4AYID

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 wild type
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
b'LADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayiD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayiD01
2KDYA 3UAQA 5EE2A 3HOLA 1YS5A 5T5FA 3V8UA 4O3XB 4AYEC 4O49A 4AYID 3VE2A 4AYDC 4O3ZA 2LFUA 2W81C 4O4XA 4O3WA 3VE1A 3HOEA 4O3YA 4U9CA 3PQUA 2Y7SA 4AYMC 2W80C 4Z3TA 4AYNA 2YPVA 4O4UA 3PQSA 2KC0A 4QQ1A 3KVDD
chains in the Genus database with same CATH superfamily
4XWGH 1J10A 1N10A 4NPKA 1AGDA 1E9QB 5SX5H 1R3HB 3RDTD 3SQBB 4P5TB 3VQLA 3FH8A 3BHBA 4RFEA 3K6SA 1DUYB 1B2YA 4JZJC 1J0HA 1PBYA 1MFEL 4I77H 4OLUH 2O61B 4QO1B 5DEFA 5KBPA 3ML9A 2B4CC 5I8OH 3A23A 4G9DB 4LVNB 1I1CA 4N8VB 4KTGA 5TF1L 2VR8A 3TLRA 3SO3B 2WVVA 3OL2A 3QDGE 4M1GL 1K85A 2F1VA 3EZ8A 1KTLB 1MCHA 4AZ8A 4AIZA 3EH4B 4X8CA 3EJPA 4BKLB 5DQDL 5AZ2H 1ZJAA 5AWNL 4X5RA 5FEBA 4Q9QH 3LDBB 2JCCB 4P5RA 3T5WA 3W9EB 4NN7C 4HXAH 1ZEAH 1X4XA 4AQAA 2HKHH 2VLJA 4P46D 2WD0A 2CGYA 4F37F 4F8NA 1UEMA 2VN4A 1ZHTA 1MHHA 1JV2A 4NZRL 4M7JH 3G5VA 3PF2A 3L4YA 4X8XA 7PCYA 2ED7A 1NPUA 5D7SL 3P30L 4DGVL 4FXGA 3HLKA 2VSDA 3FHAA 4BELD 4HALA 1T1ZA 5F21B 3II3A 4OCWL 5AVSB 4YXLH 2B9BA 5FYJH 2CPUA 3C8HA 3Q6GL 3QYNA 3QRFM 4LL9A 4RAVB 3C09C 4L8CB 3AT8A 4O5LH 1P2CB 5BS0A 4DK6A 5GXBB 1IKFL 2XN9B 3B37A 5CD5C 1QJ9A 2FO1A 3TA3C 4XP9H 1D9KD 4F92B 2UX6A 4ZUTB 1IFRA 2AJUH 3CFDA 3M45A 4JB9H 2P52A 4APQD 3BH9A 1XIWD 2VXQA 2WQVA 3IF1B 3VTMA 2P8LB 4PJCA 4CVWA 4PJIB 5I1CH 3CVDA 4M03A 5E5RB 1CFVL 3RB7A 3T8MA 2EDHA 5E5MB 5D70L 4U1GC 2G3MA 3TT1H 1AS8A 4D65A 1CZ8H 1LGVA 3OKOA 5GPRA 3RG1C 5B1JC 2DBLH 2DD8L 3ZSSA 5H94B 4KKNA 2K70A 3WS6C 5ID0A 2IALB 4ZQKB 3GXIA 2YQ3A 1G4MA 2RBLA 3RDTA 2VDPH 3V9EA 4KVNL 4P23D 1RK1B 1PKQB 5GS1B 2Q87A 4KDVA 4AIOA 1BBJB 4EKJA 2BY0A 3APCA 4KI5F 1UJ3C 4GQRA 2WWMC 4L1BA 1FIGH 1ACYL 2HRPL 5EO0A 1G7PB 1N64L 5LNEA 3V0WH 4DGWC 4WI5A 2CLZB 4LRIC 3VWJC 3IVKB 5C0DB 4XN8A 2QVIA 5C0RH 2X12A 2GPZA 2G9HA 1FAKT 2EADA 4U1IA 3I75A 2GJZA 3K8KA 3ISRA 4E9LA 2NTSP 3O2DL 1YEDA 1LM8V 3QHFL 1RAMA 4OFQA 1WAEA 4LCCB 3OPZL 4K7PL 5ENWB 4CVXB 2ZP8A 3IDMA 3D69A 4P3CL 3D39D 1U8NB 3F7PC 4LVOC 1XGUA 1OTSC 1XCTB 1SQ2N 3NA4A 1P7QD 3PAZA 1WFUA 2IDSA 4CMMA 1CD1B 3GZQA 2R7EB 2WYHA 4XX5A 4XPHH 4FQHA 1T6BX 4L3EB 1KZYA 2NRDA 3L1OL 3RA7L 2WHVA 4I18B 4JFXA 1IUZA 5ITFB 3V0DA 1BD2B 5IBLD 4H1LG 2XWTA 2XACC 4UANA 4GYBA 1TCRB 4L37A 5E2TH 2ENQA 4M62H 2JK5A 1IQDB 5I1DA 3IJHB 3KLLA 5D2LB 4H8QA 3H9SD 1OM3H 3VWKB 1DYZA 3D0VB 3C6SB 3GWJA 4LLVB 1D9KA 2O6FA 4H5SA 3U4AA 4H40A 5F3BA 1KACB 3LK2A 1AD0B 4G6AC 3BE1H 3WUWA 2Y2XA 1NCJA 2R0ZL 4RMBA 4APQA 3QCVH 4G7SB 3MJWA 1A0QL 1OK0A 3O2VL 1XIWA 2IH8A 4IGBD 4EUPH 4HLEA 5C0AE 5JW5A 3CZSA 3ETBF 2L7UA 4DIXA 5EZJA 3VXRE 1U93A 5IM7A 4UQ3A 1PJ9A 2R27A 5FFOA 1F4HA 3TONA 3V55A 1J5OL 4W4NA 4K3EL 5D4QA 2IFFL 4CJ0A 1ZHXA 1OP5K 2IOIA 4Y4HD 4A2LA 3L3KA 2VT0A 3TURA 5H35A 4W9JC 4X6CE 3AFLA 2V9UA 4P23A 3NZHH 3VFRB 3ZHNA 5C7ZA 3PWPB 4P59L 3GBLA 4WY7L 3FN0L 1UM4H 5ACMA 3MRQA 4PRIB 3U7WL 1YHPA 3ZTJH 1GOGA 2A73B 4CN6A 5J9PB 2C34A 2UXVA 1YY9C 1FN4B 1YQVL 3P0YH 2HFGL 2Z93B 3GJEA 1WFIA 2MH4A 2CO2A 4FT6A 2VE6B 3QULB 1U33A 3E3QE 1N70A 4C83B 1XH3A 3SZKC 3T9WA 3QP3A 3EGDA 3IMVA 5CIPA 3NFPA 1MWAA 4ONGH 3BRGC 1QUPA 4ZYKA 3D39A 1QA9B 3VFPA 1W0VB 2J73A 4CMHC 2NTFA 2P5WE 1BZEA 4LFHD 4Q0XH 3KL3A 1CFBA 1P7QA 4QXVA 4RISL 4TL5A 4YHYC 4MSWB 4PJHA 3C5JA 1HOCA 3SDXA 5GTHO 4PJAE 4WU7B 3GXUB 4P4KB 3BVNB 4NQTA 5FGSA 1GGYA 5L9DH 5E2UH 3CN0A 3BPNB 4V2CB 4U33A 1OAKH 1Q9WA 2B16A 4Y0GA 5CWSB 5F7YC 1QYGH 4P2CG 2VTFA 4FNTA 3MRNA 3UZEA 3IAPA 4JFEB 2XTQA 3DVNB 4RWHA 4B96A 4LDLB 1I1YB 4MMYB 4KR4A 2F58H 3H9SA 2NZ9D 1LDSA 5JOFB 2B08A 5EWIH 3PJSB 1BV8A 2EDMA 1NLDL 2ERJC 1RY7B 3ZZLA 4GRWE 4YL4A 4YE0A 4U0RB 2OMUB 4Y5XC 1M7DA 1HSAA 2XWBA 5I26A 2VH5H 4JFFE 4LAQH 3GBNL 4LLYA 5AW7B 4IGBA 1DLFL 3IM1A 1DJXA 5B38A 2MIZA 1AQDA 2XTLA 3NIGE 1A22B 3TESA 1F3RB 1ZA3A 4KI5C 2YBGA 5ESQA 4N6QA 3UROR 3N44B 1CLZH 2BIIA 1AIFA 1IBGL 3ATFA 1DCEA 4LNRB 4YR6A 3ESOA 2KL6A 1HESA 4Y4HA 4ESKA 2APSA 2ODIA 2Z35B 4MNGB 4HPOL 2NQ3A 4PWJA 2VAAB 3NJFA 2BY1A 2V3EA 1FVDB 4V11A 1KB5L 1ZSDA 5HDRA 1XZWA 3EO1B 4XZUA 3F12A 3ESVF 4R26L 1CDIA 5DVMA 3MCG1 1MH5B 1L9PA 1TZIB 4MDJA 5A16B 1D5ZA 5FCSH 2J1NA 3LB6D 1IGJA 1ZGLB 3AA6B 3K6IA 4YDVA 1A1NB 4YHNA 1CC3A 3GUFA 2YGNA 1UH3A 5GGRY 3AXLB 4Z3FA 1K8DB 1JGEA 5DA4A 4ORZC 4QRSB 5TPWH 5K9JL 1E6JH 2XOTA 2VWEE 4JRFA 2R39A 4FQJH 3B9KD 1MW0A 4RMSA 1S7QB 2BZ7A 3DZMA 3JWDC 1FWXA 4WNJA 3FFCE 3OKKA 2H0JA 4LCIL 1HN1A 1U3HC 4NIYE 5FM5O 4U3XA 3U0WL 4GSRA 4NPYB 4B50A 3ELQA 4KRNA 1IM9D 1QNIA 1J5CA 4DAGL 4ZW8A 3AADB 4K3JH 5JPNB 2DV6A 4CC1A 1KGXA 2Z3FA 4QXGH 2HT3D 2O5XH 1ORSA 2BMKA 3CVIL 3V5DA 4D7PA 2A5UA 4ZFGL 5EIIB 1WRFA 1JRHH 2IBBA 4F8PA 1E43A 3FB5A 3KVDD 1SJXA 1PZ3A 1N0XH 3CSPA 5KW9L 1Q0YH 4AGOA 3H1ZA 4MJ5A 2EDXA 5F89A 2QSCH 1W72A 3NBNA 5K39A 2O6CA 1DQKA 2IWVA 4CUCA 4V1DE 3T6WA 1PD0A 1FL5A 2FVNA 1SLUA 1PZDA 1WTLA 5JA9A 1F1AA 4OGZA 4HK0B 2R29L 3CZUB 3U82B 5TE4H 3BOVA 1SYSB 4R9HA 1UWYA 4YHMH 3L3OA 4LBEB 