3SYSA

Improved crystal structure of pseudomonas aeruginosa occk1 (opdk)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
387
structure length
374
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNSNSELLPLHDDGRAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Vanillate porin OpdK
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 101
structure length 374
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3sysA01
8PRNA 4LSIA 1GFPA 2ZLDA 3HWBA 4RJWA 4FOZA 4D65A 2J4UP 1GFOA 5DL5A 1HXTA 4KR4A 3PORA 2ZFGA 1HXXA 4LSHA 1H6S1 3SYBA 3FYXA 3SZVA 3SYSA 1GFNA 4C69X 3POUA 2FGRA 2XE5A 2Y2XA 4FSPA 4LSEA 4GCQA 3WI4A 3SZDA 4FT6A 4FMSA 2FGQX 3VZWX 1GFMA 3SY9A 3T0SA 5FVNA 2XE1A 4D5UA 1E54A 4FRXA 4GCPA 3NSGA 3POXA 4KR8A 3T24A 3T20A 3VY8X 5DL6A 5DL7A 4AUIA 4LSFA 1GFQA 2PRNA 4JFBA 3UU2A 3EMNX 2XG6A 3HW9A 4BUMX 2J1NA 2O4VA 1HXUA 2XE2A 4GCSA 4FRTA 2K4TA 3VZUX 1BT9A 3UPGA 2QTKA 5JDPA 4D64A 2ODJA 1BH3A 2XE3A 2Y0KA 5DL8A 4KRAA 2OMFA 3VZTX 6PRNA 3A2SX 1OSMA 3WI5A 1OPFA 3JTYA 4FSOA 3O0EA 3PRNA 1PHOA 3VY9X 3K19A 3SY7A 1PRNA 1MPFA 7PRNA 2PORA 4RJXA 5PRNA 3POQA 2Y0HA 2Y0LA
chains in the Genus database with same CATH superfamily
8PRNA 4LSIA 1GFPA 3LK42 2ZLDA 3HWBA 4AKRB 4FZMA 4RJWA 3DA4A 5IYUA 4FOZA 4E1TA 4O3WA 2Y7SA 2WVPA 4D65A 3AA1B 2J4UP 1GFOA 4O4XA 1QJPA 5DL5A 1HXTA 4AZLA 4D64A 4KR4A 2R4NA 3PORA 4N59A 2X27X 2R8AA 1HXXA 2JMMA 2ZFGA 1ORMA 4LSHA 1H6S1 3SYBA 4AYMC 4FZLA 3HOLA 2R4LA 2M06A 4C4VB 3FYXA 2LFUA 4AYNA 2AXTO 3SZVA 3JCUO 3SYSA 3PF1A 1GFNA 3G7GA 4AYEC 4C69X 4FQEA 3POUA 4RL9A 4O49A 1QJ9A 2N2MA 3PGRA 4N58A 4U9CA 4UB8O 3BS0A 3RBHA 2FGRA 2XE5A 2Y2XA 3QRAA 4QQ1A 4FSPA 3KVDD 4RLBA 4AKRA 4LSEA 3LK41 4FESA 4B61A 5GTHO 3AA1A 2XTQA 2KDYA 2F1VA 4GCQA 1IZNA 3AAAA 4PR7A 2KC0A 3SZDA 3UAQA 3WI4A 5B66O 3DZMA 5ADXL 1IZNB 2XTRA 4FT6A 4O3ZA 4PUXA 3AAAB 4IL6O 2GE4A 4FMSA 2W81C 2FGQX 3VZWX 1GFMA 1YS5A 3A0HO 4XNLA 4GHBA 3SY9A 3T0SA 4C4VA 5FVNA 5G3AA 2XE1A 4AFKA 2ERVA 2KZ7B 3LK2B 3V8UA 4D5UA 1E54A 1ZHYA 2X9KA 4FRXA 4GCPA 4K3CA 3NSGA 4E1SA 1ZHXA 3POXA 3VE1A 3GP6A 4KR8A 5AFUL 3AA6A 3T24A 4C00A 2YNKA 3VY8X 3T20A 5DL6A 3AA6B 2F1TA 2LHFA 5DL7A 1Q9FA 4AUIA 4G75A 4LSFA 2R89A 1GFQA 2F1CX 2PRNA 3PGUA 4FUVA 3EMNX 3A0BO 4JFBA 