4AYID

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 wild type
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
LADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayiD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayiD01
4O4UA 4U9CA 4Z3TA 3VE2A 3PQUA 3UAQA 2W81C 2Y7SA 4O4XA 4O3WA 4AYEC 4QQ1A 4AYDC 1YS5A 3KVDD 2W80C 2YPVA 4O49A 3PQSA 4AYNA 4O3YA 4AYMC 5EE2A 4O3XB 2KC0A 3VE1A 4AYID 5T5FA 3HOEA 3HOLA 2LFUA 2KDYA 3V8UA 4O3ZA
chains in the Genus database with same CATH superfamily
5HGGS 1AY1L 4PGZA 2GTZA 1JDAA 2ZXAA 1FFRA 5E6ID 3ZSTA 2WKOF 1YQ2A 1G7MA 3V0FA 1SLXA 3PE9A 1OE3A 3L4CA 1ZHNA 1IGJB 3OHMB 4LHUB 4CSZA 4MWFA 5AVRB 2O6FA 3DETC 4PRIA 5EOQH 4CKQA 5JDSA 1CF1A 3LIZL 4YZWA 3VI4E 4G9FD 3DMMD 1HS6A 1MN4A 3UGXA 4EAEA 2X2JA 1NAML 3M1BB 4ZNEA 1I7TB 3KPSD 5I76B 1ICTA 3PWNB 4JQIH 2BP5M 2Q8BH 1DE4A 4AEHH 5KTEH 4BINA 1ZMYA 2FB4H 3EGDB 4TVPD 4P5TA 1XR8B 3AT0A 1MIEH 2R0ZH 4N6RA 3K6FA 3VRIA 1A14H 3BEVB 5DJDA 1RIUL 1RK0A 3QAZC 4PGCA 2GCYA 2P49B 3V6FA 3IDJB 1DSWA 4PJEF 1ETA1 5FV1L 3VGAC 2EACA 3WKYA 5IVNA 1R0AL 4QHLB 4ALAC 3JV6A 3CZKA 3KPMB 2JQYA 1IKFL 1DL7L 4OD3H 4YFLI 5F3BB 4MAYA 5GRUH 1SUHA 1HL4A 3RX8A 4AEEA 4Z7QE 2J56A 5C08D 1JXKA 2EXTA 1BAWA 3FW6A 3O4OC 3C60A 2Z8RA 4L3EB 4WI9A 3QRFM 4LEEA 2BSSB 1M05A 2EYTA 3GO1L 3GD1C 4ZODA 3NCMA 1N5YH 5IQLA 4AYDC 3QZBA 5TQ2L 5CJQL 2I7SA 1YDPA 2NSMA 1I9RH 3SJVD 5HVHC 5CZXD 2X6VA 1KXTA 3S4SG 1LE5B 3DOIA 3GI9H 2Z91B 3UZVA 4GKZA 3LEYH 1ZTMA 5JQ6H 1OARL 3RZCD 1G7HA 2AXTO 1E6OH 1F3JA 3T0EC 3IXAA 1R24A 2N7SA 2L0DA 3TIEB 4PR5B 3MXVL 3CBKB 3TTSA 1CDBA 4CILA 2GUOA 1J0HA 4NUMA 3J7HA 1OAUL 2FWLB 4G8FB 4P5MA 3ETSA 2J8OA 2Q7AA 5C0GA 5FUCE 4MRCA 3N91A 1OPGL 2H2PC 4K5MA 5J12B 3CVHL 4DK3A 4F7PB 2YPKB 5GIRB 1WWAX 5C0AA 3CG8A 4AQOA 4KNTA 4F7CB 4NN5C 3TH3T 3LB6C 4EI5B 2Z31B 4DWHA 1B9ZA 5BVJA 4U1KB 1X5AA 1YPZE 3BWAA 3TT3H 4JHUA 