2O4VA

An arginine ladder in oprp mediates phosphate specific transfer across the outer membrane
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
411
structure length
411
Chain Sequence
GTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYGRFDGYYTNNGNTADAAYFRRAYLEFGGTAYRDWKYQINYDLSRNVGNDSAGYFDEASVTYTGFNPVNLKFGRFYTDFGLEKATSSKWVTALERNLTYDIADWVNDNVGTGIQASSVVGGMAFLSGSVFSENNNDTDGDSVKRYNLRGVFAPLHEPGNVVHLGLQYAYRDLEDSAVDTRIRPRMGMRGVSTNGGNDAGSNGNRGLFGGSSAVEGLWKDDSVWGLEGAWALGAFSAQAEYLRRTVKAERDREDLKASGYYAQLAYTLTGEPRLYKLDGAKFDTIKPENKEIGAWELFYRYDSIKVEDDNIVVDSATREVGDAKGKTHTLGVNWYANEAVKVSANYVKAKTDKISNANGDDSGDGLVMRLQYVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Porin P
publication title An arginine ladder in OprP mediates phosphate-specific transfer across the outer membrane.
pubmed doi rcsb
total genus 116
structure length 411
sequence length 411
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07396 Porin_O_P Phosphate-selective porin O and P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2o4vA00
1OPFA 2J1NA 2QTKA 3WI4A 4KR8A 2FGRA 4GCSA 2XG6A 1BT9A 4FOZA 4LSEA 3POUA 4FMSA 2Y2XA 3O0EA 1MPFA 2FGQX 5DL6A 3SY9A 2Y0HA 3K19A 3HWBA 3UU2A 3SYBA 4JFBA 2OMFA 3VZUX 2J4UP 2O4VA 3T0SA 5JDPA 3VZTX 3SZVA 3VZWX 4LSHA 1E54A 3NSGA 3SZDA 1GFNA 3T20A 1BH3A 4GCQA 3A2SX 4FRTA 5DL8A 4RJXA 1PRNA 6PRNA 4D65A 4FSOA 2ZFGA 1OSMA 2PRNA 3HW9A 2XE2A 2Y0LA 4AUIA 1H6S1 4GCPA 1HXXA 4D64A 4BUMX 4C69X 3SY7A 3VY8X 3SYSA 5FVNA 1GFQA 3VY9X 1HXUA 2PORA 7PRNA 2ZLDA 4FSPA 3JTYA 5DL7A 4KR4A 3T24A 2XE1A 4FRXA 1HXTA 2Y0KA 2XE5A 3POXA 5DL5A 2ODJA 3PRNA 3EMNX 5PRNA 4RJWA 1GFMA 2K4TA 3FYXA 4KRAA 4D5UA 4LSFA 1GFPA 3UPGA 3POQA 8PRNA 2XE3A 1GFOA 4LSIA 4FT6A 3PORA 1PHOA 3WI5A
chains in the Genus database with same CATH superfamily
