XE2A 3QRAA 4FZNA 3SY7A 3QRCA 3VY9X 4D5UA 2ODJA 1Q9GA 2KDYA 2J1NA 3G7GA 4G76A 2LHFA 4N59A 4C69X 3LK3A 2FGRA 2X27X 1HXXA 4AYDC 3VE1A 2KZ7B 3SZDA 4O3ZA 4FT6A 4JCHA 5EE2A 2XTQA 4GF4A 8PRNA 4U9CA 1ZHTA 3T20A 4AKRA 2JMMA 2M07A 2QTKA 1H6S1 1MPFA 3AA1B 4JFBA 4FZMA 3K19A 2PRNA 3HOLA 2W80C 2N2LA 3DA3A 4O4XA 4GHBA 3LK41 5FVNA 5DL6A 3FYXA 7PRNA 4AYNA 5GV0A 2MNHA 3JTYA 4QQ1A 3PRNA 2J4UP 1MM4A 1THQA 2KZ7A 3NSGA 3UPGA 3LK42 4RLBA 3VY8X 4G75A 1OPFA 2GE4A 4AUIA 1HXTA 1BH3A 1QJ9A 2XTRA 5ADXK 2YNKA 3O0EA 1ZHWA 3AA6A 1PRNA 2KC0A 4RLCA 3AA1A 2K0LA 4FRXA 3T24A 1ZHZA 2Y0LA 2ERVA 4FUVA 3RBHA 1IZNB 2PORA 4XNKA 4FMSA 4RJWA 3AA6B 3HW9A 5G26A 4E1SA 3UAQA 1MM5A 4LSFA 5AFUK 1G90A 3TZGA 1P4TA 1E54A 3AA7A 4FSOA 4KR8A 5DL5A 4AKMA 4LSIA 2XE3A 3WI4A 5ADXL 2MHLA 3AA7B 2Y2XA 3PQUA 5AFUL 4AZLA 4F4BA 4O4UA 4FZLA 4B61A 2XG6A 4GCPA 2O4VA 3POXA 3SYBA 5PRNA 4N58A 3PORA 3DA4A 3PQSA 2XE5A 3VZUX 2W81C 4LSHA 1IZNA 5D5DA 3POUA 4RL9A 4D65A 4O49A 3KVDD 1GFOA 3AAEB 3GP6A 3HOEA 1GFPA 2K4TA 4GCSA 4AYMC 4AYID 2Y0HA 5DL7A 3LK2B 4E1TA 5IYUA 5JDPA 4O3XB 3POQA 4FSPA 2ZLDA 2N2MA 2M06A 4FOZA 2KXPB 3AAAB 3SY9A 2F1TA 1GFNA 3AA0B 4FRTA 4D64A 4O3WA 3VE2A 4O3YA 1Q9FA 2Y7SA 4AFKA 4Z3TA 3C5OA 4LSEA 5DL8A 3UU2A 4GCQA 3EMNX 1BT9A 2ZFGA 1ZHYA 2XMXA 2Y0KA 4BUMX 4KRAA 4RJXA 3SYSA 3LK3B 4XNLA 2XE1A 1HXUA 3AAEA 1BXWA 1YS5A 3SZVA 3LK2A 6PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VZW X;  4KR4 A;  2FGQ X;  3A2S X;  2OMF A;  3HWB A;  3T0S A;  3VZT X;  1PHO A;  3WI5 A;  1GFQ A;  1OSM A;  1GFM A;  2XE2 A;  3SY7 A;  3VY9 X;  4D5U A;  2ODJ A;  2J1N A;  4C69 X;  2FGR A;  1HXX A;  3SZD A;  4FT6 A;  8PRN A;  3T20 A;  2QTK A;  1H6S 1;  1MPF A;  4JFB A;  3K19 A;  2PRN A;  5FVN A;  5DL6 A;  3FYX A;  7PRN A;  3JTY A;  3PRN A;  2J4U P;  3NSG A;  3UPG A;  3VY8 X;  1OPF A;  4AUI A;  1HXT A;  1BH3 A;  3O0E A;  1PRN A;  4FRX A;  3T24 A;  2Y0L A;  2POR A;  4FMS A;  4RJW A;  3HW9 A;  4LSF A;  1E54 A;  4FSO A;  4KR8 A;  5DL5 A;  4LSI A;  2XE3 A;  3WI4 A;  2Y2X A;  2XG6 A;  4GCP A;  2O4V A;  3POX A;  3SYB A;  5PRN A;  3POR A;  2XE5 A;  3VZU X;  4LSH A;  3POU A;  4D65 A;  1GFO A;  1GFP A;  2K4T A;  4GCS A;  2Y0H A;  5DL7 A;  5JDP A;  3POQ A;  4FSP A;  2ZLD A;  3SY9 A;  4FOZ A;  4D64 A;  1GFN A;  4FRT A;  4LSE A;  5DL8 A;  3UU2 A;  4GCQ A;  3EMN X;  1BT9 A;  2ZFG A;  2Y0K A;  4BUM X;  4KRA A;  4RJX A;  3SYS A;  2XE1 A;  1HXU A;  3SZV A;  6PRN A; 
#chains in the Genus database with same CATH topology
