3SYSA

Improved crystal structure of pseudomonas aeruginosa occk1 (opdk)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
387
structure length
374
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNSNSELLPLHDDGRAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Vanillate porin OpdK
total genus 101
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sysA01
4GCSA 8PRNA 4D64A 4RJWA 2K4TA 3VZWX 1PHOA 1H6S1 2Y0HA 4D65A 2J1NA 2Y0LA 3HW9A 2PRNA 4KR8A 4LSEA 3WI4A 4RJXA 2QTKA 3VY9X 1GFPA 4FRXA 2XE1A 5PRNA 3VZTX 1PRNA 5DL6A 5FVNA 4FSOA 2ZLDA 4FSPA 4FRTA 2XE5A 3VY8X 5DL8A 3T0SA 5DL5A 4AUIA 3A2SX 3PRNA 3UPGA 1E54A 3T24A 4KRAA 4LSIA 1HXXA 3POXA 4GCQA 3FYXA 4LSHA 3POQA 1BH3A 4JFBA 3SZVA 3SYBA 3JTYA 6PRNA 2Y0KA 3POUA 2XE2A 2FGRA 3NSGA 3K19A 4BUMX 4FT6A 3O0EA 2ZFGA 1BT9A 4FMSA 2OMFA 5JDPA 3SZDA 4D5UA 2ODJA 2PORA 4FOZA 4C69X 3UU2A 2FGQX 3SY9A 4LSFA 1GFNA 1GFMA 1GFQA 2XG6A 2Y2XA 3EMNX 1HXUA 3VZUX 2XE3A 1MPFA 4KR4A 3HWBA 1GFOA 7PRNA 4GCPA 3SYSA 3SY7A 1HXTA 3WI5A 2O4VA 1OPFA 1OSMA 3T20A 2J4UP 3PORA 5DL7A
chains in the Genus database with same CATH superfamily
4O3XB 4GCSA 5KAIO 4AKMA 8PRNA 5ADXK 5E79O 5GTHO 2R4NA 2KC0A 3DWNA 3HOLA 3WU2O 4FQEA 3LK2A 4U9CA 3AA1A 3DWOX 4D64A 1Q9FA 2KXPA 4RJWA 2K4TA 5T5FA 3BRYA 2F1CX 4O3YA 4O3ZA 1PHOA 4XNLA 4O4UA 3UAQA 3VZWX 2N2LA 4AYID 2XTRA 2Y7SA 3VE1A 2WJRA 1H6S1 2Y0HA 4D65A 5IYUA 5G3AA 2J1NA 4G75A 3RBHA 2ERVA 3V8UA 4AYMC 2X9KA 2Y0LA 5TISO 1QJ8A 3HOEA 3LK41 3GP6A 3HW9A 4N59A 4GF4A 4RLBA 2PRNA 3AA0B 2R88A 3DA4A 4KR8A 1BXWA 4LSEA 4N75A 4AYNA 4C4VB 2R4PA 3WI4A 4C00A 3G7GA 4RJXA 3AA7A 2WVPA 4K3CA 2QTKA 3VY9X 1GFPA 4FRXA 2XE1A 5PRNA 3VZTX 4O49A 1PRNA 5DL6A 3AA6B 5FVNA 3AA1B 4FSOA 2ZLDA 3AA6A 4FSPA 2KZ7A 4FRTA 3KZIO 2XE5A 4C4VA 2IWWA 3PGSA 2MNHA 3VY8X 5GTIO 4FZNA 4QQ1A 5DL8A 1G90A 1QJ9A 3T0SA 5DL5A 4AKRA 4AUIA 3A2SX 4AZLA 3AA0A 3DA3A 1T1LA 3PRNA 3QRAA 4O3WA 1ORMA 5D5DA 1E54A 3UPGA 2R89A 3AAEB 3T24A 3LK42 4KRAA 4LSIA 2LFUA 2F1VA 1HXXA 3POXA 4GCQA 2LHFA 3FYXA 4PUXA 3POQA 4LSHA 4XNKA 1Q9GA 1BH3A 5AFUK 3KVDD 3JCUO 4JFBA 4AYEC 1ZHYA 2M07A 2K0LA 5G26A 4JCHA 3SZVA 3SYBA 1IZNB 3JTYA 4N58A 4F4BA 4RLCA 2JQYA 4Z3TA 6PRNA 3TZGA 2Y0KA 3POUA 4AYDC 3AA7B 4CTDA 2XE2A 