3HOLA 1OPFA 3A0BO 2KDYA 5G3AA 3DZMA 2J1NA 2QTKA 3PGUA 2M06A 3WI4A 4KR8A 4CTDA 2FGRA 4GCSA 3AAAB 2WJRA 2Y7SA 2XG6A 3C5OA 1BT9A 5T5FA 4IL6O 1QJ8A 4FOZA 2R8AA 4FQEA 4LSEA 4AYNA 5AFUL 4O3YA 2IWVA 4O4XA 2XTQA 3POUA 4GHBA 4FMSA 2Y2XA 4XNKA 4K3CA 4RL9A 2XMXA 2JMMA 4AYID 3PGRA 3AAAA 3LK42 3O0EA 1MPFA 3PGSA 2FGQX 3AA6A 5DL6A 3SY9A 2Y0HA 3K19A 3LK3B 4O4UA 3HWBA 3KVDD 3UU2A 3BRZA 3SYBA 3G7GA 2N2LA 2R4NA 4JFBA 4AYMC 2OMFA 2YPVA 3AA0B 4FESA 5KAFO 3VZUX 2O4VA 2J4UP 2W80C 4G76A 4C00A 2KXPB 4RLBA 1QJPA 4GF4A 3T0SA 1G90A 2X27X 2AXTO 3VE1A 3LK3A 4AYDC 5JDPA 4FZNA 3VZTX 4UB6O 3SZVA 5EE2A 3VE2A 3VZWX 4E1SA 2M07A 5GTHO 4LSHA 2R4LA 3AA1B 5ADXL 1E54A 5E79O 3AA0A 2GE4A 2R89A 3DWNA 5IYUA 3NSGA 3SZDA 2KXPA 3QRCA 1GFNA 3WU2O 4O3ZA 1BH3A 3KZIO 4GCQA 3T20A 4E1TA 5GV0A 3VY8X 4FZMA 5D5DA 3A2SX 2R4PA 3NJTA 2JQYA 4FRTA 1YS5A 2F1VA 5DL8A 3HOEA 3AA1A 1PRNA 4K3BA 2MHLA 4RJXA 5PRNA 5TISO 1ORMA 1T16A 2X9KA 4D65A 4F4BA 5B66O 6PRNA 4FSOA 5H2FO 2ZFGA 3LK2B 1MM4A 1OSMA 2PRNA 4O49A 3BRYA 3HW9A 7PRNA 2F1TA 4B61A 1ZHWA 5GTIO 1ZHYA 1Q9GA 2XE2A 2Y0LA 1H6S1 4AUIA 2WVPA 3DA3A 3BS0A 4N58A 3AAEB 3TZGA 4AYEC 4AKRB 4N74A 3A0HO 3LK2A 4GCPA 2YNKA 4JCHA 3RBHA 5KAIO 1Q9FA 1HXXA 5AFUK 4D64A 4C4VB 1QJ9A 4N75A 4BUMX 4C69X 3SY7A 4PJ0O 3SYSA 5FVNA 1GFQA 2R88A 1HXUA 2PORA 2R4OA 3AA7B 3VY9X 2ZLDA 5B5EO 4Z3TA 4FSPA 3AAEA 3JTYA 2XTRA 4AKRA 5DL7A 1ZHXA 4KR4A 4XNLA 3T24A 4C4VA 3LK41 3JCUO 2XE1A 1BXWA 2N2MA 4FUVA 4FRXA 4N59A 2IWWA 4G75A 3AA7A 1HXTA 1THQA 4QQ1A 2Y0KA 3PQUA 2XE5A 4AFKA 1ZHTA 4FZLA 4AZLA 2F1CX 2W81C 4AKMA 3DA4A 3PF1A 1S5LO 3POXA 2K0LA 4PR7A 5DL5A 1IZNB 2LHFA 2ODJA 2KZ7B 3EMNX 3PRNA 3PQSA 5G39A 4RLCA 2WJQA 4RJWA 1GFMA 2K4TA 2LFUA 3AA6B 1ZHZA 3FYXA 4KRAA 4D5UA 4LSFA 4O3WA 2MNHA 1GFPA 3UPGA 3POQA 3V8UA 1MM5A 8PRNA 2XE3A 5ADXK 2ERVA 5G26A 4PUXA 1P4TA 4UB8O 1GFOA 3GP6A 4LSIA 1IZNA 3QRAA 2KZ7A 2KC0A 4FT6A 4U9CA 5G38A 3DWOX 3PORA 4O3XB 3UAQA 1PHOA 1T1LA 3WI5A
chains in the Genus database with same CATH topology