3UU2A 5GV0A 2XG6A 3AA0B 3DWNA 5TISO 4K3BA 3AAEA 2MNHA 5G39A 4FZNA 3HW9A 4BUMX 4XNKA 1T16A 2J1NA 2O4VA 4O3YA 5KAIO 3TZGA 2W80C 3AAEB 1HXUA 2WJRA 2XE2A 1ZHWA 3BRZA 3HOEA 4O3XB 1BXWA 4GCSA 4F4BA 4FRTA 2KZ7A 3LK2A 3VE2A 2WJQA 5T5FA 4GF4A 4AYID 4O4UA 1P4TA 1T1LA 2K4TA 1BT9A 3VZUX 3UPGA 2QTKA 5ADXK 4AYDC 5JDPA 1THQA 2M07A 3PGSA 3PQSA 2KXPB 5B5EO 3AA7A 2ODJA 1ZHTA 1BH3A 2XE3A 3WU2O 2Y0KA 5EE2A 2YPVA 3DA3A 1MM4A 4KRAA 2OMFA 5DL8A 3LK3B 3NJTA 3AA7B 3KZIO 4N75A 1Q9GA 3VZTX 6PRNA 1MM5A 5G38A 3A2SX 1OSMA 4JCHA 3AA0A 5G26A 3WI5A 1OPFA 3JTYA 4FSOA 1ZHZA 4Z3TA 3O0EA 5AFUK 2R4OA 1QJ8A 5GTIO 3PRNA 1PHOA 3QRCA 4G76A 4AKMA 3VY9X 2JQYA 3K19A 2R88A 3SY7A 5E79O 1S5LO 1PRNA 3BRYA 1MPFA 3C5OA 7PRNA 2MHLA 2PORA 4N74A 4RJXA 2R4PA 5PRNA 3POQA 3PQUA 4RLCA 5H2FO 2KXPA 5KAFO 4CTDA 2IWVA 2K0LA 2Y0HA 2N2LA 3DWOX 4UB6O 1G90A 2Y0LA 2XMXA 2IWWA 4PJ0O 3LK3A 5D5DA
chains in the Genus database with same CATH topology
8PRNA 4LSIA 1GFPA 3LK42 2ZLDA 3HWBA 4AKRB 4FZMA 4RJWA 3DA4A 5IYUA 4FOZA 4E1TA 4O3WA 2Y7SA 4D65A 3AA1B 2J4UP 1GFOA 4O4XA 1QJPA 5DL5A 1HXTA 4AZLA 4KR4A 4N59A 3PORA 2X27X 2ZFGA 1HXXA 2JMMA 1ORMA 4LSHA 1H6S1 3SYBA 4AYMC 4FZLA 3HOLA 2M06A 3FYXA 2LFUA 4AYNA 3SZVA 3SYSA 1GFNA 3G7GA 4AYEC 4C69X 4RL9A 3POUA 4O49A 1QJ9A 2N2MA 4N58A 4U9CA 3RBHA 2FGRA 2XE5A 2Y2XA 3QRAA 4QQ1A 4FSPA 3KVDD 4RLBA 4AKRA 4LSEA 3LK41 4FESA 4B61A 3AA1A 2XTQA 2KDYA 2F1VA 4GCQA 1IZNA 3AAAA 3UAQA 2KC0A 3SZDA 3WI4A 5ADXL 1IZNB 2XTRA 4FT6A 4O3ZA 4PUXA 3AAAB 2GE4A 4FMSA 2W81C 2FGQX 3VZWX 1GFMA 1YS5A 4XNLA 3SY9A 4GHBA 3T0SA 5FVNA 2XE1A 4AFKA 2ERVA 2KZ7B 3LK2B 3V8UA 4D5UA 1E54A 1ZHYA 4E1SA 4FRXA 4GCPA 3NSGA 1ZHXA 3POXA 3VE1A 3GP6A 4KR8A 5AFUL 3AA6A 3T24A 3T20A 2YNKA 3VY8X 5DL6A 3AA6B 2F1TA 2LHFA 5DL7A 1Q9FA 4AUIA 4G75A 4LSFA 1GFQA 2PRNA 4FUVA 4JFBA 3EMNX 3UU2A 5GV0A 2XG6A 3AA0B 3AAEA 2MNHA 4FZNA 3HW9A 4BUMX 4XNKA 2J1NA 2O4VA 3TZGA 4O3YA 2W80C 3AAEB 1HXUA 2XE2A 1ZHWA 3HOEA 4O3XB 1BXWA 4GCSA 4F4BA 4FRTA 2KZ7A 3LK2A 3VE2A 5T5FA 4GF4A 4AYID 4O4UA 1P4TA 2K4TA 3VZUX 1BT9A 3UPGA 2QTKA 5ADXK 4AYDC 5JDPA 1THQA 2M07A 3PQSA 2KXPB 3AA7A 2ODJA 1ZHTA 1BH3A 2XE3A 4D64A 2Y0KA 5EE2A 2YPVA 3DA3A 1MM4A 4KRAA 2OMFA 5DL8A 3LK3B 3AA7B 3VZTX 1Q9GA 6PRNA 1MM5A 3A2SX 1OSMA 