4FESA 2FGRA 1ZHWA 3NSGA 3VE2A 1ZHXA 2IWVA 3K19A 4UB6O 5B66O 4BUMX 1IZNA 4FT6A 2YPVA 2R8AA 2W81C 3AAAA 3LK3A 3A0HO 5AFUL 3O0EA 4N74A 2JMMA 1T16A 1MM5A 2MHLA 1BT9A 2ZFGA 2KDYA 4FMSA 2R4OA 2XMXA 3LK2B 2OMFA 3BS0A 5JDPA 5G39A 1QJPA 4O4XA 3SZDA 4D5UA 3QRCA 2YNKA 4GHBA 3DZMA 4E1SA 3AAEA 2ODJA 2PORA 4FOZA 4C69X 1ZHZA 2FGQX 4PR7A 3SY9A 3UU2A 4LSFA 4AKRB 3PF1A 1GFNA 1GFMA 1GFQA 1THQA 3PGUA 4FUVA 2XG6A 4G76A 5H2FO 2GE4A 5B5EO 2M06A 2Y2XA 3EMNX 1HXUA 2KZ7B 1P4TA 2R4LA 3A0BO 4B61A 3VZUX 5G38A 2XE3A 1MPFA 2N2MA 4FZLA 4E1TA 2X27X 5ADXL 4KR4A 3BRZA 3HWBA 2W80C 1YS5A 4AFKA 1GFOA 3NJTA 3PQSA 7PRNA 3AAAB 3LK3B 2F1TA 4GCPA 4K3BA 3SYSA 2AXTO 4FZMA 2XTQA 3SY7A 1ZHTA 2KXPB 4UB8O 3PQUA 1S5LO 4RL9A 5EE2A 4IL6O 1HXTA 5GV0A 3PGRA 3WI5A 2O4VA 2WJQA 1OPFA 1OSMA 3C5OA 3T20A 2J4UP 5KAFO 3PORA 4PJ0O 5DL7A 1MM4A
chains in the Genus database with same CATH topology
4O3XB 4GCSA 4AKMA 8PRNA 5ADXK 2KC0A 3HOLA 3LK2A 4U9CA 3AA1A 4D64A 1Q9FA 2KXPA 4RJWA 2K4TA 5T5FA 4O3YA 3UAQA 4O3ZA 4XNLA 1PHOA 3VZWX 4O4UA 2N2LA 4AYID 2XTRA 2Y7SA 3VE1A 1H6S1 2Y0HA 4D65A 5IYUA 3RBHA 2J1NA 4G75A 2ERVA 3V8UA 4AYMC 2Y0LA 1QJ8A 3HOEA 3LK41 3GP6A 3HW9A 4N59A 4GF4A 4RLBA 2PRNA 3AA0B 4KR8A 3DA4A 4AYNA 1BXWA 4LSEA 3WI4A 3G7GA 4RJXA 3AA7A 2QTKA 3VY9X 1GFPA 4FRXA 2XE1A 5PRNA 3VZTX 4O49A 1PRNA 5DL6A 3AA6B 5FVNA 3AA1B 4FSOA 2ZLDA 3AA6A 4FSPA 2KZ7A 4FRTA 2XE5A 2MNHA 3VY8X 4FZNA 4QQ1A 5DL8A 1G90A 1QJ9A 3T0SA 5DL5A 4AKRA 4AUIA 3A2SX 4AZLA 3AA0A 3DA3A 3PRNA 3QRAA 4O3WA 5D5DA 1ORMA 3UPGA 1E54A 3AAEB 3T24A 3LK42 4KRAA 4LSIA 2LFUA 2F1VA 1HXXA 3POXA 4GCQA 2LHFA 3FYXA 4PUXA 3POQA 4LSHA 4XNKA 1Q9GA 1BH3A 5AFUK 3KVDD 4JFBA 4AYEC 1ZHYA 2M07A 2K0LA 5G26A 4JCHA 3SZVA 3SYBA 1IZNB 3JTYA 4N58A 4F4BA 4RLCA 4Z3TA 6PRNA 3TZGA 2Y0KA 3POUA 4AYDC 3AA7B 2XE2A 4FESA 2FGRA 1ZHWA 3NSGA 3VE2A 1ZHXA 3K19A 4BUMX 1IZNA 4FT6A 2YPVA 3AAAA 2W81C 3LK3A 5AFUL 3O0EA 2JMMA 1MM5A 2MHLA 1BT9A 2ZFGA 2KDYA 4FMSA 2XMXA 3LK2B 2OMFA 5JDPA 1QJPA 4O4XA 3SZDA 4D5UA 3QRCA 2YNKA 4GHBA 4E1SA 3AAEA 2ODJA 2PORA 4FOZA 4C69X 1ZHZA 2FGQX 3SY9A 3UU2A 4AKRB 4LSFA 1GFNA 1GFMA 1GFQA 1THQA 4G76A 4FUVA 2XG6A 2GE4A 2M06A 2Y2XA 3EMNX 1HXUA 2KZ7B 1P4TA 4B61A 3VZUX 2XE3A 1MPFA 2N2MA 4FZLA 4E1TA 2X27X 