3HOLA 1OPFA 2KDYA 2J1NA 2QTKA 2M06A 3WI4A 4KR8A 2FGRA 4GCSA 3AAAB 2Y7SA 2XG6A 3C5OA 1BT9A 5T5FA 1QJ8A 4FOZA 4AYNA 5AFUL 4LSEA 4O3YA 4O4XA 2XTQA 3POUA 4GHBA 4FMSA 2Y2XA 4XNKA 4RL9A 4AYID 2XMXA 2JMMA 3AAAA 3LK42 3O0EA 1MPFA 2FGQX 3AA6A 5DL6A 3SY9A 2Y0HA 3K19A 3LK3B 4O4UA 3HWBA 3KVDD 3UU2A 3SYBA 3G7GA 2N2LA 4JFBA 4AYMC 2OMFA 2YPVA 3AA0B 4FESA 3VZUX 2J4UP 2O4VA 2W80C 4G76A 2KXPB 4RLBA 1QJPA 4GF4A 3T0SA 1G90A 2X27X 3VE1A 4AYDC 3LK3A 5JDPA 4FZNA 3VZTX 3SZVA 3VE2A 5EE2A 3VZWX 4E1SA 2M07A 4LSHA 3AA1B 5ADXL 1E54A 3AA0A 2GE4A 5IYUA 3NSGA 3SZDA 2KXPA 3QRCA 1GFNA 4O3ZA 1BH3A 3T20A 4GCQA 4E1TA 5GV0A 4FZMA 5D5DA 3A2SX 4FRTA 1YS5A 2F1VA 5DL8A 3HOEA 3AA1A 1PRNA 4RJXA 2MHLA 6PRNA 1ORMA 4D65A 4F4BA 4FSOA 2ZFGA 3LK2B 1MM4A 1OSMA 2PRNA 4O49A 3HW9A 2F1TA 4B61A 1ZHWA 1ZHYA 1Q9GA 2XE2A 2Y0LA 1H6S1 4AUIA 3DA3A 4N58A 3AAEB 3TZGA 4AYEC 4AKRB 3LK2A 4GCPA 2YNKA 4JCHA 3RBHA 1Q9FA 1HXXA 5AFUK 4D64A 1QJ9A 4BUMX 4C69X 3SY7A 3VY8X 3SYSA 5FVNA 1GFQA 3VY9X 1HXUA 2PORA 7PRNA 3AA7B 2ZLDA 4Z3TA 4FSPA 3AAEA 3JTYA 2XTRA 4AKRA 5DL7A 1ZHXA 4KR4A 4XNLA 3T24A 3LK41 2XE1A 1BXWA 2N2MA 4FUVA 4FRXA 4N59A 4G75A 3AA7A 1HXTA 1THQA 4QQ1A 2Y0KA 3PQUA 2XE5A 4AFKA 1ZHTA 4FZLA 4AZLA 2W81C 4AKMA 3DA4A 3POXA 5DL5A 2K0LA 1IZNB 2LHFA 2ODJA 2KZ7B 3EMNX 3PRNA 3PQSA 5PRNA 4RLCA 4RJWA 1GFMA 2K4TA 2LFUA 3AA6B 1ZHZA 3FYXA 4KRAA 4D5UA 4LSFA 4O3WA 2MNHA 1GFPA 3UPGA 3POQA 3V8UA 1MM5A 8PRNA 2XE3A 5ADXK 2ERVA 5G26A 4PUXA 1P4TA 1GFOA 3GP6A 4LSIA 1IZNA 3QRAA 2KZ7A 2KC0A 4FT6A 4U9CA 3PORA 4O3XB 3UAQA 1PHOA 3WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPF A;  2J1N A;  2QTK A;  3WI4 A;  4KR8 A;  2FGR A;  4GCS A;  2XG6 A;  1BT9 A;  4FOZ A;  4LSE A;  3POU A;  4FMS A;  2Y2X A;  3O0E A;  1MPF A;  2FGQ X;  5DL6 A;  3SY9 A;  2Y0H A;  3K19 A;  3HWB A;  3UU2 A;  3SYB A;  4JFB A;  2OMF A;  3VZU X;  2J4U P;  2O4V A;  3T0S A;  5JDP A;  3VZT X;  3SZV A;  3VZW X;  4LSH A;  1E54 A;  3NSG A;  3SZD A;  1GFN A;  3T20 A;  1BH3 A;  4GCQ A;  3A2S X;  4FRT A;  5DL8 A;  4RJX A;  1PRN A;  6PRN A;  4D65 A;  4FSO A;  2ZFG A;  1OSM A;  2PRN