4NQSB 3BFWA 4GNKB 1H6S1 5C0BE 4NB7A 5G2NA 3ZQ9A 4IMKC 2XKNB 4AYFB 3RBGA 4PV1C 3QRAA 1Q72L 3E2HB 2VN3A 1H15A 4EMZA 4KMLB 3ATBA 4BFIA 2G2PA 3KLQA 4NERA 1JGVH 1UYWL 4WDIA 3UIZA 4WSKA 2QTKA 5DTFB 1A6VL 1MIEH 1C8QA 1K6QL 4EN3B 3PP4L 4Z77B 3CAFA 1YRKA 3D87B 1E2ZA 2HKAA 2XDHA 1A3LL 5KSBA 2FGQX 2V9TA 4NRYA 4JPWL 1SXZA 3QYMA 3VD7A 3PV6B 3VFUA 1TQTA 1QFPA 2E3VA 3TIDA 1HQRA 4K8RC 3KPSB 1ZAGA 3Q8AA 1BQ5A 4GQZA 1HZHH 4G8IB 7FABL 4NBZB 4FQCH 3B9KA 5AVZB 3LIZA 3V5KB 2R0LH 3ZDZB 4JFOB 5FECB 5CKAA 4F3FB 1NOLA 5CCHE 1AGCB 1NCOA 2HJLA 2Q8BL 3PF1A 2JELH 1ADWA 4QRTA 3PIQB 3LZFH 4IS6A 4P04A 2ICEA 3IYLW 5FKAA 3RWEB 1KEMH 4YHIB 4RMUA 4M7LT 3R8QA 1CGXA 4PJDE 3MO1A 1IM9A 1EJOL 2PWDA 3CSFA 1GJWA 1KJMB 1HINL 2ALAA 2IEPA 4JFWA 3U0PB 3WN5B 2NUPA 3VMPA 1OLLA 4TPRL 1B0GA 1QUNB 4S1DD 4DN4H 2Y0SA 1NC4B 3VNYA 4WIQA 1N6QH 1QO3A 1NZRA 4D0DA 1T1XB 3II1A 1NCWL 1JYVA 1BQLH 3DMMC 4TSBL 1BEYL 3UG4A 3MLZL 1X4YA 3QNXB 2X53A 2PMZA 3P3YA 4Z7NF 3L7FB 1LMIA 4YE4H 1AXIB 5A2IH 4BSWA 1T16A 1S5LO 3G6DL 1KGUA 2VDRL 1ACXA 3HG0A 1FFRA 4FNQA 3AWGA 1AGDB 5I0ZA 1N7MH 5DZJA 5T3ZD 3OAZH 1HXXA 1IU1A 3BHBB 4RFEB 3K6SB 2GB2A 5E6SB 4ENED 4KXZI 1SHMA 4W9IC 4LAJH 3M8OL 2LABA 3H7BA 2VM9A 3TPKA 3QIBC 5GRVK 1JF5A 1E5BA 8PRNA 2NY7H 1GFPA 4KZDL 1Q0XL 4OF0A 4Z0XA 2WVVB 4L4JA 4F20A 1MFNA 4HWBH 1S9KC 4XMWA 4AZ8B 4AIZB 4RRPG 4BIKA 1OE1A 5DJDA 5FYKE 1WTGT 5KEZA 4HCRH 1JTOA 1KN2H 1XO8A 1IAKA 2V17L 4PG9B 3KWUA 2DN7A 1MCIA 3WTUA 1TVHA 2AP2A 3NJKA 2VDOL 2NY5H 2W91A 3FT0A 4AQAB 2VLJB 1T5WA 4QJ3B 2NR6C 4HUMB 5A2AA 1MHHB 1JV2B 2CBMA 2GAZA 2NLJA 3G5VB 4R6UA 1OCRB 1PZ2A 2YN5A 3DKHA 4FXGB 1UWGH 4LLMB 4EI0A 2X0VA 1T1ZB 1Y6NR 1UXMA 4N0RA 1J12A 2X05A 2F8OA 3QS2A 4AVIA 4O9HH 1CDUA 1QG3A 1NKOA 1ZLEA 1T7ZA 4PJGF 1XL4A 1WYJA 3GK8H 1JGIA 2D7TH 3AVEA 5D7IA 5J11C 3CFDB 2WLIA 3MUGA 3PDGA 3VGAB 4YDJA 1M3JA 2QSQA 3RQ3A 2X41A 3FB8B 1J0JA 4PJCB 1FNAA 1FNHA 2EEBA 2F1BA 5D1QE 3UC0H 2CKBL 1EERB 3W11C 1L0YA 2WVSA 3DXAE 2NY4B 3MNZA 3FT3A 3P2DA 4QWWC 5BCAA 1DBKL 2F19H 2AJXH 1GC1C 1RZ8A 2P24A 1JWSA 4AIEA 5I8KH 4FMKA 1XF3A 3T0XA 5DMYA 2X0UA 4B97A 1EZVY 4KUZH 2PWEA 5CAYB 2H6UA 1SOQA 3QXTA 4YDIL 4FQIH 5FO9A 2A99A 3RIKA 4RWYL 3IAQA 3VB8A 4WW1A 5F1SA 1CJYA 1MOEA 3L4XA 4OJAA 2VJXA 4LPXA 4HD9A 1CLOH 1SEQL 3GO1H 3PGFL 5HI3D 5EO0B 3BRYA 3GLAA 4MA3A 2ORBH 3LH2L 5C0EA 5B7FA 3RZWA 3MROA 3W2DH 4K15A 1FIEA 2G9HB 2WXRA 2FLMA 4MLSA 1KLUB 2JF1A 3LQZB 4HHGA 4U1IB 3BKCL 3Q06A 5DRNB 2GJZB 4U6VL 5HHNB 1E90A 1NSNH 2EDWA 2DQIH 2RIKA 3U7AA 1HT6A 2AXGB 3IDMB 3D69B 3AGVA 1DVZA 1XGUB 1WF5A 4EN2A 1JZIA 1DFBL 3MRHA 1RI8A 3CSTA 3VAEA 4CMMB 3OKNA 4IBTA 2DLEA 3BAKA 3SHSA 4FA6A 4X4YA 5I1LA 3QUZD 4EO5A 1NCAH 2MTAA 5AAMC 3OMIB 4FQHB 5LWYH 1D7BA 3QFDA 3N0AA 5ANME 2XVGA 4CJ1A 1MIML 5C07E 2XWTB 2HUHA 3NCCB 2C3VA 3OJ2C 5D8JH 2X40A 5AYUH 4L37B 4JHUA 2JK5B 3G3LA 3HI6L 4QHKI 5EORL 5I1DB 3ULUL 4UMGA 2XZCH 3BPCB 4QHKJ 1MQ8A 3RL2A 5DL7A 3QJTB 1U3YA 1SEBB 1D9KB 4H5SB 3MACL 5F3BB 3LK2B 1CF8L 1A7RH 3WUWB 3RY4A 2EO9A 4HMDA 4UB6O 4APQB 4CAGA 1E2WA 6PCYA 5IV2A 1XIWB 1F86A 4LHUD 4PHXA 4X7SL 2EDFA 3TO4D 4IJ3C 5JW5B 4C4KT 3FU7A 4X7CC 5IFAH 3SE4A 4FOMA 4GKNB 1JK8A 5EZJB 1U93B 4UQ3B 4ODXA 4LDOB 3N06B 3PLYA 5HGHA 1OAYH 5EEYA 4D9LL 4XBGA 4IOIA 4HJ0C 4H13C 1CE1L 1KXVA 3U9PL 2ATAA 2VQ4A 3KPLA 2VKXA 1QSEE 2Y06H 1HYSD 3BMVA 3LYRA 2JQYA 4P23B 2VW6A 2GTZA 2WJ7A 4IEFA 2IAND 3H55A 3LNIA 3BP7A 4OD3L 3MRQB 4NZDA 1A25A 2FWUA 1XCWA 2VXUL 4OFPA 4GKSB 3IE9A 1DSFL 3GJEB 2WXQA 2OSYA 2E9WA 2I26N 4FFTA 3VGGA 1PSKL 1XH3B 4L4VE 3FL7A 4L2YA 3U1QA 2OMBA 3EGDB 3TVMD 1SVZA 5CIPB 3NFPB 1OPGH 5T33H 1C7TA 5MP6L 1AR2A 1MWAB 2I25N 3D1MC 3M07A 3KDPB 4ZYKB 1F3JA 1OP9A 3VFPB 1UD8A 4XX1G 2NTFB 5DA0B 2DB8A 3EIFA 4S0SD 1P7QB 1FHNA 4KVCL 3GZPA 3C5JB 1HOCB 3KYAA 3A4AA 1BM3H 4PJHB 3QUZA 1USZA 2DQUH 2C9XA 2E6PA 4AK2A 2R2BA 4OF3A 5LBSH 5FYLH 3FB7A 3MR9A 3PXJA 4JMNA 1R0AH 4G2AA 2LGNA 4Y5YA 3T0WA 3SBWC 3CX5J 3EYFA 5I5MA 4MJ2A 1ULVA 3MRNB 5LG1A 4ODSL 5EMYA 1BOGA 3LMJH 3U83A 4RA0C 3B2MA 1DSYA 3GMMA 4TQIA 2F5AL 4UT6A 4K9EH 1I8UA 2WKLA 3D4GA 5TQ2H 3TNMB 4Z78A 2EXWC 4GW1A 3ARYA 2V9RA 4NO2A 3O3BA 4DOHE 3C5ZB 1WS8A 1TJHH 2KLRA 5LAXA 3NJIA 4JRLA 1HSAB 2XWBB 4MMXC 3BD4A 1AXTH 4BFJA 4LHUA 3AWFA 4PJ7F 4IGBB 5CJBA 3QZOA 3TO4A 1N3NA 2X6BA 5B38B 1R19A 1AQDB 3MKGA 3EKCA 5JHLA 2ZFGA 4YHZH 4NM4L 4EJ1C 1F58H 4PRHD 5TJWK 5ESQB 5E95B 1UUNA 4I9WE 1FSKB 1H8SA 3LZPA 1AIFB 3CBJB 5L2JB 2ZIDA 1MHEA 4YR6B 4Y4HB 3GSVA 4GAYB 1LP9A 2JNZA 1HFUA 2GVYA 1X5GA 5AVRB 4AQ1A 4I1PA 1E6OH 5J1AA 3HG5A 2YR3A 4YFLF 5FPIA 4XZUB 3F12B 1U4FA 1XXFC 2IANA 1R5WA 3CVHL 4ZTOH 5B8CA 4OCYH 4OGYL 4RZCA 1D5ZB 4JFDE 1IGJB 4YHNB 3L54A 4R4NC 4Y9EA 2C3HA 3CX5K 1VFBA 1FH2A 2YZ8A 4N2AA 4BZ1L 4ZMZA 2FYYB 4DK3A 4YSEA 4AOFA 5B4MD 4LCWE 1PY9A 1JUFB 2ZF9A 3LKRB 4UUJA 1E5CA 1R24A 3SE9H 4F7CA 2MJWA 3QDMD 1P7KA 4YHKL 4PB0H 5CJOL 5KOVC 2FHBA 2DEYX 3TVMA 1AY1H 3OKKB 4M00A 3NK4A 1U92A 3GSWA 4GKZA 3QUML 4WGWB 5ECGA 4JKMA 1WSST 4P07A 3RI5K 1MAMH 1E50A 5B1KA 5A6MA 1QBML 1GHFH 3WHE0 1XAKA 1M4KA 4WTZG 2WLLA 5DS8A 1LO3H 4OTXL 1OTTC 1MHPH 5H4YA 5BZWA 1BQKA 2BMKB 3V5DB 2CD0A 