5ADXL 4KR4A 3HWBA 2W80C 1YS5A 4AFKA 1GFOA 7PRNA 3PQSA 3AAAB 3LK3B 2F1TA 4GCPA 3SYSA 4FZMA 2XTQA 3SY7A 1ZHTA 2KXPB 3PQUA 5EE2A 4RL9A 5GV0A 1HXTA 3WI5A 2O4VA 1OPFA 1OSMA 3C5OA 3T20A 2J4UP 3PORA 5DL7A 1MM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCS A;  8PRN A;  4D64 A;  4RJW A;  2K4T A;  3VZW X;  1PHO A;  1H6S 1;  2Y0H A;  4D65 A;  2J1N A;  2Y0L A;  3HW9 A;  2PRN A;  4KR8 A;  4LSE A;  3WI4 A;  4RJX A;  2QTK A;  3VY9 X;  1GFP A;  4FRX A;  2XE1 A;  5PRN A;  3VZT X;  1PRN A;  5DL6 A;  5FVN A;  4FSO A;  2ZLD A;  4FSP A;  4FRT A;  2XE5 A;  3VY8 X;  5DL8 A;  3T0S A;  5DL5 A;  4AUI A;  3A2S X;  3PRN A;  3UPG A;  1E54 A;  3T24 A;  4KRA A;  4LSI A;  1HXX A;  3POX A;  4GCQ A;  3FYX A;  4LSH A;  3POQ A;  1BH3 A;  4JFB A;  3SZV A;  3SYB A;  3JTY A;  6PRN A;  2Y0K A;  3POU A;  2XE2 A;  2FGR A;  3NSG A;  3K19 A;  4BUM X;  4FT6 A;  3O0E A;  2ZFG A;  1BT9 A;  4FMS A;  2OMF A;  5JDP A;  3SZD A;  4D5U A;  2ODJ A;  2POR A;  4FOZ A;  4C69 X;  3UU2 A;  2FGQ X;  3SY9 A;  4LSF A;  1GFN A;  1GFM A;  1GFQ A;  2XG6 A;  2Y2X A;  3EMN X;  1HXU A;  3VZU X;  2XE3 A;  1MPF A;  4KR4 A;  3HWB A;  1GFO A;  7PRN A;  4GCP A;  3SYS A;  3SY7 A;  1HXT A;  3WI5 A;  2O4V A;  1OPF A;  1OSM A;  3T20 A;  2J4U P;  3POR A;  5DL7 A; 
#chains in the Genus database with same CATH topology
 4O3X B;  4GCS A;  5KAI O;  4AKM A;  8PRN A;  5ADX K;  5E79 O;  5GTH O;  2R4N A;  2KC0 A;  3DWN A;  3HOL A;  3WU2 O;  4FQE A;  3LK2 A;  4U9C A;  3AA1 A;  3DWO X;  4D64 A;  1Q9F A;  2KXP A;  4RJW A;  2K4T A;  5T5F A;  3BRY A;  2F1C X;  4O3Y A;  4O3Z A;  1PHO A;  4XNL A;  4O4U A;  3UAQ A;  3VZW X;  2N2L A;  4AYI D;  2XTR A;  2Y7S A;  3VE1 A;  2WJR A;  1H6S 1;  2Y0H A;  4D65 A;  5IYU A;  5G3A A;  2J1N A;  4G75 A;  3RBH A;  2ERV A;  3V8U A;  4AYM C;  2X9K A;  2Y0L A;  5TIS O;  1QJ8 A;  3HOE A;  3LK4 1;  3GP6 A;  3HW9 A;  4N59 A;  4GF4 A;  4RLB A;  2PRN A;  3AA0 B;  2R88 A;  3DA4 A;  4KR8 A;  1BXW A;  4LSE A;  4N75 A;  4AYN A;  4C4V B;  2R4P A;  3WI4 A;  4C00 A;  3G7G A;  4RJX A;  3AA7 A;  2WVP A;  4K3C A;  2QTK A;  3VY9 X;  1GFP A;  4FRX A;  2XE1 A;  5PRN A;  3VZT X;  4O49 A;  1PRN A;  5DL6 A;  3AA6 B;  5FVN A;  3AA1 B;  4FSO A;  