4JCHA 3AA0A 5G26A 3WI5A 1OPFA 3JTYA 4FSOA 1ZHZA 4Z3TA 3O0EA 5AFUK 1QJ8A 3PRNA 1PHOA 3QRCA 4G76A 4AKMA 3VY9X 3K19A 3SY7A 1PRNA 1MPFA 3C5OA 7PRNA 2MHLA 2PORA 4RJXA 5PRNA 3POQA 3PQUA 4RLCA 2KXPA 2K0LA 2Y0HA 2N2LA 1G90A 2Y0LA 2XMXA 3LK3A 5D5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8PRN A;  4LSI A;  1GFP A;  2ZLD A;  3HWB A;  4RJW A;  4FOZ A;  4D65 A;  2J4U P;  1GFO A;  5DL5 A;  1HXT A;  4KR4 A;  3POR A;  2ZFG A;  1HXX A;  4LSH A;  1H6S 1;  3SYB A;  3FYX A;  3SZV A;  3SYS A;  1GFN A;  4C69 X;  3POU A;  2FGR A;  2XE5 A;  2Y2X A;  4FSP A;  4LSE A;  4GCQ A;  3WI4 A;  3SZD A;  4FT6 A;  4FMS A;  2FGQ X;  3VZW X;  1GFM A;  3SY9 A;  3T0S A;  5FVN A;  2XE1 A;  4D5U A;  1E54 A;  4FRX A;  4GCP A;  3NSG A;  3POX A;  4KR8 A;  3T24 A;  3T20 A;  3VY8 X;  5DL6 A;  5DL7 A;  4AUI A;  4LSF A;  1GFQ A;  2PRN A;  4JFB A;  3UU2 A;  3EMN X;  2XG6 A;  3HW9 A;  4BUM X;  2J1N A;  2O4V A;  1HXU A;  2XE2 A;  4GCS A;  4FRT A;  2K4T A;  3VZU X;  1BT9 A;  3UPG A;  2QTK A;  5JDP A;  4D64 A;  2ODJ A;  1BH3 A;  2XE3 A;  2Y0K A;  5DL8 A;  4KRA A;  2OMF A;  3VZT X;  6PRN A;  3A2S X;  1OSM A;  3WI5 A;  1OPF A;  3JTY A;  4FSO A;  3O0E A;  3PRN A;  1PHO A;  3VY9 X;  3K19 A;  3SY7 A;  1PRN A;  1MPF A;  7PRN A;  2POR A;  4RJX A;  5PRN A;  3POQ A;  2Y0H A;  2Y0L A; 
#chains in the Genus database with same CATH topology
 8PRN A;  4LSI A;  1GFP A;  3LK4 2;  2ZLD A;  3HWB A;  4AKR B;  4FZM A;  4RJW A;  3DA4 A;  5IYU A;  4FOZ A;  4E1T A;  4O3W A;  2Y7S A;  2WVP A;  4D65 A;  3AA1 B;  2J4U P;  1GFO A;  4O4X A;  1QJP A;  5DL5 A;  1HXT A;  4AZL A;  4D64 A;  4KR4 A;  2R4N A;  3POR A;  4N59 A;  2X27 X;  2R8A A;  1HXX A;  2JMM A;  2ZFG A;  1ORM A;  4LSH A;  1H6S 1;  3SYB A;  4AYM C;  4FZL A;  3HOL A;  2R4L A;  2M06 A;  4C4V B;  3FYX A;  2LFU A;  4AYN A;  2AXT O;  3SZV A;  3JCU O;  3SYS A;  3PF1 A;  1GFN A;  3G7G A;  4AYE C;  4C69 X;  4FQE A;  3POU A;  4RL9 A;  4O49 A;  1QJ9 A;  2N2M A;  3PGR A;  4N58 A;  4U9C A;  4UB8 O;  3BS0 A;  3RBH A;  2FGR A;  2XE5 A;  2Y2X A;  3QRA A;  4QQ1 A;  4FSP A;  3KVD D;  4RLB A;  4AKR A;  4LSE A;  3LK4 1;  4FES A;  4B61 A;  5GTH O;  3AA1 A;  2XTQ A;  2KDY A;  2F1V A;  4GCQ A;  1IZN A;  3AAA A;  