A;  3HW9 A;  2XE2 A;  2Y0L A;  4AUI A;  1H6S 1;  4GCP A;  1HXX A;  4D64 A;  4BUM X;  4C69 X;  3SY7 A;  3VY8 X;  3SYS A;  5FVN A;  1GFQ A;  3VY9 X;  1HXU A;  2POR A;  7PRN A;  2ZLD A;  4FSP A;  3JTY A;  5DL7 A;  4KR4 A;  3T24 A;  2XE1 A;  4FRX A;  1HXT A;  2Y0K A;  2XE5 A;  3POX A;  5DL5 A;  2ODJ A;  3PRN A;  3EMN X;  5PRN A;  4RJW A;  1GFM A;  2K4T A;  3FYX A;  4KRA A;  4D5U A;  4LSF A;  1GFP A;  3UPG A;  3POQ A;  8PRN A;  2XE3 A;  1GFO A;  4LSI A;  4FT6 A;  3POR A;  1PHO A;  3WI5 A; 
#chains in the Genus database with same CATH topology
 3HOL A;  1OPF A;  3A0B O;  2KDY A;  5G3A A;  3DZM A;  2J1N A;  2QTK A;  3PGU A;  2M06 A;  3WI4 A;  4KR8 A;  4CTD A;  2FGR A;  4GCS A;  3AAA B;  2WJR A;  2Y7S A;  2XG6 A;  3C5O A;  1BT9 A;  5T5F A;  4IL6 O;  1QJ8 A;  4FOZ A;  2R8A A;  4FQE A;  4LSE A;  4AYN A;  5AFU L;  4O3Y A;  2IWV A;  4O4X A;  2XTQ A;  3POU A;  4GHB A;  4FMS A;  2Y2X A;  4XNK A;  4K3C A;  4RL9 A;  2XMX A;  2JMM A;  4AYI D;  3PGR A;  3AAA A;  3LK4 2;  3O0E A;  1MPF A;  3PGS A;  2FGQ X;  3AA6 A;  5DL6 A;  3SY9 A;  2Y0H A;  3K19 A;  3LK3 B;  4O4U A;  3HWB A;  3KVD D;  3UU2 A;  3BRZ A;  3SYB A;  3G7G A;  2N2L A;  2R4N A;  4JFB A;  4AYM C;  2OMF A;  2YPV A;  3AA0 B;  4FES A;  5KAF O;  3VZU X;  2O4V A;  2J4U P;  2W80 C;  4G76 A;  4C00 A;  2KXP B;  4RLB A;  1QJP A;  4GF4 A;  3T0S A;  1G90 A;  2X27 X;  2AXT O;  3VE1 A;  3LK3 A;  4AYD C;  5JDP A;  4FZN A;  3VZT X;  4UB6 O;  3SZV A;  5EE2 A;  3VE2 A;  3VZW X;  4E1S A;  2M07 A;  5GTH O;  4LSH A;  2R4L A;  3AA1 B;  5ADX L;  1E54 A;  5E79 O;  3AA0 A;  2GE4 A;  2R89 A;  3DWN A;  5IYU A;  3NSG A;  3SZD A;  2KXP A;  3QRC A;  1GFN A;  3WU2 O;  4O3Z A;  1BH3 A;  3KZI O;  4GCQ A;  3T20 A;  4E1T A;  5GV0 A;  3VY8 X;  4FZM A;  5D5D A;  3A2S X;  2R4P A;  3NJT A;  2JQY A;  4FRT A;  1YS5 A;  2F1V A;  5DL8 A;  3HOE A;  3AA1 A;  1PRN A;  4K3B A;  2MHL A;  4RJX A;  5PRN A;  5TIS O;  1ORM A;  1T16 A;  2X9K