2GHWB 4Z3EA 4FQEA 4K5NA 3E1F1 3KJ4C 3BQVA 3FB5B 2X89A 1FO0L 3L4VA 4R96A 2ZNXA 1ETA1 2DYRB 4WUUA 4MJ5B 1KBGH 4U1NA 2WSKA 3QEQE 1BVNP 5F89B 43CAA 5HBBA 5A7EA 1F18A 1W72B 5K39B 4XP1L 4K8RH 4AKOA 2BNQE 5DL8A 3WKMH 5C0GA 2Y72A 1WO2A 1KDIA 2XFXB 1FL5B 3VW3H 3BSZA 4F7EA 1MPAH 1J9QA 1LVEA 3LNDA 3B43A 3OKEA 4YGVA 4MZIA 5AG8A 4ZS6C 4E41D 3WN6A 4NNXA 4AFKA 1S78D 2QADC 4UWQB 5T1DH 4R5XA 4BFGA 2P80D 2WXLA 3L3OB 2VMFA 1X5HA 1U3NA 1QSFD 4PRHA 4AWJC 3A24A 1QTSA 3PHSA 1QW8A 1TZAA 5SX4H 3L13A 1CK0H 2N56A 4Q6KA 4ZX4A 3LXAA 4PWKA 3GXFA 3MRBA 4AYMC 2Y23A 5IHZA 3C5XA 2ZTBA 5H37H 1H15B 1I9EA 2AANA 4G6KL 4JFZL 4BFIB 1RUAH 3WIIL 1G84A 3INUL 2O5NA 1A6UL 3BQUD 2R89A 3TWCL 3N3EA 4WDIB 4R83A 2E9GA 3VX0A 1UFUA 4X6EA 1JHTA 3S8GB 4KXBA 2D9QB 2ZOKA 2C7FA 3W37A 2KZ7A 5KSBB 4NRYB 4HC1H 5KYXA 3WTSA 3ZTJG 1R1CA 4NKIL 2MCPL 1HQRB 2ARWA 3MJ7A 3TIDB 4I2XE 5F9AC 5GGQL 2ENJA 3CU7A 3ECQA 2VJ8A 3B9KB 4L5FL 3A67L 1PAMA 3HRZC 3CPLA 1H3GA 3QDMA 4HS8H 4XNBA 4OZGE 4XZ4A 1RZKC 1MJJB 1NL0H 2HJLB 3IT8D 4JHZA 4NWTH 4QRTB 5CLXA 1RCYA 1YJDL 3NFNB 5F3FA 5FKAB 2ICEB 2JB6A 4R5TA 3WNKA 4Q9CA 1H3VA 3B7UX 3QDGD 1E5YA 3M6DA 3MO1B 1IM9B 4DQAA 4HG4J 4N20A 4G76A 3HA0A 4MS6A 5TDOA 4AJYV 5E8EA 2IWKA 4OGAC 3MBXL 1B0GB 4OJEH 3QRGL 1UOKA 1EFXD 5L2KD 3F00A 4FSOA 3RLSA 2JWYA 3GJFH 1QO3B 1LEGA 2DMKA 3K6NA 3S98A 4IOSD 5C2BL 6FABL 4JFYB 4UB0H 3MTXA 2Z8SA 3RTQD 2WQWA 3DX7A 1CFMA 2C1OB 2E27H 3K1DA 3JWNC 4XOCA 1U4EA 3WDJA 1D5IH 3QFJE 1MFBH 4M61A 5IGXH 1SY6L 3ZVVA 4BSWB 5CLZA 4WI8A 4ZX6A 1PL3A 3POXA 2ZG2A 4FFYH 4HJUA 2B1HH 5MI0B 2QQNH 2BDNH 3UBXA 3QUYD 4Y2NA 5GGVY 4FXKA 4FABL 5I73C 2QV2A 2X4SA 4EQ3A 4E41A 2WLZA 4LHJB 3OZ9L 2P80A 3O2DA 2VLKB 5KYUA 1T2XA 1QSFA 1WS7A 3BW9B 3H7BB 3OWRA 4R0LA 4H8WL 2ZP9A 5K69A 5GRVL 4P3WA 1Z6JT 4ZW5A 1FBIL 2ITFA 5IEKB 1KJ3H 1OT1A 2H2PD 1JBJA 3OM3B 4Z0XB 3WNJA 5I19L 4GXFA 1XMWA 1FNGA 3DK2A 1CLVA 3OKLB 5DJDB 3E6HA 4OM1H 5BV7B 3WLWC 4HG4K 4O02L 1VLXA 1IAKB 1K5NA 5EO1A 5EU7C 4NQDB 1UD6A 3RWJA 4J8RA 2EINB 4KROD 4QXTA 2X2UA 2Z4QA 4NGHL 2VR7A 5AZEH 1T5WB 1FFNB 2R2EA 4N0FA 5CS7A 5JIHA 1O5PA 2F54E 1CGSL 4MYWB 1MEXL 4PGDA 2NLJB 2GAZB 5A2CA 4PG2C 3QPQC 4DO4A 3CZGA 4XB7A 4FCHA 3GYRA 1HIMH 1FFOA 3N43F 3E6FA 4EBQL 1U8JA 1GZQB 1QTPA 2WMPA 3RIAK 1JNNH 1T80A 4I1NB 1NDGA 3B7TA 5TQ0L 2DIAA 4LSSH 2QPFA 3WKYA 5C92A 1MCJA 5ALBH 4PU2A 3EJSA 5D7IB 1BXUA 3OAUL 3K4DA 3O3EA 2AK1L 3QZLA 1GFOA 2CGRH 1EFXA 2V2TA 3G9AB 1N8OE 1XGRA 5L2KA 2VDQL 3MUGB 1JZFA 2NY6D 1FVEA 4IOSA 4FOZA 4NQED 4YZWA 5G4OA 1CWVA 2A9CA 4WEBL 2DQTL 5IHBA 3RTQA 1Q9LA 3O3UN 3SKMA 3VU2A 4U3CA 3CHRA 3GSUA 3L17A 4WK4B 5HVHB 5C6TH 2APXA 2V5SA 3T09A 4ZW3A 3MNZB 2Y2TA 3FT3B 5E03A 3ZOAA 4KRPD 1NM4A 2AEPL 2IPUG 4JHBA 3FUMA 2P24B 1JWSB 3BDYH 4UIKH 4MTMA 4PBDA 1XF3B 1X5YA 2EABA 2GITA 3ET9F 1ZK9A 3EUDA 3QUYA 4KJPD 4A7QA 2Y6SD 5D2NC 4NM8H 3L6FA 5FO9B 1X5IA 2EDBA 3X12B 1NIBA 5IROD 5IB3A 4GOSA 4WW1B 3ARWA 1X5ZA 5CCKH 2ZF8A 5GGRA 4FMVA 4IOFC 3VE0A 1TSHA 1MCWW 3WO4C 2W0FA 4MA3B 3LS5H 5CBAA 5LBGA 1K4CA 3L7EA 4Y9BA 3TJHC 3CGTA 2Q7YA 5J6GA 2BOLA 4OJYA 1RZIA 2V7HA 1GTFA 2MQ3A 2N0KA 2HP4A 5A6IA 4AG4L 2APBA 4Y2OA 3UEQA 5FCUH 4XP6L 3KGRA 2VDNB 1VDGA 3LNGA 3SGEI 3VXSB 3QXUA 2KQMA 3RIFK 1NCDH 5E8DL 3VI4A 1GGIL 3DDGA 3JZ7A 2J8UF 1NUGA 1AYRA 4OF6A 3A6CH 2PXYB 3T3PB 1AGBA 3SKJH 5I66A 4LMQI 3MRHB 2OK0L 3K7UA 2PP9A 3IEAA 1T0PB 3LKQB 3VXOB 2XG6A 1CGTA 3OKNB 3TX4A 4X4YB 5K9OA 3L5WA 5I1LB 5CP3H 3D5OF 3ECWA 3MNWA 4ZPVA 3KJ6H 5J1SC 4YWGL 1OAXH 4GXUM 4OI9A 2ZWYA 1AO7E 1DVTA 4NT6A 1GVIA 2XU9A 3NJJA 2J43A 2WQSA 4M1CC 4S1RH 1NEZA 2C3VB 5GSRB 4TLTA 3O9WA 1K3IA 1QNZL 3BZ4A 3NRFA 3SGDI 4GO9A 4FQQA 2IH1A 1TITA 1F11A 1RJZA 1KIRA 4JO3L 4Q14A 3TJEH 5C2UB 1EJ6A 3P77B 1DQDH 3NTCH 5C0NC 3V0HA 3KPQA 2A1WL 3DVGA 3ARZA 4WHDA 3ULVF 1BGXH 2O6DA 3BUQA 4NQEA 3I50L 2WBKA 4WJG3 4OSUL 4CVUA 2X4NB 3ARGC 1B4TA 4YDLB 3FU7B 3TEWA 3N85H 1NEPA 1JK8B 1S7UA 3CFEA 3CH8A 1EUUA 2DWYA 2IPKA 4ODXB 3WD5H 3KLHC 1Z9LA 1TFHA 4P5TC 3VGDA 4P2QD 1IE4A 3P0VH 4XBGB 2KZBA 4IOIB 1I1AC 3FDWA 2YJLA 1CGUA 4N9GA 2XI9A 1I75A 2Y6TE 3KPLB 3RKDD 2XV2A 3ZDYF 1KDJA 2LV4A 3MCYA 4JJHA 3X11A 2X70A 1JNLH 1TO5A 5IROA 2KZWA 3NJMA 4GQ9L 3UYRH 5HHVL 1E4XI 2GTZB 1AH1A 5BRZE 5GJTL 5CUSH 1T1LA 5EZIH 1KCVL 1E4WL 3BP7B 4KK9D 2L7QA 4E36A 4L1HA 4PJEA 5DEGA 2YPLD 3BZEA 2YN3A 4IQHA 5GHWL 3G5YB 4G8EA 4IIQA 2ICES 3RPKA 2R51A 2G0KA 2FL5A 3HI1A 1RU9L 3O6FD 1IC5L 5E99L 1OB1B 4D0BB 1V8HA 2AS5M 3C60C 3LZQA 2W80C 3QWNA 5DRZA 3FYIB 1M2OA 5KSVB 4G6FD 1TQCC 1A02N 3NPSB 3OPUA 1IGFL 4OBRA 5BQ7A 3QUKA 2AHIA 3QDJD 3AA7A 3K0YA 2CZNA 4K23H 4JY6A 1QFUL 3LSOA 5F97E 3V7AE 1R5VA 2RACA 4KVPA 3SDYL 5I1IL 1F4YH 1WAAF 3J27A 4L4TE 3QQ9D 3QUZB 3JXAA 4E9WA 2R2BB 4NDMB 3FB7B 3MR9B 1UQSA 2D8KA 4TNVK 1N19A 1MCOH 2HZHA 5BW7A 4Y5YB 1T03H 3VXUD 5EN3A 3EYFB 4QRRE 5DHEA 3DV4A 4DVRL 2C26A 3MVSA 5KYNA 1XMEB 4D3CL 3RNKA 4I48A 1BOGB 3MLRL 4KNUA 2JJTA 4PIBA 3AMKA 3GMMB 2OPCA 3A4DA 3D30A 4ZMAT 1IFGA 1CBVH 4Z78B 4GW1B 4PS4L 4EZKA 4NO2B 1EHAA 4AMKL 3O3BB 3B2PA 2EIDA 4ATTA 1UOLA 3FFCD 5LAXB 1JS4A 4BA8A 1WITA 4GP4B 4ANUA 1PZBA 1RK0B 2LU4A 4LHUB 4XBEH 