4PR7 A;  2KC0 A;  3SZD A;  3UAQ A;  3WI4 A;  5B66 O;  3DZM A;  5ADX L;  1IZN B;  2XTR A;  4FT6 A;  4O3Z A;  4PUX A;  3AAA B;  4IL6 O;  2GE4 A;  4FMS A;  2W81 C;  2FGQ X;  3VZW X;  1GFM A;  1YS5 A;  3A0H O;  4XNL A;  4GHB A;  3SY9 A;  3T0S A;  4C4V A;  5FVN A;  5G3A A;  2XE1 A;  4AFK A;  2ERV A;  2KZ7 B;  3LK2 B;  3V8U A;  4D5U A;  1E54 A;  1ZHY A;  2X9K A;  4FRX A;  4GCP A;  4K3C A;  3NSG A;  4E1S A;  1ZHX A;  3POX A;  3VE1 A;  3GP6 A;  4KR8 A;  5AFU L;  3AA6 A;  3T24 A;  4C00 A;  2YNK A;  3VY8 X;  3T20 A;  5DL6 A;  3AA6 B;  2F1T A;  2LHF A;  5DL7 A;  1Q9F A;  4AUI A;  4G75 A;  4LSF A;  2R89 A;  1GFQ A;  2F1C X;  2PRN A;  3PGU A;  4FUV A;  3EMN X;  3A0B O;  4JFB A;  3UU2 A;  5GV0 A;  2XG6 A;  3AA0 B;  3DWN A;  5TIS O;  4K3B A;  3AAE A;  2MNH A;  5G39 A;  4FZN A;  3HW9 A;  4BUM X;  4XNK A;  1T16 A;  2J1N A;  2O4V A;  4O3Y A;  5KAI O;  3TZG A;  2W80 C;  3AAE B;  1HXU A;  2WJR A;  2XE2 A;  1ZHW A;  3BRZ A;  3HOE A;  4O3X B;  1BXW A;  4GCS A;  4F4B A;  4FRT A;  2KZ7 A;  3LK2 A;  3VE2 A;  2WJQ A;  5T5F A;  4GF4 A;  4AYI D;  4O4U A;  1P4T A;  1T1L A;  2K4T A;  1BT9 A;  3VZU X;  3UPG A;  2QTK A;  5ADX K;  4AYD C;  5JDP A;  1THQ A;  2M07 A;  3PGS A;  3PQS A;  2KXP B;  5B5E O;  3AA7 A;  2ODJ A;  1ZHT A;  1BH3 A;  2XE3 A;  3WU2 O;  2Y0K A;  5EE2 A;  2YPV A;  3DA3 A;  1MM4 A;  4KRA A;  2OMF A;  5DL8 A;  3LK3 B;  3NJT A;  3AA7 B;  3KZI O;  4N75 A;  1Q9G A;  3VZT X;  6PRN A;  1MM5 A;  5G38 A;  3A2S X;  1OSM A;  4JCH A;  3AA0 A;  5G26 A;  3WI5 A;  1OPF A;  3JTY A;  4FSO A;  1ZHZ A;  4Z3T A;  3O0E A;  5AFU K;  2R4O A;  1QJ8 A;  5GTI O;  3PRN A;  1PHO A;  3QRC A;  4G76 A;  4AKM A;  3VY9 X;  2JQY A;  3K19 A;  2R88 A;  3SY7 A;  5E79 O;  1S5L O;  1PRN A;  3BRY A;  1MPF A;  3C5O A;  7PRN A;  2MHL A;  2POR A;  4N74 A;  4RJX A;  2R4P A;  5PRN A;  3POQ A;  3PQU A;  4RLC A;  5H2F O;  2KXP A;  5KAF O;  4CTD A;  2IWV A;  2K0L A;  2Y0H A;  2N2L A;  3DWO X;  4UB6 O;  1G90 A;  2Y0L A;  2XMX A;  2IWW A;  4PJ0 O;  3LK3 A;  5D5D A; 
#chains in the Genus database with same CATH homology