A;  4D65 A;  4F4B A;  5B66 O;  6PRN A;  4FSO A;  5H2F O;  2ZFG A;  3LK2 B;  1MM4 A;  1OSM A;  2PRN A;  4O49 A;  3BRY A;  3HW9 A;  7PRN A;  2F1T A;  4B61 A;  1ZHW A;  5GTI O;  1ZHY A;  1Q9G A;  2XE2 A;  2Y0L A;  1H6S 1;  4AUI A;  2WVP A;  3DA3 A;  3BS0 A;  4N58 A;  3AAE B;  3TZG A;  4AYE C;  4AKR B;  4N74 A;  3A0H O;  3LK2 A;  4GCP A;  2YNK A;  4JCH A;  3RBH A;  5KAI O;  1Q9F A;  1HXX A;  5AFU K;  4D64 A;  4C4V B;  1QJ9 A;  4N75 A;  4BUM X;  4C69 X;  3SY7 A;  4PJ0 O;  3SYS A;  5FVN A;  1GFQ A;  2R88 A;  1HXU A;  2POR A;  2R4O A;  3AA7 B;  3VY9 X;  2ZLD A;  5B5E O;  4Z3T A;  4FSP A;  3AAE A;  3JTY A;  2XTR A;  4AKR A;  5DL7 A;  1ZHX A;  4KR4 A;  4XNL A;  3T24 A;  4C4V A;  3LK4 1;  3JCU O;  2XE1 A;  1BXW A;  2N2M A;  4FUV A;  4FRX A;  4N59 A;  2IWW A;  4G75 A;  3AA7 A;  1HXT A;  1THQ A;  4QQ1 A;  2Y0K A;  3PQU A;  2XE5 A;  4AFK A;  1ZHT A;  4FZL A;  4AZL A;  2F1C X;  2W81 C;  4AKM A;  3DA4 A;  3PF1 A;  1S5L O;  3POX A;  2K0L A;  4PR7 A;  5DL5 A;  1IZN B;  2LHF A;  2ODJ A;  2KZ7 B;  3EMN X;  3PRN A;  3PQS A;  5G39 A;  4RLC A;  2WJQ A;  4RJW A;  1GFM A;  2K4T A;  2LFU A;  3AA6 B;  1ZHZ A;  3FYX A;  4KRA A;  4D5U A;  4LSF A;  4O3W A;  2MNH A;  1GFP A;  3UPG A;  3POQ A;  3V8U A;  1MM5 A;  8PRN A;  2XE3 A;  5ADX K;  2ERV A;  5G26 A;  4PUX A;  1P4T A;  4UB8 O;  1GFO A;  3GP6 A;  4LSI A;  1IZN A;  3QRA A;  2KZ7 A;  2KC0 A;  4FT6 A;  4U9C A;  5G38 A;  3DWO X;  3POR A;  4O3X B;  3UAQ A;  1PHO A;  1T1L A;  3WI5 A; 
#chains in the Genus database with same CATH homology
 3HOL A;  1OPF A;  2KDY A;  2J1N A;  2QTK A;  2M06 A;  3WI4 A;  4KR8 A;  2FGR A;  4GCS A;  3AAA B;  2Y7S A;  2XG6 A;  3C5O A;  1BT9 A;  5T5F A;  1QJ8 A;  4FOZ A;  4AYN A;  5AFU L;  4LSE A;  4O3Y A;  4O4X A;  2XTQ A;  3POU A;  4GHB A;  4FMS A;  2Y2X A;  4XNK A;  4RL9 A;  4AYI D;  2XMX A;  2JMM A;  3AAA A;  3LK4 2;  3O0E A;  1MPF A;  2FGQ X;  3AA6 A;  5DL6 A;  3SY9 A;  2Y0H A;  3K19 