2ZLD A;  3AA6 A;  4FSP A;  2KZ7 A;  4FRT A;  3KZI O;  2XE5 A;  4C4V A;  2IWW A;  3PGS A;  2MNH A;  3VY8 X;  5GTI O;  4FZN A;  4QQ1 A;  5DL8 A;  1G90 A;  1QJ9 A;  3T0S A;  5DL5 A;  4AKR A;  4AUI A;  3A2S X;  4AZL A;  3AA0 A;  3DA3 A;  1T1L A;  3PRN A;  3QRA A;  4O3W A;  1ORM A;  5D5D A;  1E54 A;  3UPG A;  2R89 A;  3AAE B;  3T24 A;  3LK4 2;  4KRA A;  4LSI A;  2LFU A;  2F1V A;  1HXX A;  3POX A;  4GCQ A;  2LHF A;  3FYX A;  4PUX A;  3POQ A;  4LSH A;  4XNK A;  1Q9G A;  1BH3 A;  5AFU K;  3KVD D;  3JCU O;  4JFB A;  4AYE C;  1ZHY A;  2M07 A;  2K0L A;  5G26 A;  4JCH A;  3SZV A;  3SYB A;  1IZN B;  3JTY A;  4N58 A;  4F4B A;  4RLC A;  2JQY A;  4Z3T A;  6PRN A;  3TZG A;  2Y0K A;  3POU A;  4AYD C;  3AA7 B;  4CTD A;  2XE2 A;  4FES A;  2FGR A;  1ZHW A;  3NSG A;  3VE2 A;  1ZHX A;  2IWV A;  3K19 A;  4UB6 O;  5B66 O;  4BUM X;  1IZN A;  4FT6 A;  2YPV A;  2R8A A;  2W81 C;  3AAA A;  3LK3 A;  3A0H O;  5AFU L;  3O0E A;  4N74 A;  2JMM A;  1T16 A;  1MM5 A;  2MHL A;  1BT9 A;  2ZFG A;  2KDY A;  4FMS A;  2R4O A;  2XMX A;  3LK2 B;  2OMF A;  3BS0 A;  5JDP A;  5G39 A;  1QJP A;  4O4X A;  3SZD A;  4D5U A;  3QRC A;  2YNK A;  4GHB A;  3DZM A;  4E1S A;  3AAE A;  2ODJ A;  2POR A;  4FOZ A;  4C69 X;  1ZHZ A;  2FGQ X;  4PR7 A;  3SY9 A;  3UU2 A;  4LSF A;  4AKR B;  3PF1 A;  1GFN A;  1GFM A;  1GFQ A;  1THQ A;  3PGU A;  4FUV A;  2XG6 A;  4G76 A;  5H2F O;  2GE4 A;  5B5E O;  2M06 A;  2Y2X A;  3EMN X;  1HXU A;  2KZ7 B;  1P4T A;  2R4L A;  3A0B O;  4B61 A;  3VZU X;  5G38 A;  2XE3 A;  1MPF A;  2N2M A;  4FZL A;  4E1T A;  2X27 X;  5ADX L;  4KR4 A;  3BRZ A;  3HWB A;  2W80 C;  1YS5 A;  4AFK A;  1GFO A;  3NJT A;  3PQS A;  7PRN A;  3AAA B;  3LK3 B;  2F1T A;  4GCP A;  4K3B A;  3SYS A;  2AXT O;  4FZM A;  2XTQ A;  3SY7 A;  1ZHT A;  2KXP B;  4UB8 O;  3PQU A;  1S5L O;  4RL9 A;  5EE2 A;  4IL6 O;  1HXT A;  5GV0 A;  3PGR A;  3WI5 A;  2O4V A;  2WJQ A;  1OPF A;  1OSM A;  3C5O A;  3T20 A;  2J4U P;  5KAF O;  3POR A;  4PJ0 O;  5DL7 A;  1MM4 A; 
#chains in the Genus database with same CATH homology