 8PRN A;  4LSI A;  1GFP A;  3LK4 2;  2ZLD A;  3HWB A;  4AKR B;  4FZM A;  4RJW A;  3DA4 A;  5IYU A;  4FOZ A;  4E1T A;  4O3W A;  2Y7S A;  4D65 A;  3AA1 B;  2J4U P;  1GFO A;  4O4X A;  1QJP A;  5DL5 A;  1HXT A;  4AZL A;  4KR4 A;  4N59 A;  3POR A;  2X27 X;  2ZFG A;  1HXX A;  2JMM A;  1ORM A;  4LSH A;  1H6S 1;  3SYB A;  4AYM C;  4FZL A;  3HOL A;  2M06 A;  3FYX A;  2LFU A;  4AYN A;  3SZV A;  3SYS A;  1GFN A;  3G7G A;  4AYE C;  4C69 X;  4RL9 A;  3POU A;  4O49 A;  1QJ9 A;  2N2M A;  4N58 A;  4U9C A;  3RBH A;  2FGR A;  2XE5 A;  2Y2X A;  3QRA A;  4QQ1 A;  4FSP A;  3KVD D;  4RLB A;  4AKR A;  4LSE A;  3LK4 1;  4FES A;  4B61 A;  3AA1 A;  2XTQ A;  2KDY A;  2F1V A;  4GCQ A;  1IZN A;  3AAA A;  3UAQ A;  2KC0 A;  3SZD A;  3WI4 A;  5ADX L;  1IZN B;  2XTR A;  4FT6 A;  4O3Z A;  4PUX A;  3AAA B;  2GE4 A;  4FMS A;  2W81 C;  2FGQ X;  3VZW X;  1GFM A;  1YS5 A;  4XNL A;  3SY9 A;  4GHB A;  3T0S A;  5FVN A;  2XE1 A;  4AFK A;  2ERV A;  2KZ7 B;  3LK2 B;  3V8U A;  4D5U A;  1E54 A;  1ZHY A;  4E1S A;  4FRX A;  4GCP A;  3NSG A;  1ZHX A;  3POX A;  3VE1 A;  3GP6 A;  4KR8 A;  5AFU L;  3AA6 A;  3T24 A;  3T20 A;  2YNK A;  3VY8 X;  5DL6 A;  3AA6 B;  2F1T A;  2LHF A;  5DL7 A;  1Q9F A;  4AUI A;  4G75 A;  4LSF A;  1GFQ A;  2PRN A;  4FUV A;  4JFB A;  3EMN X;  3UU2 A;  5GV0 A;  2XG6 A;  3AA0 B;  3AAE A;  2MNH A;  4FZN A;  3HW9 A;  4BUM X;  4XNK A;  2J1N A;  2O4V A;  3TZG A;  4O3Y A;  2W80 C;  3AAE B;  1HXU A;  2XE2 A;  1ZHW A;  3HOE A;  4O3X B;  1BXW A;  4GCS A;  4F4B A;  4FRT A;  2KZ7 A;  3LK2 A;  3VE2 A;  5T5F A;  4GF4 A;  4AYI D;  4O4U A;  1P4T A;  2K4T A;  3VZU X;  1BT9 A;  3UPG A;  2QTK A;  5ADX K;  4AYD C;  5JDP A;  1THQ A;  2M07 A;  3PQS A;  2KXP B;  3AA7 A;  2ODJ A;  1ZHT A;  1BH3 A;  2XE3 A;  4D64 A;  2Y0K A;  5EE2 A;  2YPV A;  3DA3 A;  1MM4 A;  4KRA A;  2OMF A;  5DL8 A;  3LK3 B;  3AA7 B;  3VZT X;  1Q9G A;  6PRN A;  1MM5 A;  3A2S X;  1OSM A;  4JCH A;  3AA0 A;  5G26 A;  3WI5 A;  1OPF A;  3JTY A;  4FSO A;  1ZHZ A;  4Z3T A;  3O0E A;  5AFU K;  1QJ8 A;  3PRN A;  1PHO A;  3QRC A;  4G76 A;  4AKM A;  3VY9 X;  3K19 A;  3SY7 A;  1PRN A;  1MPF A;  3C5O A;  7PRN A;  2MHL A;  2POR A;  4RJX A;  5PRN A;  3POQ A;  3PQU A;  4RLC A;  2KXP A;  2K0L A;  2Y0H A;  2N2L A;  1G90 A;  2Y0L A;  2XMX A;  3LK3 A;  5D5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...