2FUTA 1OARH 3LRMA 4B41A 1KCKA 1N3NB 3HZVA 2IDQA 3MAWA 2AXJA 4PJBF 3VZUX 5DO2D 3UDWC 4WFEE 2WUBH 4GSDL 3TNNA 4I89A 3W81A 2H26B 5ILTH 4ABVA 1TLMA 1G9HA 1NDMA 4P2QA 1KN4H 1M7UA 1MHEB 2DQDH 4OZHE 4K3CA 3N44F 3GSVB 1CLYL 4TVPE 4XNMA 2R1YA 1VAHA 4A6YL 3QUHA 4NNPH 1LP9B 4AQ1B 5J1AB 4GRLD 2E7CA 5EEVA 4HZAA 3H53A 1R5WB 5B8CB 3HHMA 5DD1H 3S6CA 4RZCB 1MSPA 3WSQH 5DMGC 3MLWH 5BV7H 3DO7A 2IV9A 2YPLA 1VFBB 1JGUL 2X2YA 4EOWL 5F9DC 4LCCC 3RFZC 3GKZA 3VG0L 4P2RE 1DCLA 5AVYB 4ZAKD 3O6FA 1CXHA 4UUJB 1R24B 3VDAA 5CEZL 4AT6A 5I9QC 1P7KB 4PBVC 3HAEH 3NN8A 1CD9B 3TVMB 4FNLH 1MQKH 2I5YL 2YAOA 2YA0A 3HHRB 5GRYA 4B7LA 3FQRB 1U92B 3GSWB 4GKZB 1XV8A 3SKNA 3QDJA 1URZA 3HC3H 5KAIO 4G9FE 3P3RA 5D7LA 9PCYA 4AI7A 1Q0EA 3CLEH 1IGML 3A4FA 5HI4D 2VZTA 3MLVL 2WTPA 2WLLB 3ZU8A 4YXKH 1EZLA 1Z9OA 2FD6H 1N18A 4N22A 4RGOH 5DS8B 2XXFA 2KC0A 4UNIA 2ZYRA 5LAPA 3HKFA 5BZWB 3VXUA 5EOQL 5BRQA 3FCGA 2DWEA 3HS0C 2C3WA 1YEJL 4QCIB 1GGBL 3H56A 4J39A 3ULVC 3SGKC 4KHXH 4GG6E 1MI5D 4OM0H 4WUUB 2GIYA 4WK2B 1BMZA 4GS7B 4JDZA 4U1NB 1RZJH 2LAGB 4WAFA 4A1RA 4EI6B 1RPUA 43CAB 4DKFL 2UUDH 4ODVL 3FFCA 1SQMA 5C0GB 1JGDA 2FATH 4HKZA 4F7EB 3OKEB 4FE9A 1NM9A 4YGVB 1FAIH 6PRNA 1N67A 4FFVC 5LDSA 1P4BL 1LK2A 4P2OC 4NNXB 3WNMA 1RZKH 3X3FL 4IYKA 3BAWA 2DQFB 3EYVB 3GRWH 4Y1SA 1RMFH 4P2AA 3GHEL 4PRHB 5AZUA 2HMID 4O49A 2WGXA 4LXFA 1CTNA 3DWNA 3BWZA 4TRPH 1ECYA 3B9EA 2LLGA 1X5FA 3L5IA 3MRBB 2V9QA 4PYHA 4OU3A 5IHZB 2PTVA 4JUTA 2Y7LA 3QNZA 1L3NA 3O6ML 4GRLA 3GMQB 4FTVA 4RETB 3DO4A 3DX3A 4ODUA 5EZOL 4X6EB 2I32A 1JHTB 3NEEA 4XPFL 5I1EH 3LX9A 3NCJH 2ZOKB 1E5ZA 3BN3B 4PRPD 2KZ7B 4NZTH 3JCUO 1UG9A 2NSQA 5KYXB 4O58L 3MJ7B 1IAOA 5D71L 5J1TC 4ZAKA 3HJ0A 4YBQD 3RL1A 4K94C 4IL6O 3LXUX 2F9BT 2JKWA 2C4FT 4G42A 2WLYA 3CPLB 3QDMB 4NP4L 1BAWA 1E9OA 2M83A 4P3DA 3VE1A 3QRBA 3GSRB 3L5JA 4F7TA 2JB6B 4NC1C 2ZCLH 1EAPB 3BPNC 2D7QA 3UJIL 2CKBA 4DCQA 3QO1A 3IFOA 3NIFB 4MCYA 5TDOB 5I6XB 5E8EB 1VERA 1RFDH 3QCTL 3S35L 4OFYD 1KXQA 3VDCA 4YDNA 4PUBH 5FR3A 2AI0H 4MQTB 2WQAA 1QLEL 3QWOA 5I0DA 4HP5A 5DUPL 4PJFE 3F83A 3DBXA 2YAEA 1T7XA 2WXFA 3F5WA 5F7AA 5LCVL 4WRLA 1BQUA 3A6BH 4MBRA 3ESUF 5C7XH 1MI5A 1LQSR 1PCXA 4KQ3H 4M61B 1MCKA 4JHVA 1DQJA 1QHPA 4BBWA 5I0XA 2HTLC 1IGYA 4G43A 3UBXB 1V05A 4FN0A 2GSGA 1KGJA 2UZPA 4FXKB 4J3OF 3PAUA 3EBIA 1WP6A 3LZNA 5DK3A 1OGSA 3CFCH 3W0WE 4XE5B 4EIBA 5KYUB 4R0LB 5DL6A 1QSFB 1UCTA 5CR8A 1NEUA 4Q58C 3MUY1 3EYOA 3CWGA 1EA9C 3SY0A 3D4ZA 3MRGB 2XVKA 3FAWA 2QSTA 2BY2A 2EEFA 1JZ5A 3P02A 1J1OH 3MX0A 4PP2A 2DH2A 1OHQA 3E6HB 5HYJD 3S3SA 5AG9A 2KXPA 4PW9A 4NUGH 5DVOA 2Q3AA 1K5NB 4S11A 5EO1B 2FJHA 4WO4D 4HIHA 4NWUL 5FVNA 5EOCJ 1OO2A 4OR1A 2P3YA 1RUPH 1U3JA 4J8RB 1O0VA 4QXTB 2HUEA 4PRPA 4F1ZA 2WM0A 4XI5C 2R2EB 4N0FB 4WHYH 5T1KD 3ZHKA 4HJEA 1ZANH 2YPVL 2ZX9A 4PGDB 3VU1A 1XCQA 3EXLA 1JRHI 3AREC 2B15A 3B1UA 3HJEA 3H3PH 5A2FA 4WI9A 1LD9A 2DQJH 2BERA 1VFAB 1FFOB 3J8F7 3E0GA 1FCCA 1U8JB 1XWVA 1MCRA 3AABA 3E6FB 3LQMA 4J1UA 2JKXA 2YGVA 4WCYL 3V0GA 3CDFA 1F6AB 2IPTH 5E9NA 1ZE3C 2EH8H 4AEFA 5GRUH 1IGCH 2VR3A 1NDGB 3Q43A 4AYEC 2Q6WA 3LXCA 3MFFA 3DYMA 5IVXB 2G60L 1THCA 1EDYA 3O3EB 1JZ6A 2V2TB 1EFXB 2X44D 4OFYA 5L2KB 1KTCA 1M05A 2Q76B 3EGSA 1FVEB 1YEKL 2RTTA 2YUZA 4XCCL 4JQIL 4LPVA 4M6NH 1Q9LB 3RTQB 3SKMB 4XPAH 3GSUB 1HH9B 3I6LD 4NNYA 5HHPA 3FRPA 2YOAA 1RUQL 1EO7A 3K91A 3HPLA 3CVCA 3L9YA 4ZFFA 2BFVL 3T3MF 4TQEL 4YEFA 3CXDL 1RUKL 1XEDA 1YUKB 5EC1A 1A9EA 4M5YH 4X7TA 1JF1A 4L48A 3LHPH 4PTUA 1D2OA 4BE5A 4JQXA 3QUYB 3VRJA 2HLFC 2WCPA 2DL2A 4M8QB 1WFJA 4IBZA 4BE6A 1MFAH 4HF5H 3L6FB 3X1EA 5D6DA 2F53D 5ISZE 3K80A 2XBDA 2BRRL 5IB4A 1PG7H 4JFBA 1CU4L 4B61A 5KVDL 1B4JL 2N4IA 4G5ZH 4RGNB 1U30A 4IBQA 3E2HC 4XMVA 5FUZH 4KXDA 4XN4A 3VE0B 4Y4FC 2NW3A 4WQOA 1ZLWK 4FESA 1YN7A 4PCTA 2KKQA 1HXKA 1K4CB 3HS9A 4DESA 5J6GB 2Q7YB 4QF1A 3W38A 1IO4C 1OV8A 2V7HB 1NIFA 2CA4A 1KC5L 4ODTH 1QPXA 4Y2OB 5HYJA 1KCBA 4NKMA 5H37G 4R2GD 4G59C 3VI4B 1TYRA 4WO4A 4GMTL 4GUPA 1TVDA 3PV7A 1L9QA 1T21A 2AJYH 1AGBB 2NT1A 4M3KB 4KROB 4AKRA 2P4AB 5EFIA 5MENE 3ZRCC 4M3HA 5K9OB 1QSED 4X6DF 4B0MB 1WGVA 5T1KA 4ZPVB 1QPKA 5GS0C 2CBTA 4F9LC 4MDIA 1E65A 3ZE2B 1IBBA 3RWIA 4NT6B 1BXAA 5FOBB 2GFBA 1T0NB 2ZXCA 3HG1B 1AP2A 5AW3B 2CBQA 1MVUA 3UJJL 3O9WB 1JI1A 1KJVA 1QBAA 4L3AA 5AUMA 3BZ4B 3GB7A 4EI5C 1ACCA 4ELKA 4FQQB 2IH1B 4C8XA 3V6ZA 4O3ZA 1F11B 4HIIA 1RJZB 5INCA 1KIRB 3FS9A 1QSZA 4U49A 1YEEL 3KPQB 3DVGB 4G11A 4NQCE 4HIXL 4AL8C 1LTXA 3K2UL 3NYKA 4J3OC 1RURL 1SXNA 1S7UB 3CFEB 2F7OA 5K9QG 2IPKB 2VLRD 1A3RH 3CDGA 3OXRA 1ZT1A 4AEIL 1Q8MA 4KRPB 4ONFH 4RFNB 3SY6A 2GT9B 1J1PL 5C0CE 2YD1A 4N9GB 4KTDH 4BZ1A 2NX5A 3L3IA 4XGZA 1KIQA 1JDAA 3X11B 2X70B 4I9XA 1HCZA 3LD8B 2AXFA 2WQRA 2F53A 1INQA 4WF7A 4NO3A 2B2XL 2FUQA 2OI9B 3WNIA 4LSFA 1DANT 4FYRA 4PJEB 4NP9A 5DEGB 3BZEB 3L5HA 5D7SH 3WDHA 3ETTA 4W9KC 4DGVH 4G8EB 1MFDL 4IIQB 5FGCB 5D1XE 2FL5B 3HI1B 3TZGA 1Q94B 4X4XA 2NPLX 4MGXA 4OCWH 5F72S 3UAJA 1TETH 4NCC1 1HHJB 1NLBH 5DRZB 4XWGL 5DJXA 2EIBA 2WLKA 4XVUD 3V7AG 1CVSC 1DVXA 1WZAA 5A1AA 3RWCA 2N3JA 4JFUA 5ABDE 5BQ7B 1IKFH 3QUKB 3UABA 1QEWA 3FSOA 4FXGC 1I53A 4JY6B 2HT2D 