 3VZW X;  1ZHX A;  4KR4 A;  4PUX A;  2FGQ X;  1QJ8 A;  3PGS A;  3WU2 O;  3A2S X;  5B66 O;  2OMF A;  3DWN A;  3HWB A;  4C4V A;  2F1V A;  3T0S A;  2KXP A;  2LFU A;  3AAA A;  3AA0 A;  3VZT X;  1ORM A;  4AKR B;  1PHO A;  3WI5 A;  3V8U A;  2YPV A;  1GFQ A;  4FES A;  4UB8 O;  4AYE C;  1QJP A;  5T5F A;  4N74 A;  1OSM A;  1GFM A;  2XE2 A;  3QRA A;  4FZN A;  2R88 A;  2R4L A;  5GTH O;  3SY7 A;  3QRC A;  3VY9 X;  4D5U A;  2ODJ A;  1Q9G A;  2KDY A;  2J1N A;  3G7G A;  4G76 A;  2LHF A;  2JQY A;  4N59 A;  3LK3 A;  2FGR A;  5E79 O;  4C69 X;  3NJT A;  2X27 X;  5KAF O;  1HXX A;  4AYD C;  3VE1 A;  2KZ7 B;  3SZD A;  4O3Z A;  4FT6 A;  3A0B O;  4JCH A;  1T16 A;  5EE2 A;  2XTQ A;  4GF4 A;  8PRN A;  4UB6 O;  4U9C A;  1ZHT A;  3T20 A;  4AKR A;  2JMM A;  2M07 A;  2QTK A;  1H6S 1;  1MPF A;  3AA1 B;  3DWO X;  4JFB A;  4FZM A;  3K19 A;  2PRN A;  3HOL A;  2IWV A;  2W80 C;  2N2L A;  2R8A A;  3DZM A;  2R4P A;  3DA3 A;  4O4X A;  4GHB A;  3LK4 1;  5FVN A;  5DL6 A;  3FYX A;  7PRN A;  4AYN A;  5GV0 A;  2MNH A;  2R4N A;  3JTY A;  3PRN A;  4QQ1 A;  4CTD A;  2J4U P;  3PF1 A;  1MM4 A;  1THQ A;  4PJ0 O;  2KZ7 A;  3NSG A;  3UPG A;  3LK4 2;  4RLB A;  3VY8 X;  4G75 A;  1OPF A;  2GE4 A;  4AUI A;  1HXT A;  4PR7 A;  1BH3 A;  1QJ9 A;  2XTR A;  4FQE A;  2YNK A;  2WJR A;  3O0E A;  5ADX K;  1ZHW A;  3AA6 A;  1PRN A;  2KC0 A;  3BRY A;  4RLC A;  3AA1 A;  5KAI O;  2K0L A;  4FRX A;  3T24 A;  1ZHZ A;  2Y0L A;  2ERV A;  4FUV A;  3RBH A;  1IZN B;  2POR A;  4XNK A;  4FMS A;  4RJW A;  3AA6 B;  3HW9 A;  5G26 A;  4E1S A;  3UAQ A;  1MM5 A;  4LSF A;  2F1C X;  5AFU K;  1G90 A;  3TZG A;  1P4T A;  3KZI O;  1E54 A;  3AA7 A;  4FSO A;  4KR8 A;  5DL5 A;  5G38 A;  4AKM A;  2R89 A;  2XE3 A;  4LSI A;  3WI4 A;  2X9K A;  5ADX L;  2MHL A;  2IWW A;  3AA7 B;  4C00 A;  2Y2X A;  3PGU A;  3PQU A;  5AFU L;  4AZL A;  4F4B A;  4O4U A;  5G3A A;  4FZL A;  4B61 A;  2XG6 A;  4GCP A;  2O4V A;  3POX A;  4N75 A;  3SYB A;  5PRN A;  4N58 A;  3POR A;  3DA4 A;  3PQS A;  2R4O A;  2XE5 A;  3VZU X;  2W81 C;  4LSH A;  1IZN A;  2AXT O;  5D5D A;  3POU A;  4RL9 A;  4D65 A;  4O49 A;  3KVD D;  1GFO A;  3AAE B;  3GP6 A;  3HOE A;  1GFP A;  2K4T A;  4GCS A;  4AYM C;  4AYI D;  2Y0H A;  5DL7 A;  2WJQ A;  3LK2 B;  4K3C A;  5TIS O;  5IYU A;  5JDP A;  3PGR A;  5GTI O;  4O3X B;  3POQ A;  3BS0 A;  4E1T A;  1S5L O;  4FSP A;  4C4V B;  2ZLD A;  5H2F O;  2N2M A;  2M06 A;  4FOZ A;  2KXP B;  3AAA B;  3SY9 A;  2F1T A;  1GFN A;  3AA0 B;  4FRT A;  1T1L A;  4D64 A;  5B5E O;  4O3W A;  3VE2 A;  4O3Y A;  1Q9F A;  2Y7S A;  4AFK A;  4Z3T A;  3C5O A;  4LSE A;  5DL8 A;  5G39 A;  4GCQ A;  3UU2 A;  3EMN X;  1BT9 A;  2ZFG A;  3JCU O;  3BRZ A;  4IL6 O;  1ZHY A;  2XMX A;  2Y0K A;  3A0H O;  4BUM X;  4KRA A;  4RJX A;  3SYS A;  3LK3 B;  4XNL A;  2XE1 A;  1HXU A;  3AAE A;  1BXW A;  1YS5 A;  3SZV A;  2WVP A;  3LK2 A;  4K3B A;  6PRN A; 