A;  3LK3 B;  4O4U A;  3HWB A;  3KVD D;  3UU2 A;  3SYB A;  3G7G A;  2N2L A;  4JFB A;  4AYM C;  2OMF A;  2YPV A;  3AA0 B;  4FES A;  3VZU X;  2J4U P;  2O4V A;  2W80 C;  4G76 A;  2KXP B;  4RLB A;  1QJP A;  4GF4 A;  3T0S A;  1G90 A;  2X27 X;  3VE1 A;  4AYD C;  3LK3 A;  5JDP A;  4FZN A;  3VZT X;  3SZV A;  3VE2 A;  5EE2 A;  3VZW X;  4E1S A;  2M07 A;  4LSH A;  3AA1 B;  5ADX L;  1E54 A;  3AA0 A;  2GE4 A;  5IYU A;  3NSG A;  3SZD A;  2KXP A;  3QRC A;  1GFN A;  4O3Z A;  1BH3 A;  3T20 A;  4GCQ A;  4E1T A;  5GV0 A;  4FZM A;  5D5D A;  3A2S X;  4FRT A;  1YS5 A;  2F1V A;  5DL8 A;  3HOE A;  3AA1 A;  1PRN A;  4RJX A;  2MHL A;  6PRN A;  1ORM A;  4D65 A;  4F4B A;  4FSO A;  2ZFG A;  3LK2 B;  1MM4 A;  1OSM A;  2PRN A;  4O49 A;  3HW9 A;  2F1T A;  4B61 A;  1ZHW A;  1ZHY A;  1Q9G A;  2XE2 A;  2Y0L A;  1H6S 1;  4AUI A;  3DA3 A;  4N58 A;  3AAE B;  3TZG A;  4AYE C;  4AKR B;  3LK2 A;  4GCP A;  2YNK A;  4JCH A;  3RBH A;  1Q9F A;  1HXX A;  5AFU K;  4D64 A;  1QJ9 A;  4BUM X;  4C69 X;  3SY7 A;  3VY8 X;  3SYS A;  5FVN A;  1GFQ A;  3VY9 X;  1HXU A;  2POR A;  7PRN A;  3AA7 B;  2ZLD A;  4Z3T A;  4FSP A;  3AAE A;  3JTY A;  2XTR A;  4AKR A;  5DL7 A;  1ZHX A;  4KR4 A;  4XNL A;  3T24 A;  3LK4 1;  2XE1 A;  1BXW A;  2N2M A;  4FUV A;  4FRX A;  4N59 A;  4G75 A;  3AA7 A;  1HXT A;  1THQ A;  4QQ1 A;  2Y0K A;  3PQU A;  2XE5 A;  4AFK A;  1ZHT A;  4FZL A;  4AZL A;  2W81 C;  4AKM A;  3DA4 A;  3POX A;  5DL5 A;  2K0L A;  1IZN B;  2LHF A;  2ODJ A;  2KZ7 B;  3EMN X;  3PRN A;  3PQS A;  5PRN A;  4RLC A;  4RJW A;  1GFM A;  2K4T A;  2LFU A;  3AA6 B;  1ZHZ A;  3FYX A;  4KRA A;  4D5U A;  4LSF A;  4O3W A;  2MNH A;  1GFP A;  3UPG A;  3POQ A;  3V8U A;  1MM5 A;  8PRN A;  2XE3 A;  5ADX K;  2ERV A;  5G26 A;  4PUX A;  1P4T A;  1GFO A;  3GP6 A;  4LSI A;  1IZN A;  3QRA A;  2KZ7 A;  2KC0 A;  4FT6 A;  4U9C A;  3POR A;  4O3X B;  3UAQ A;  1PHO A;  3WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...