5TFSL 3LSOB 3O8XA 4I77L 3H6AA 1CS6A 3W1ZA 2XV3A 1LWRA 4LSUL 1WCQA 4XVJL 5FYKU 5I8OL 5IEHA 4TQ8A 4WI3A 3EFOA 4PJHF 3UGEA 4CL7A 5DR5L 1UQSB 2NY2C 1WZ1H 3SDXF 3MUUA 3G5WA 4PS7A 5D70H 1O7DC 2BWIA 3DV4B 4J3UA 3NVQA 3LKSA 4YZFF 4I48B 1JG9A 1G7LA 2HFTA 5AZ2L 2CJUL 3KYNA 1JNHA 2CR6A 3TTSA 4YMPA 1A1MA 2ZCHL 1JWMB 4XXCC 4Y9CA 2PRNA 2FEDD 4UTBL 1IIKA 4UAOB 2HX9A 1ZEAL 1E4XL 4N2FA 3PGDA 3NUKA 2A0LD 3QA3A 4OBSA 1ES0B 2OCCB 4ZMLA 2C4FU 3MRKA 4AQEB 2NY4C 3K81A 1JZDC 2HRPH 3HZVB 4KZCA 4RESB 5HDBB 4GUQA 3CSBA 3TNNB 5E8NA 2VLRA 5IQNA 2WCSA 2P48B 3RDTC 3MLUL 2K7QA 4JRXE 1JE6A 1UWFA 3RWGA 3PFQA 3CLFH 2IH3A 3ZE1F 4BKTC 5DRWB 5F7LB 3IMWA 5GS2H 2F7IA 2CUIA 2R1YB 5JO5A 4F8OA 3OGOE 3OPZH 4K7PH 3TGXA 1ASPA 4P3CH 1J0IA 2EACA 1W8EA 3CFBA 3BIAX 3D2UD 4JB9L 3P9LA 5IREA 3AY2A 4PV8A 1V7ML 3KZ8A 2Z91B 1PCSA 5I1CL 3HMXH 1NUFA 1KCRL 5DJ0A 4FADA 5BMFH 5CJQL 2YPLB 3VFOA 4YVUA 1CIDA 3TT1L 1CZ8L 3U4BH 3L1OH 3RA7H 3HFFA 1FZJB 2V3DA 4PJ5D 1LNUB 4PN6A 3MJGX 4Z3IA 5ABZA 4F4BA 3O6FB 2I9LA 5IUCA 2XPYA 4P46C 3DURB 2CO4A 3GFUA 2VDPL 3KPMA 3SKNB 2XWDA 4F9PA 1P53A 1CGVA 3QDJB 3KMDA 4GJTB 1FH5L 3RY6A 2PTTA 1ZIBA 4TTGA 5D7LB 2A6IB 4NFBA 2R0ZH 3POCA 2WZ0A 4UQAA 4JFPA 4EXKA 1A0QH 3O2VH 1OGAB 2QVFB 4A2EA 3V0WL 1H3WM 3NMEA 3TBTA 5C0RL 2W95A 2VOTA 1MFVA 4OV6F 3TYGL 3VXUB 3QJVB 2VDRB 2DWEB 3DJ9A 2X10A 4FFWD 1NGQH 1D9KC 5JDSB 4WO0A 3C08L 5E9AA 1CYWA 1J5OH 4K3EH 4XCFL 2PW1A 5I74B 2O30A 1XIWC 2XQYK 4WFGD 4MA1B 1EUTA 5CLTA 2N1KA 3DBSA 1BG1A 1QZNA 3KBEA 4HHAA 4P59H 5CJXC 3F64A 1JGDB 4HKZB 3HVDA 4WY7H 4DQOL 4JMXA 4XPHL 5IJKA 3MOBL 5CMAA 4PCYA 3U7WH 4FLQA 5EIQA 3A6OA 3FK3A 1BX2A 1LK2B 1E28A 4FTDA 1DJZA 1KWGA 2JCCE 3CFNA 1YQVH 1AZRA 2HFGH 1MG3C 4IBSA 3A21A 4M62L 4AYNA 3U2SA 1MXDA 2VDOB 3ZYZA 1INDL 3CV5A 5FO2A 2Q9OA 1XSKA 4BH7A 5G38A 1CICB 4YK4B 3QNZB 1VACA 4FTVB 4YLCA 4FNPA 3D2UA 3QFJD 3D12B 1AR1C 4ODUB 5F1KC 1ROCA 3HBPA 4HUNB 5I0WA 4JGMA 3TFKD 2F1AA 3PWVA 5C09B 1S46A 3L8QA 3MGTA 4FD0A 3JTSA 5I17A 1JFHA 3V4UL 2EZ0D 2B3RA 4PJ5A 1IAOB 2X4QB 2MOVA 4ZAKB 1J9CT 2XN9E 5AOKA 3RL1B 1ACZA 5IT2L 4G42B 3SPVA 1MNNA 1IL1A 4UDUA 4MNQD 1J8SA 3AY4A 3BDBA 3U4EA 1LXMA 5C97A 5EF3A 1E9OB 4AE0A 4P3DB 2WO2B 4WI7A 5C1MB 2Y36L 4K3BA 4F7TB 3MZGB 3M7FB 4PJIE 4BZ2A 4PI2A 2K4TA 4PPTA 1UM4L 2K8MA 3BVTA 2CKBB 5JOPE 5IBLC 5SWSD 2BSSA 2OJEB 3F7YA 3IFOB 1O6TA 4MCYB 4WGVB 5HJ3A 3BO8A 3QPXH 3P0YL 3QWOB 2HFFA 4FCAA 1BH3A 5KSAD 1UXLA 1V7NL 2Z8RA 3DBXB 2X3BA 3UTPE 2QPDB 3F5WB 4IBLT 3H42L 3G6AA 2R4NA 1PKQE 5KVEH 4KRAA 4H8HA 5DVNA 1MI5B 1FGVL 5FGRA 1N5AA 4CN4A 1I9RL 1DQJB 4IGBC 3EDEA 2D7PA 2XKUA 1KB5H 4APXA 4Q7DA 1IGYB 4G43B 4GXUN 1A7NL 2OS7A 4OZGA 4XTRC 1O9VA 2GSGB 5F0PB 1HQ4A 3N40P 1YYMH 3V6OE 5C0BB 4G3YH 3IMSA 4P4RA 3WJJA 3VZTX 3L81A 1OAKL 1RSFA 5BZDA 3L3GA 2DM2A 1MY7A 2FTAA 2ZWZA 1ZE3H 1EBPA 3ETBJ 5K9JH 3WAJA 1RPQA 3GBMH 3MRDA 5BVJA 1PEZA 2GSIA 2Q1EA 3EYOB 3MSPA 4FFZL 1OTUD 3ECBA 2F58L 4XAWH 2B5IB 4TXVB 3VDBA 4TUUA 1BP3B 3VSTA 1KMGA 4ZMTA 4HIEA 4LCIH 1ZHYA 5ES4B 3OJVC 4PP2B 3VFVA 3U0WH 2YKLH 2UVFA 2N1TE 2VZUA 4DEUA 4L3EE 2KXPB 1I82A 3KBHE 5G5DA 4CBZA 2VH5L 4HIHB 1VSCA 1BD2E 4LSPL 4DAGH 4PRPB 5TE6L 4LP8A 4JM2F 4NZ8A 4KH2A 3S2AA 4ELMA 5D2LE 5B3SB 2VZOA 3LN5B 1AMYA 3CVIH 1I8KA 1XCQB 1CLZL 1MF2L 2DKMA 2YRPA 4KXCA 4ZFGH 1DJHA 4HUUA 1J8HB 4MNQA 2Y5EA 1S2EA 1G7MA 2QHLA 4QYAA 4X0KA 3HAEG 4OGQC 3SE6A 1DANU 4H1LA 5IMMA 2BK8A 4NUPA 3SZ6A 2Q6WB 3CBRA 3WIHL 3N91A 5SWSA 3FQNA 2JLPA 3RWHA 5GZOD 3AACA 4EQ2A 1S9YA 2AQ2A 2E7LC 4BUHA 2R29H 3TO2B 5CCJA 1M05B 5D7IF 3TCTA 3ZDYE 3EGSB 2NZ1A 4DH2A 1E6JL 5KSAA 2NZ9C 2QJDA 1RJYA 4MA8L 4HJ1A 4RNRA 4ZX3A 4DPBX 4AKQA 4JJ5A 5C0FA 3L9BA 3PWPE 1GZPA 3FRPB 5HHPB 1X7TA 2GK2A 3HPLB 1Q72H 5CINL 4ZFFB 3ZZSA 2EDEA 1VFUA 2KH2B 1C8PA 1AO7D 4PRIE 4F7PB 1A9EB 4X7TB 5EOCL 1JF1B 1UYWH 4PTUB 2ATKA 1CT8A 3VRJB 3L3OC 2HYMA 2DWXA 2EDLA 4N0UA 4PR5B 1HXTA 2DJSA 1K6QH 2R69L 3AT0A 4K3JL 1YMMB 3NCBB 1EPFA 5IB4B 4QXGL 3SE3C 3MN8A 4FL4B 2O5XL 3HE6D 5E4EB 1JDCA 2J88L 3TASA 4EZLA 4HAFA 3ZT5A 2NCMA 1P4IL 2NW3B 3AS2A 4B9IA 1JRHL 1VESA 1YN7B 4IW4C 1Y07A 3KCWA 4AW4A 1N0XL 2K9UA 2AGJL 3C2SA 3EOYG 1P1VA 4QF1B 1P5VA 1OPFA 2AF2A 2QGCA 4R7LA 4DP1X 3ME0A 5BO1L 1KLFA 4KNQA 4HJSA 2GSMB 5PAZA 5HYJB 3D09A 3TN0C 4NKMB 4JREC 3FQWA 2F18A 1DVFD 4HUWA 5T1MA 5G4MA 1UKTA 1SDDA 3QBTB 1HINH 4J3OH 1T21B 1TTFA 3B9KC 4AKRB 3RE0A 2XTJD 5TE4L 4JFEE 5EFIB 5CBEB 3RVVD 3HNVL 3JWNG 4FERA 1QRNE 1NCWH 2WZPD 3P73A 2GABA 5K9QI 4MDIB 4TSBH 3RWIB 3MLZH 2R15A 1OSYA 5JDPA 1MRCL 4DP8X 2GFBB 4R90L 2NOYA 1MVUB 2ZP0T 2ADGB 4NN5C 5EV7A 3R18A 3T04D 5AUMB 3GB7B 4K2UL 2VDRH 4ELKB 3V6ZB 4N1EA 5DFWH 1N59A 1VFMA 1O6SA 3L45A 4HIIB 4PY8I 5INCB 4D0CA 5ADOL 2ZUQB 5GZOA 2Z9TA 4PY8J 2B59A 5JPMC 1HEZA 1WHPA 4N85A 3LH8A 3N50A 4M93B 4MB5A 4AYSA 3HRPA 4HOMA 3SCMD 5GGSY 3LRSA 3Q48A 5GISL 4Y8AA 3IWUA 3TBVB 2WBWB 4CSTA 4X42A 4MNGE 4N0CD 4WEMB 1OY3B 4UOW0 5L4IA 4MDRA 1LO4L 1WBZA 3MC0A 1Z3RA 4KZDH 5G39A 3CVHB 3CDGB 1AO7A 1KEML 4ZXBB 1BREA 5AENA 3IPBA 3CIAA 3MBEB 2VJ0A 2AV7A 2XWRA 1R3IL 2B4CL 1I9JL 3VD3A 5CCGE 2NX5B 4XN5A 1AAJA 5AFUK 2V17H 3L3IB 4RIRA 3FMGH 4XGZB 