 4O3X B;  4GCS A;  4AKM A;  8PRN A;  5ADX K;  2KC0 A;  3HOL A;  3LK2 A;  4U9C A;  3AA1 A;  4D64 A;  1Q9F A;  2KXP A;  4RJW A;  2K4T A;  5T5F A;  4O3Y A;  3UAQ A;  4O3Z A;  4XNL A;  1PHO A;  3VZW X;  4O4U A;  2N2L A;  4AYI D;  2XTR A;  2Y7S A;  3VE1 A;  1H6S 1;  2Y0H A;  4D65 A;  5IYU A;  3RBH A;  2J1N A;  4G75 A;  2ERV A;  3V8U A;  4AYM C;  2Y0L A;  1QJ8 A;  3HOE A;  3LK4 1;  3GP6 A;  3HW9 A;  4N59 A;  4GF4 A;  4RLB A;  2PRN A;  3AA0 B;  4KR8 A;  3DA4 A;  4AYN A;  1BXW A;  4LSE A;  3WI4 A;  3G7G A;  4RJX A;  3AA7 A;  2QTK A;  3VY9 X;  1GFP A;  4FRX A;  2XE1 A;  5PRN A;  3VZT X;  4O49 A;  1PRN A;  5DL6 A;  3AA6 B;  5FVN A;  3AA1 B;  4FSO A;  2ZLD A;  3AA6 A;  4FSP A;  2KZ7 A;  4FRT A;  2XE5 A;  2MNH A;  3VY8 X;  4FZN A;  4QQ1 A;  5DL8 A;  1G90 A;  1QJ9 A;  3T0S A;  5DL5 A;  4AKR A;  4AUI A;  3A2S X;  4AZL A;  3AA0 A;  3DA3 A;  3PRN A;  3QRA A;  4O3W A;  5D5D A;  1ORM A;  3UPG A;  1E54 A;  3AAE B;  3T24 A;  3LK4 2;  4KRA A;  4LSI A;  2LFU A;  2F1V A;  1HXX A;  3POX A;  4GCQ A;  2LHF A;  3FYX A;  4PUX A;  3POQ A;  4LSH A;  4XNK A;  1Q9G A;  1BH3 A;  5AFU K;  3KVD D;  4JFB A;  4AYE C;  1ZHY A;  2M07 A;  2K0L A;  5G26 A;  4JCH A;  3SZV A;  3SYB A;  1IZN B;  3JTY A;  4N58 A;  4F4B A;  4RLC A;  4Z3T A;  6PRN A;  3TZG A;  2Y0K A;  3POU A;  4AYD C;  3AA7 B;  2XE2 A;  4FES A;  2FGR A;  1ZHW A;  3NSG A;  3VE2 A;  1ZHX A;  3K19 A;  4BUM X;  1IZN A;  4FT6 A;  2YPV A;  3AAA A;  2W81 C;  3LK3 A;  5AFU L;  3O0E A;  2JMM A;  1MM5 A;  2MHL A;  1BT9 A;  2ZFG A;  2KDY A;  4FMS A;  2XMX A;  3LK2 B;  2OMF A;  5JDP A;  1QJP A;  4O4X A;  3SZD A;  4D5U A;  3QRC A;  2YNK A;  4GHB A;  4E1S A;  3AAE A;  2ODJ A;  2POR A;  4FOZ A;  4C69 X;  1ZHZ A;  2FGQ X;  3SY9 A;  3UU2 A;  4AKR B;  4LSF A;  1GFN A;  1GFM A;  1GFQ A;  1THQ A;  4G76 A;  4FUV A;  2XG6 A;  2GE4 A;  2M06 A;  2Y2X A;  3EMN X;  1HXU A;  2KZ7 B;  1P4T A;  4B61 A;  3VZU X;  2XE3 A;  1MPF A;  2N2M A;  4FZL A;  4E1T A;  2X27 X;  5ADX L;  4KR4 A;  3HWB A;  2W80 C;  1YS5 A;  4AFK A;  1GFO A;  7PRN A;  3PQS A;  3AAA B;  3LK3 B;  2F1T A;  4GCP A;  3SYS A;  4FZM A;  2XTQ A;  3SY7 A;  1ZHT A;  2KXP B;  3PQU A;  5EE2 A;  4RL9 A;  5GV0 A;  1HXT A;  3WI5 A;  2O4V A;  1OPF A;  1OSM A;  3C5O A;  3T20 A;  2J4U P;  3POR A;  5DL7 A;  1MM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...