#chains in the Genus database with same CATH homology
 3VZW X;  1ZHX A;  4KR4 A;  4PUX A;  2FGQ X;  1QJ8 A;  3A2S X;  2OMF A;  3HWB A;  2F1V A;  3T0S A;  2KXP A;  2LFU A;  3AAA A;  3AA0 A;  3VZT X;  1ORM A;  4AKR B;  1PHO A;  3WI5 A;  3V8U A;  2YPV A;  1GFQ A;  4FES A;  4AYE C;  1QJP A;  5T5F A;  1OSM A;  1GFM A;  2XE2 A;  3QRA A;  4FZN A;  3SY7 A;  3QRC A;  3VY9 X;  4D5U A;  2ODJ A;  1Q9G A;  2KDY A;  2J1N A;  3G7G A;  4G76 A;  2LHF A;  4N59 A;  4C69 X;  3LK3 A;  2FGR A;  2X27 X;  1HXX A;  4AYD C;  3VE1 A;  2KZ7 B;  3SZD A;  4O3Z A;  4FT6 A;  4JCH A;  5EE2 A;  2XTQ A;  4GF4 A;  8PRN A;  4U9C A;  1ZHT A;  3T20 A;  4AKR A;  2JMM A;  2M07 A;  2QTK A;  1H6S 1;  1MPF A;  3AA1 B;  4JFB A;  4FZM A;  3K19 A;  2PRN A;  3HOL A;  2W80 C;  2N2L A;  3DA3 A;  4O4X A;  4GHB A;  3LK4 1;  5FVN A;  5DL6 A;  3FYX A;  7PRN A;  4AYN A;  5GV0 A;  2MNH A;  3JTY A;  4QQ1 A;  3PRN A;  2J4U P;  1MM4 A;  1THQ A;  2KZ7 A;  3NSG A;  3UPG A;  3LK4 2;  4RLB A;  3VY8 X;  4G75 A;  1OPF A;  2GE4 A;  4AUI A;  1HXT A;  1BH3 A;  1QJ9 A;  2XTR A;  5ADX K;  2YNK A;  3O0E A;  1ZHW A;  3AA6 A;  1PRN A;  2KC0 A;  4RLC A;  3AA1 A;  2K0L A;  4FRX A;  3T24 A;  1ZHZ A;  2Y0L A;  2ERV A;  4FUV A;  3RBH A;  1IZN B;  2POR A;  4XNK A;  4FMS A;  4RJW A;  3AA6 B;  3HW9 A;  5G26 A;  4E1S A;  3UAQ A;  1MM5 A;  4LSF A;  5AFU K;  1G90 A;  3TZG A;  1P4T A;  1E54 A;  3AA7 A;  4FSO A;  4KR8 A;  5DL5 A;  4AKM A;  4LSI A;  2XE3 A;  3WI4 A;  5ADX L;  2MHL A;  3AA7 B;  2Y2X A;  3PQU A;  5AFU L;  4AZL A;  4F4B A;  4O4U A;  4FZL A;  4B61 A;  2XG6 A;  4GCP A;  2O4V A;  3POX A;  3SYB A;  5PRN A;  4N58 A;  3POR A;  3DA4 A;  3PQS A;  2XE5 A;  3VZU X;  2W81 C;  4LSH A;  1IZN A;  5D5D A;  3POU A;  4RL9 A;  4D65 A;  4O49 A;  3KVD D;  1GFO A;  3AAE B;  3GP6 A;  3HOE A;  1GFP A;  2K4T A;  4GCS A;  4AYM C;  4AYI D;  2Y0H A;  5DL7 A;  3LK2 B;  4E1T A;  5IYU A;  5JDP A;  4O3X B;  3POQ A;  4FSP A;  2ZLD A;  2N2M A;  2M06 A;  4FOZ A;  2KXP B;  3AAA B;  3SY9 A;  2F1T A;  1GFN A;  3AA0 B;  4FRT A;  4D64 A;  4O3W A;  3VE2 A;  4O3Y A;  1Q9F A;  2Y7S A;  4AFK A;  4Z3T A;  3C5O A;  4LSE A;  5DL8 A;  3UU2 A;  4GCQ A;  3EMN X;  1BT9 A;  2ZFG A;  1ZHY A;  2XMX A;  2Y0K A;  4BUM X;  4KRA A;  4RJX A;  3SYS A;  3LK3 B;  4XNL A;  2XE1 A;  1HXU A;  3AAE A;  1BXW A;  1YS5 A;  3SZV A;  3LK2 A;  6PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...