1KIQB 3ZPDA 5G3AA 1A8ZA 4KNSA 4ZRGA 1LO0L 2AXFB 2MEJB 2CO7A 1VPOL 4DN4L 1F90H 2F53B 1INQB 4NO3B 4RQQA 3HE6A 4UYQA 5KS9F 2NYYD 3PREA 1DO6A 1BQLL 1FJ1A 4Y2LA 4O3YA 3L48A 3S3CB 5IBUB 1PX3A 2G2NA 4H0IA 1KGCD 4U6HA 4XOAA 4RAUA 1FYTD 4Z7VF 4X4XB 3BEWA 4JM2C 5BOPA 5D6CA 3DGCR 2VMDA 4R2GB 5DJXB 5EEXA 1DVFA 1UENA 1N7ML 3RWCB 1QEWB 3WY2A 4JS7A 2EXYC 1RSYA 4LF3A 4H7VA 3B2UC 4MLIA 2EIJB 3U1SL 1OGPA 3O8XB 1P5UA 4OIAA 4ALAC 3UTQA 4F8TA 1A65A 4QOKD 3Q6FA 3QORC 3DPDA 2H1PH 2WZPA 3EFOB 5IEHB 4DNLA 2QLYA 2ZSWB 1SBSL 2NY7L 1ZHBA 4UTAL 1MCEA 2CKBH 4LEXL 1VGEH 1DQVA 3VCLA 1PZ5A 1OF0A 3Q8EA 4HWBL 2Y3AA 5AKTA 2XE2A 5HYIA 2HCZX 4U31A 3TBWA 3LKSB 1SXAA 1MRDL 1X7SA 4HCRL 1G7LB 4RDQG 4S1DC 1KN2L 1JNHB 1A1MB 4FG4A 3RGVC 3RZCD 3N0PB 1KT2A 2VR5A 1X6NA 1BFOA 4QT5A 3PRNA 4YDIH 2W60A 4HIQA 5DD6A 3PGDB 4K3HA 5IY5B 5KBNC 5C08E 3EJTA 3NPZB 4K3GA 4JKWA 4RMTA 3SCMA 5HVHC 2K1MA 1WAPA 5KVFL 1YVLA 2XIBA 3FAXA 3MRKB 5E7BA 2QKSA 5CEXA 1QWHA 1SEQH 3PGFH 2F5BL 1UWGL 4GSXA 3RPIA 5CHNA 4HEMA 25C8L 5E8NB 3ROLA 1V5JA 2VLRB 4XT1C 1PIFA 2WWNA 2VXSL 2PP8A 3V6FA 3RWGB 3BKCH 1YNTA 2IH3B 4O9HL 4ENEC 2RHEA 3KYKL 5HYSB 5JO5B 5HI5C 1CL7I 1OCZB 4F2FA 3FT2B 2CIIB 4Z7UA 2EDQA 2XY1A 4JDVA 4PRAA 3CFJA 5D5MB 2CALA 1LP9F 3CFBB 4K5PA 5L7XL 4KKLC 1DFBH 2LR4A 2BOBA 1HCYA 2AEIT 2FEEI 3P9LB 3ZDZE 3WTYA 3RU8L 4HAGA 2VCOA 1F3DJ 2J25A 5DJ0B 3HOLA 3UC0L 3VFOB 2Y5TA 5LVEA 3LQAC 5FYLE 1PPIA 4KO9A 5IF0B 1FYTA 4B9CA 2CHDA 1MIMH 1YA5A 4N8UA 1HHKA 2F19L 4ORGA 2AJXL 2I9LB 3QIUB 4HBCL 3HI6H 5EORH 3ULUH 3ZHLA 4YNYA 1G1CA 2FGWL 1Z9NA 1HXUA 3KPMB 3QJRB 4FQIL 4PJXF 4JCMA 1NANH 3DX8B 4JFHE 3MACH 4TUKH 3QI9D 2VUOA 1EH9A 3HNSH 1CF8H 3O0RH 4BYHA 1NIEA 2OCFD 1AGEB 4HGWA 4QOKA 4JFPB 4Z9KB 2BVEA 3QJXA 3Q8BA 5I6OA 2ORBL 2DS4A 3I3EA 1MCCA 2LE9A 1ZXKA 2V33A 3N40F 3WFBH 1FDLL 2MMXA 3U48A 5K59F 5BOJA 2J44A 3BVVA 2MQ0A 2YUVA 3NCYS 1X9QA 1UGNA 1NSNL 2J55A 2DQIL 2KMWA 4KGJA 1CPUA 4RLDA 1DJIA 1OP5H 2PW1B 4JPKL 1E4KA 1CE1H 4IBYA 2IH9A 4TOYL 3U9PH 1QJ8A 3RVWC 3RZCA 5I6LA 2DQEL 2ZUYA 2R4RH 3GLZA 3SE4C 4JFSA 5KAFO 4OT1L 3T0ED 2PKDA 4HHAB 2EXSA 2CDEA 3B83A 4CU8A 2Z31C 1WE5A 1NCAL 2X6AA 1QBLL 5CMAB 1MAJA 3ATEA 4BZYA 1BX2B 2XV6B 3RBSA 1T5XA 4NN6C 1NAMH 4WW2A 1CQKA 1DSFH 4JPIA 4JEGB 5D8JL 1QEXA 5BVPL 3U2SB 5L4MA 2H32H 4M02A 5A7BA 2A74C 1YN6A 1PSKH 1NCIA 4L8DA 2VLJE 4TMPA 2PPCA 2ARJA 3T0VA 4I0PD 4BH7B 1Y6KR 2VMEA 5HI3C 4X8GA 4GEIA 2YPVA 1VACB 2J4WL 4N24A 4UT7L 5KVMC 3KHQA 4GIOA 2ZXBA 3MJ9A 5ICXA 4OIBA 1H5BA 4UAHA 4RRPA 3HS8A 1QFWI 3PWVB 1LO2H 5KOMC 2D3LA 3DSFL 5FO8A 5I75B 4OUOA 3MGTB 2Y69B 4OKVA 3FN3A 3JTSB 4CNIA 3VI3A 3WTWA 2ENYA 4KKZA 5JHDD 2Y7OA 2DMHA 2XPZA 1IC7H 1RHHA 4PJ5B 1OAYL 4L8BA 1EEQA 5BS0E 4WHCA 5IG7A 3GSXA 4G7YL 3SPVB 1RH8A 1IL1B 4ODSH 1WZKA 4FHBD 4UDUB 1WDAA 2KZKA 3U4EB 3LZLA 1R4XA 4WWID 2VDQB 1F41A 1ZPLA 3D2TA 3R06A 2DEWX 1ZXQA 2OKMA 4PJCE 4JQIA 3DTDA 3GS0A 3QI9A 3GF8A 4NSKA 2NQDA 4Y5YC 4KJWD 4F5CA 3FW6A 3F7YB 1U8OA 2YEVB 1YYCA 2VW4A 3S34L 4X50A 3BO8B 3STLB 4ONHA 3WENA 5TF0A 1RLBA 1TNNA 2YGOA 2W94A 1DQML 3HB3B 4N5ED 1DQLL 2HFFB 2EC9T 4RGMC 4NM4H 3OF6D 4OCLC 3WKQA 2OJZL 3EW3B 1RVFH 4BUQA 2YA1A 5LLIC 5LGKA 4AJWA 4WSJA 1YEFL 2PYFA 1OPGL 1KOAA 2VDKB 3HG2A 5DJAA 2OMFA 1A5FL 1N5AB 5HGDA 3C6LD 4MHHG 3TO4C 5IHLB 1ZHZA 3PY9A 1AHWA 1ZV9A 1CXKA 1QATA 3B2VL 1U8IA 1KELL 4HW6A 4K5MA 3TPUB 3WU2O 4APXB 4YSCA 3T0EA 4HGKC 3CVHH 3BI9X 1FYHB 1B3IA 1NUDA 1QAWA 1UD5A 1NQBA 4Y4KB 4GBXC 3IGKA 1S7WA 4WSGA 1P4UA 4OAWA 2QKIC 3FO1A 4P4RB 1R0AL 2YGPA 3L3GB 4UZSA 2CO3A 2GC4C 5IQMA 4UQEA 4FUVA 3MRDB 2AW2A 3V0AC 2GSIB 5BVJB 3U7YH 3LMJL 5DFVD 2I7SA 3DWTA 5J6HA 4I0PA 5CJOH 4MAYC 4HIEB 4DP9X 2HFEA 3QUMH 4Z7WA 3CIQA 1TJHL 4GSUA 5I15L 4HBQA 1GIGL 1ED3A 5G5DB 5IJBC 3ZE0B 1QBMH 1JHKL 2NXYD 43C9B 1R75A 3HNTH 2HRHA 3JWDL 2DQ6A 5SWQB 4LLWA 3OLGA 2YAPA 4YHZL 5JHDA 1GY2A 2OX5A 4OTXH 3FC8A 4I8DA 5E4OA 3NSYA 1I8KB 2BINA 2BCMA 2CJ3A 4F33A 4G6MH 5DHYA 1CDGA 1D5MA 4GLRI 1DJYA 2ICWJ 2FO4B 4MNQB 1FO0H 2E4TA 2AKRA 1G7MB 1HH6A 2DKSA 4NHCL 4X0KB 3FOLB 1E6OL 3IXTA 3GKWL 3LN4A 1EHLL 4CC4A 2R1XA 3SD5A 4C4UA 4ZTOL 3LTVA 4H1LB 4PI0A 5ICYA 4XP1H 5IMMB 1PDKA 2DICA 2OM5A 2J4UP 5SWSB 5IWLA 3FQNB 4M43L 3RWHB 1S9YB 1E8YA 1ADQL 5FYJD 3QJHA 4ANWA 4KKRA 1MFCH 2AEWA 5KSAB 1QKZL 1RJYB 4GS7C 2P8PA 4BDVA 3OF6A 4RNRB 3SE9L 1B2WH 3HCVA 3VACA 3R0NA 4JJ5B 4GHBA 5C0FB 4AMXA 2WUCL 1GZPB 5DQ9A 3BAEL 4RBPK 2O6EA 4FS0A 2W1NA 2C9RA 3C6LA 1GTNA 1RLWA 4JFZH 4B60A 4NCDA 3LZRA 4PTTA 3TJPA 2A9ML 5F8RC 3TWCH 2ATKB 1CT8B 4YPGA 4UB8O 5HDWA 5L6YL 3D6GA 3FTWA 5JW4Q 4N0UB 2CCVA 1ET8A 1BZ9A 4LCYA 2UXGA 1I1FA 1LO3L 1TZGL 5C0IA 1ZHKB 1BA9A 1MHPL 4N9OB 5K1NA 2MCPH 1ZLSH 2KI6A 1HL9A 2G75A 3UAQA 2K78A 4I88A 3TEUA 4L5FH 4G72B 3A67H 3INOA 3DVFA 4XWOD 1P5VB 2VUYA 4PJHE 1YLBB 4X5WA 1QP1A 1IEHA 4OVVA 4NAJA 3SDXE 5J12C 4YFLI 3L1FA 4K8RL 3MRIA 3BUYA 3WKML 3FQWB 4HUWB 2QTEA 5EB9A 5T1MB 5DGQA 1SDDB 1WK0A 3AA1A 3BXNA 2XSKA 4YZFE 1KB9J 5HGGS 1E40A 1GH7A 4FQLH 5FUCC 3WCYA 3MBXH 2UZIH 5T1DL 1XGYH 4LNVA 3GSNL 2X9XA 1LEKB 5EU4A 4ZFQA 2R88A 3OJMB 3H9SE 3ASOB 1M57B 5HXMA 3P73B 3PGSA 1CK0L 1SJEB 3Q2VA 3X2QB 4F24A 1S7SB 2CRIA 5HYQA 3BYYA 4LEBA 2BIMA 4DGYH 4E9VA 4AYDC 2K6WA 4MQXC 5I6XC 1RUAL 4PMFA 1THQA 1SY6H 4P5SA 1TIUA 1J0YA 5F88A 3RIFF 5ESAB 1P1ZA 3PE9A 5AVXB 4JHWL 1N59B 4W68A 1O6SB 1RK7A 4FABH 4CSZA 1Z1WA 2X88A 3SKOA 3BP5B 3ZE1E 1ZT7A 3MLXL 2B59B 3B2XA 1HEZB 3LRGA 1SLVA 3FT9A 4HC1L 5GGUA 3LRSB 3QNYA 3OZ9H 3KZIO 2CRMA 4A6YB 4GCPA 2IFGA 4H8WH 3SQRA 4CADA 1WBZB 4C58B 1BCIA 4HS8L 3GC3A 2YGQA 2CDGA 3AXIA 1TCMA 3UTOA 2ZOUA 4FXKC 1YMHA 2PO6D 3PXHA 4ATWA 5MEPA 3VJ6A 2ARJQ 1JZHA 4ALAH 3FBKA 4O02H 4WHTA 1KB9K 5AFUL 4OB5L 3FTYA 3HHSA 1DDHA 5T3XH 3S3BB 4QNPE 2CLRA 5HHMD 2CO7B 3UAEA 4F15C 1ERNA 3AU1A 3P11H 3HE6B 1ZTXH 2R8SL 3VH8G 1MEXH 3F6IA 3S5YA 5K9KA 1CXEA 3BQUC 3R4RA 4ABUA 2Z1PA 4K5OA 4U6HB 4Y16D 5ERWA 1D5IL 3QEHA 3TA4D 1MFBL 4RAUB 1FL3A 3VGFA 4DTGL 1OHZA 3D05A 4M8VA 3NGBB 1OP4A 2B1HL 2DMBA 3PXLA 5K33A 4N68A 2BDNL 2QL1A 3SJVD 4DT2A 1FFTB 4HQQL 2FQFA 4F8LA 1VKXA 1WVZA 2R1WA 3OAUH 1BQHG 4LF3B 2XTJB 1IBDA 4ZT1A 2AK1H 3D9AL 4KO6A 4KXZH 1P5UB 1RZQA 4XCNB 3UTQB 3O4OB 2VDQH 1DFXA 4W4OA 5KTEL 4XCEB 4XMXA 1ZRUA 2OXHA 4D94A 3Q6FB 1Y1DA 2WO3B 2RH0A 4E2OA 2DQTH 4QEGA 4B0MM 4B9ZA 1ZHBB 4CU7A 1KJ3L 1FL6A 1KV3A 2E9IA 3MLSL 3BUBA 1KV7A 3NESA 4M7LH 4NFCA 3VCLB 5GGRB 1PZ5B 5FAAA 2MCMA 1TUPA 2BIPA 1J88A 4GB9A 2I24N 3P4NB 5AQ0A 4J27A 3TBWB 1XSIA 3V0VA 2AEPH 1KIPB 4I4WB 4JPQA 2IDUA 3II2A 1FP5A 1RZ7L 3QR0A 4N2KA 1KT2B 1BFOB 4QT5B 4MJ4A 2W60B 5DD6B 3RTQC 4AV5A 4NKQB 4NO5A 1OAUH 3SCMB 1GC1L 3CFKA 5CZRA 2DMCA 3UO1H 5CEXB 1YDPA 4OFDA 2MTPA 1E67A 4TNVF 4YSPA 4ZNCD 5CHNB 4YEEA 1ONQA 5DWPA 3ROLB 1GAFH 1RIUH 2J5LB 2PO6A 5GRZA 2GJ6D 3FBQA 5D7JD 3V6FB 2ZX6A 3ARDD 1GYWA 3WFDL 4PJAF 4LSRH 4XP6H 4KXAA 3TEXA 1MCSA 4RH4A 2YQ2A 2D7OA 4FC3E 5DUJA 5KSBE 1TXKA 4AQ8A 5E8DH 3L3DA 2YSTA 1GGIH 5FWQA 1W9XA 4JDVB 4PRAB 3CFJB 2CGRL 2EC9U 2WTRA 4LPTA 1P7BA 2ODHA 2BOBB 2H2PC 2OTWA 3JT2A 3OQ3B 4UM9B 1F00I 4C55A 3TP4A 3W9DA 2J6EL 4TVPL 4UNVA 2O5ZH 3Q01A 4MJ6A 4YWGH 4M29A 4ZO7A 4YVNA 5DURD 3QJQB 4G5AA 4GRWF 4Y16A 2BJML 1EZUA 1FYTB 4Y88A 3APFA 5IMKB 3ZYOA 1HHKB 3CMOL 4ORGB 2YNKA 4IHOA 3GTNA 4UIKL 3E38A 4TM9A 5B1CA 1QNZH 2P49B 4OLZL 3SJVA 4UCFA 1JZ7A 4YNYB 4RDBA 3NIGF 6CGTA 2ZXWB 2G0LA 2YQGA 2WP3O 4JO3H 4Z3GA 1DBBH 3ZO9A 1KLGA 4J3OG 4HGWB 2A1WH 4AV4A 4JN2A 4W70A 5F9WC 2X1OA 3AS0A 2L0DA 4PIRF 3UYPB 2RA1A 2YPKB 4J3BA 2KYIA 3LEXA 4Z3HA 3EADA 4WWKD 4A2HA 4L18A 4JCHA 4YAQA 5CD3A 1KFGA 2IQ9H 1L9TA 2ZOTA 4KH9A 3UPGA 3LKOA 1NCDL 2F74A 1CL7L 3RZCB 1FFPA 2NY6C 2BWQA 2FQEA 3X1BA 3SKJL 4LSQH 2EDOA 4ZMNA 5AB0A 2X4PA 3I9PA 4QAWA 1OD9A 2YAHA 1S6NA 1H6TA 1A4BA 1TO4A 4IRJC 5HHVH 3SDCC 5DK2A 4FFZA 5DRXA 5GJTH 5J6SA 3GP6A 4DP7X 2CDEB 3WJLA 5EDSA 3B3IA 3HTLX 4IRSD 3S2CA 4DPCX 1F1DA 5EF2A 3DO3A 1SJVA 2LAAA 3AU0A 3HVNA 4WV1A 1T5XB 1A21A 5GHWH 2B0SH 4WW2B 4KJPC 4W6YB 4JPIB 2GJ6A 2ZUVA 5D7JA 4WTQA 5IROC 4PGEA 2C9AA 5BRPA 1IC5H 5E99H 5AOMA 1EFQA 1YN6B 4MS8D 4J6IA 4L8DB 2ARJB 1E9QA 5LBVA 3IDGA 1UT2A 4BQ9A 3LZOA 1IGFH 3TJEL 1AZNA 1V55B 4JO1L 1MNUL 2MSPA 2W59A 5ICXB 1BGXL 4QO1A 1H5BB 5EC2A 3SDYH 1PZUB 4X7DC 2P47B 3RUGA 1BAFL 2G4EA 3Q5YA 5FO8B 4LO9A 4FSPA 5F44A 4L8SA 4G9DA 1JZJA 2VNCA 3N85L 2Y1ZA 4OKVB 3FT4A 2HKFL 3B8SA 4CNIB 5AVVB 2APWA 2BNRB 2XKSA 4RL9A 3KPRD 5EBMA 3UBGA 3VI3B 2WXOA 5DFTA 5KJ7E 2E9BA 3AMLA 4L8BB 1I8AA 5IG7B 4Y2DC 3GSXB 3LKPB 4DVRH 3QZPA 2JSFA 4YQXL 2XA8L 1CMOA 3EJYD 1TJGL 3IU3A 5D7IE 4D3CH 3MLRH 4MHHI 2H2SD 1OAZL 1J8KA 1JNLL 3UYRL 3S96A 1ZK5A 3R06B 1KBVA 4PS4H 4HKBA 3V9CA 3LS4H 5CUSL 3UIYA 3QI9B 2G3NA 4NSKB 5EZIL 1PX4A 1IKNA 3GI9L 4NCC2 1U8OB 3Q1SH 5GGSA 2Q20A 3F05A 3FTVA 3ELAT 1HHGB 4ONHB 3S36X 2Y07H 1TKWA 2CJTA 2R23A 4WWKA 3JWOC 2XJKA 2WJ5A 3HI5L 3E3QC 5T3ZE 2VIRA 3BWSA 5ADXK 1K2DA 2R69A 4IKNA 3DV6A 3FF8A 1GSKA 4J4PD 5DJAB 3KLDA 5HGDB 4A6YH 5D9SA 1F4WH 4K23L 4HFWB 1G9NC 4ZUTA 1AHWB 3WDIA 5I71C 3T0EB 1U8IB 5K5YA 2CDFA 1S7WB 5HHOD 3WNOA 1K5WA 1IC4L 4IRSA 1PG7X 3GEWB 4OAWB 1FA4A 5M94B 3FO1B 1T03L 1MCOL 5E5MA 1JGUH 4Q52A 5F0JB 4B9KC 2PW2A 3RKDC 4HEPA 3VG0H 2CK2A 3S3DB 5H94A 1EMTL 2YWYA 4QRFA 3CG8A 4QUOA 3D0LA 3T3PE 1TG8A 5CEZH 2W65A 1UM6H 4I0PB 1FNSL 2LHFA 3I2CL 2HVJA 1NFDA 4KO7A 4YFDB 3LY6A 2HFEB 4RX4D 3BPLB 1F8TH 4PAZA 1RK1A 1GSMA 1ED3B 1Q9FA 4GAFB 1ZA6A 4AYBA 3TA3D 1N8ZA 3BWUF 1OARL 3RPBA 2X0WA 4LLWB 2GI0A 3MLVH 1MJ7L 2CLZA 3KPRA 5C0DA 5F7DA 4J7RA 5JHDB 2X5PA 4DGIL 2OX5B 4O2EA 4X8JB 1M7XA 5DHYB 1D5MB 1YEJH 2NY1D 4V33A 1GGBH 2DQDL 2FB4H 3ALXA 3QJSB 4GUOA 2KT6A 1TPXB 1T7YA 2AKRB 2ITDA 3F84A 4DEPC 3QQ9C 2HLEB 3IXTB 3LN4B 4UOQA 2JKRM 2IIJA 2R1XB 2R4SL 4DKFH 4OZ4A 4ODVH 4JRWA 5DD1L 1PDKB 2QSVA 2R7EA 2ZXAA 1EWHA 3QJHB 2V7NB 4I18A 1XBRA 2WWMD 3X3FH 4J3TA 4GI9A 1F56A 3T8VA 3V0FA 3NDYE 2P8PB 3DK0A 4BDVB 4MA1C 3VXRB 3G7TA 3ARFC 3HCVB 3OHXC 4IU3A 4JFED 3SE8H 4LRNH 5EU5A 1IQDA 3S88H 4L3FA 4XODA 3IJHA 4J4PA 5DQ9B 5CP7A 4LLVA 2ID5A 1BJMA 3FZUC 3C6LB 3O6MH 1FC2D 3HC3L 1S8DA 4PTTB 3WEMA 1XGZA 1TLKA 1MY5A 4X6CB 4YPGB 2H8PA 1SVBA 2NNRA 2BRQA 5EZOH 5H2BA 2FAUA 1MDTA 1OTSD 1MVYA 2F61A 1PD6A 4XPFH 5HHOA 2C9PA 4R8WH 4YXKL 4LCYB 5GZND 1WG3A 5C0IB 3ZKXC 1IILE 5IB1A 4Z7OB 2Z8WC 3G6JA 3DIFA 5IYUA 5JORA 5D71H 2GIMA 4GRLC 1WBYB 4I3GA 4IBWA 4G83A 5LKNA 4BGDA 4OM0L 3PP3H 2ZAGA 4NP4H 4X5WB 1CFQA 4JLRB 3L5XL 4RX4A 4BHUA 4OCMC 5B3JE 2L7EA 1F1GA 3HC0A 3WFHA 3VFRA 3CQFA 3MRIB 3BUYB 2EO7A 2FATL 3UJIH 2AC0A 2NXYB 3TA3A 1A9BA 3OG6B 3CSGA 1YQ2A 1FAIL 3H3KA 4IK6A 2P5WB 2FJGA 4HWBA 4ZD3H 3BD5A 4WEUD 2Q86B 3QCTH 1RZKL 4HCRA 3S35H 1DTUA 5I6PA 5EU4B 5KUMA 1QLEH 2BSED 3WFEH 1KCWA 3L4TA 3U30B 4NBYB 5LCVH 2WJQA 5HYQB 4UOJA 3ALPA 5BJTA 4FLSA 4TULL 1HOEA 3NJNA 5HI4C 3WS6A 4AX3A 1W0VA 7TAAA 3VD2A 3QRLA 1T04A 5F88B 3GHBL 3WHXA 1P1ZB 1JXDA 5F0LB 2ZXDA 3NCJL 1DL7L 5LHDA 4N3UA 3SKOB 2OL3L 3ABZA 1ZT7B 4NZTL 5KG9B 2I60L 1UJ3A 5F1OB 3ZDXB 4BKSC 5HDLA 3QNYB 4H8PA 2HWZL 1LP9E 3LOWA 3V4LA 1TZHA 3RP1A 1X5XA 1EEUA 4CADB 4F58L 1YY9D 3NCEB 1I1YA 2CDGB 2IANE 5D7HA 1W0WB 1YMHB 1AC0A 3AW5A 4GG8A 3VJ6B 4DPRA 3T2NL 4LP5A 1H6UA 1AS6A 3QAQA 2UZXA 4WHTB 4K7PX 1IGIH 2AVGA 3RVUD 3HHSB 1Q1JL 1DDHB 1F2QA 3DOIA 4O3WA 1RFDL 4EAEA 4X99A 2CLRB 4DZBB 4DUXA 2VN7A 1A7BA 4JDTL 5GZNA 2AI0L 4G7QB 2DL9A 3AU1B 3WU1A 4BQ6A 2IC2A 3G08A 1S3KL 5GRJH 2VDPB 1EK3A 1WD9A 5HYFA 1AJ7L 3N1PC 5K9KB 5IESL 3BWUC 5JHBA 2J2ZA 1WJ3A 4HSCX 3QEHB 5ERWB 1FL3B 1IB5A 4B95C 2VAAA 4WCYH 2L4OA 3JVGA 2F15A 1QTYT 3K1KC 3PWJA 3DX2A 2J21A 3TH4T 4JRYD 1A4CA 2D2CC 5IKCA 1NBYA 1VKXB 4UQ9A 4YBQC 1JD9A 2R1WB 3CFCL 4B3EA 3AM8C 5I28A 1T89A 1P0SE 4Z3TA 5B5EO 12E8L 3HIZA 5KBKA 4W6WB 2BSEA 2Y0KA 2X1WL 4WUUE 3KPSD 1J48A 2OXHB 3PWUA 4X80L 3B2DC 2XZAH 4IJTA 4R97B 4D9RE 2GG1A 1FL6B 3US9A 4W9CC 4E9RA 1TFPA 4OIFA 1RUQH 1GOFA 1J1OL 3RTLA 1NTDA 1TR7A 4TQEH 3CXDH 1RUKH 3V8CA 5FYLD 1VRSA 1EEYA 3WIAA 2FBOJ 1A7QH 2EH7L 2DBJA 5ID1B 2X6CA 1RUPL 3F7LA 4PRHE 5CGTA 2GUOB 5K1JA 5AVQB 3F62A 4NO5B 1KCSL 3D25A 3UTZB 1TQWA 1B4JH 3S48A 3PAVA 1YDPB 3Q9QA 4U6YB 4DP4X 3H3PL 3F7QA 3FU9A 5IZ7A 3QJOA 5A2JH 3LNEA 3AWEA 3NZSA 4NFDA 1ONQB 3GMPA 4JQXC 3NIDB 1DN0A 2PO6B 1KPVA 2YXMA 5H2FO 2NNXA 4KR8A 2HJFB 3LH9A 2EH8L 3AXHA 5GRUL 4MAUL 5D6DC 1KC5H 3MOAL 4XNKA 4ADJA 3ARBD 3T6XA 1ZMYA 2YD2A 3MRCB 3L3DB 3QH3B 4OFKA 4GMTH 3NSXA 4KMTL 1F42A 3GTVA 4L2LA 5HHMB 2WTRB 1SHSA 1GJUA 3QXAB 1WWBX 2WXIA 3S36L 4H0LC 5DHDA 2OTWB 3QDME 2FWSA 1TMCB 4NQSA 1IBZA 3W9DB 3VD4A 4ZOEA 4NQVA 1QOKA 4MJ6B 5D1QC 2RD0A 4WNQA 1LDPL 1B90A 5J4MA 3TYFA 3CNKA 4Y16B 4WO4C 2C9QA 3WI9A 4HK3J 4JGUA 4WLCA 4DKEL 3NIFE 2WLJA 3ZYJA 4IHOB 5D96B 3UJJH 2A7BA 1T7WA 3OMAB 5HPOA 3WI5A 1E5AA 3SJVB 2BP3A 5DTFA 3UPCA 4JRYA 2DF3A 2CO1A 1MFAL 4HF5L 4Z77A 1D5XA 5T5NG 3RX8A 1PG7L 1KLGB 2C9SA 1A6AA 3VXPA 1YEEH 2G9KA 2WXPA 5FUZL 2AJSL 4FG6D 2A6KA 4AXWA 1M2VA 5DUBB 3KPSA 1QI4A 4JFTA 4AYID 4JN2B 3ILEA 4HIXH 1AGFB 4F80A 3ZX1A 1SJHB 3DLQR 4W9HC 3K2UH 4JFOA 2ZYSA 1RURH 2WNXA 4PW4A 2UV3A 4F3FA 1V27A 1CTMA 4MRCA 1AGCA 4YAQB 4XXDA 3PPSA 5CD3B 2ZUQC 5MEQB 4AEIH 1RL1A 2WKOF 3M1CA 3FUHA 1R17A 2XX1A 5LBSA 3JYBA 3LKOB 4ZSOA 3SGEH 2EYSB 4YLBA 2F74B 4E41E 1FFPB 2CE6A 5LGJA 1S5IL 3OXSA 3WN5A 4R5VA 4XO8A 3U0PA 3KPOB 1QSFE 4QRPD 2X4PB 5IP4A 2F8VA 3AQZA 3PL6D 5DK2B 1HNFA 5DCCA 5DRXB 1OQXA 2WQXA 2QVTA 1A9VA 3B3IB 2WXNA 2QBWA 1OAQH 3VY9X 5EZLA 2H3XC 5J13B 2EYTA 5AYQA 4HU2A 4WV1B 3CTTA 1MFDH 4K8RD 1AZUA 1BVOA 1RZGA 2GJ6B 1I3VA 5D7JB 3BEVA 1Q38A 4PGEB 1SOKA 2GJJA 4OLXH 4G7VL 3SGDH 3ARBA 3S9DB 3EYSH 1JWUB 3T4AA 1OIOA 3IDGB 3PQYD 4XMPH 5F7HA 4XMUA 1DBAH 3JWOH 5TFSH 3BVDB 5GGTL 3FSAA 5I8CB 5EC2B 2W0KA 1UT9A 4AEHL 3RUGB 4LSUH 1T22A 4PWIA 1QWUA 4XVJH 4L8SB 3U9UA 1AZBA 3WXVL 3FT4B 1U8CB 2WOBA 4KX7A 5DR5H 5AVWB 2Y7QA 5DURB 5EBMB 4JG0H 2G5RA 1A3RL 2Z0UA 3DMMD 1G9NH 4ONFL 2BSCA 1UWEH 3V9FA 3IU3B 2B7DT 1AE6L 4KTDL 2CJUH 2AQ3A 1EDHA 4PG9A 5BXFB 2XICA 2A9BA 5L2KE 1HU8A 2ZCHH 4M48L 1G1YA 4Q56A 1O9ZA 3S96B 3QAZB 3GXNA 4UTBH 2A9DA 2YMXL 4FYSA 1E4XH 4HKBB 5HVGB 3U36A 1A4KB 4OF5A 32C2B 3SGJC 3T08A 3FHQA 3MXVH 5GGSB 4XMTA 5SWZA 5E5LA 1ASQA 1N5YL 1CXFA 3ZRFC 4LLMA 1TKWB 2R23B 4WWKB 4GRWH 1PLCA 2ENPA 4TUOA 3QIBD 5FHBL 1UC6A 3ZGIA 3MLUH 1TETL 2VIRB 1NLBL 1K2DB 4LGRB 5E2VL 5F6IC 3DV6B 4C56D 1AD9A 5MHSD 2OP4H 4PGCA 3VQ1C 5T5FH 3VD0A 2EDRA 4L29B 2CHXA 1NCHA 5C0JB 5D9SB 4HCIA 3Q1EA 4QRPA 4N8PA 3ZKNC 2WOYA 1L9OA 3PL6A 2JKTM 3ZO0A 4MASA 2CDFB 3IBOA 3EO9L 4NLAA 4Z95L 4U1HA 4RFOL 1V7MH 2FR4B 3ZL2A 3FB8A 4IRSB 4OZGF 3P3SA 5HJBA 5DF0A 1KCRH 1WZ1L 2P8MA 3T6QC 5CJQH 1IZNA 3ENEA 5CGYC 1ROWA 2PW2B 5D1ZD 3DSNA 3F7RA 3VI4E 1M9WA 3P4LA 5IMLA 2XVBA 3G7GA 1UHVA 2KDYA 2W9EL 3OLEA 1TJXA 3UTSA 3NOIA 4AUIA 1BZDA 3D0LB 3BFOA 5CILH 1IBYA 4YO0A 1WD8A 5ADPL 5KVGE 2W65B 5J89A 3OB8A 4FRWA 3DNKA 2HVJB 1NFDB 3PQYA 1KTJA 3IGAA 2A3TA 1NANI 2MKWA 1FH5H 5DLMH 3HC4H 3RILA 1ZT4B 4FMSA 3ZE2E 1ZA6B 3C8KA 3TC9A 1AOHA 2XETA 1KCUH 1N8ZB 3B9AA 1IAII 3QE5A 5H37A 2VZ1A 2DJ4A 3OZLA 3KPRB 5HJDA 4XVUC 3B5HA 5F7DB 3VUAA 3TYGH 1BZ8A 4O2EB 1YNKH 3DMMA 4MB4A 3CXFA 1KLUA 2M1KA 3LQZA 4F9PC 3CLFL 4PEEA 5DRNA 4ELMF 3MBWB 1HWHB 3C08H 5HHNA 2DWSA 2HT2C 2V4LA 4ISVB 1IQWL 4XCFH 2PWFA 2AXGA 1H0DB 4BUMX 2ITDB 1UCBL 1MJUL 4HC1A 3A4EA 3TEYA 4P06A 3MLPA 4DGUA 4NQEE 2WXKA 4U3HA 2ILLA 3ZIYA 3WTVA 3QVAA 3IRCA 2BVOA 3G5ZA 4OZ4B 5E0QA 5C86A 2DQCH 1TTCA 2EDYA 4H8UA 4DQOH