3A5VA 5SWSE 1MWOA 5I16A 4HZAA 5CZXC 2Z4QA 3L54A 2IPTL 4WNSA 1DDHB 3KVQA 4PB0L 1IKNC 4M4PA 3IDYC 3K46A 4PJCF 1MRDH 2ICEA 3R06B 4X5WB 3T0ED 2YUWA 5TDPA 2HJFA 1RURH 2X9YA 4P2OB 4DJMA 3TA3B 4GO9A 1XGQB 3KR3L 1AZVA 2LU3A 4WO4B 4D3CH 2O61B 5EBLB 1D5RA 1JZIA 2R69A 2FYVA 2WTOA 3FSWA 3EH5B 4UDUB 1BZ9B 3UIYA 4XP6H 1A0QH 1P2CA 5BQ7B 1A4BA 4B61A 4OFKA 1U8MB 1YEHL 5JR1L 2XN2A 4K7FB 4YE4H 2HSIA 3CPLA 1E28A 3LB6D 2JIXB 4C00A 2P43B 3KZIO 2R15A 4F8NA 3B8YA 4JM0A 5I0DA 2MKLC 4WO4C 3S9DB 4XMWA 2K7PA 5DJ0B 1CXFA 3ET9F 5DI8A 3CDFA 3MRJA 5K33A 1VGEL 2V33A 2R56L 4PM1A 1TPXC 4GEJA 5EZOL 3WO3B 4DPAX 3FTWA 3MUGB 3SDCB 5I71C 5BJTB 3TPUA 4XAKD 1RFDL 4PJXE 3JWDL 2V9QA 3HVDA 4LCYB 4APQC 2BWDA 4G59C 4AQ1B 5I9QC 1YA5A 1R3IH 2WCGA 3O6FD 2MCG1 3MRNB 3SSGA 3NH7L 1JZFA 4KO6A 4GAGH 2OM5A 2EJ1A 1J8HE 3BKJH 5A3ID 3EYVA 1GS7A 1NDGA 4AXWB 3QCTL 1ZXQA 1BJMA 3KPOB 4RCAA 3QDGA 3B9EA 3UP6A 3WFEL 3OKMA 4BZYA 2EDOA 4NB7A 3F7YB 3HFMH 1E4WL 5DO8A 3CZGA 4JKWA 2ZKHL 1IAIM 2IFFH 1PQZB 5I9QB 1NCDH 3GSUA 2CO6B 1MEXH 3TBVA 2BJMH 3HNVH 2DKSA 2FD6H 2HG5A 2A74B 4JCMA 2J5LC 1ZGLB 2XZQH 4WW1A 4L8SC 3EJPA 43CAA 1KT2A 5J1AA 4U4BA 4FQLL 3P30H 5E1GA 3CDCA 3KPRB 1GA2A 1KGJA 3ZTCC 3PJSA 1AGDA 1OP9A 3U0PB 2AGJH 3ULAB 4PJXB 4DGVH 5IT2H 1UJ3B 1S7VA 3BVTA 2V4LA 4UAOC 1IGFL 3G5XB 3MCLH 4DOHE 2AEPH 1T04B 3B56A 3D69A 5C1MB 3RWCB 4PJ7B 2A5UA 2BH0A 4XCCL 4D94A 3WSQH 1XQ4A 2R0WH 4ZOAA 4N2AA 4U6VH 4N1EA 2WVPA 4I0KA 3WXWL 3QIWB 4JHWL 2ITEA 4Q6YA 5E5LA 3SDXE 4J3SA 1GGCH 3WFDL 4DO5A 2H2SD 3B5GA 3KNBA 3RWDA 3RGBA 4I85A 1JVKA 2E74C 3M86A 4HT1L 4NAJA 5DD6B 4L4TA 3GLDA 5GJSL 2LOEA 1BM3H 3TV8A 4LPUA 3VCLB 4EKJA 4MJHA 2I25N 3QNYA 5DUJA 4UNTA 5B8CB 4Y16B 1HWWA 3F2LA 1G4RA 1HIML 3P4MB 5CZKA 5EOTB 3UAJA 3WD5L 1NEUA 1WHOA 2MMXA 5KVMC 4MXQC 4HUCA 4C47A 1QJ9A 4EI5C 5I0VA 4KY1H 2VNCA 1N9PA 4R3SB 1D5XA 4XTRC 4UQBA 1I1FA 2XWZA 3DOSB 2YPVA 2QR0B 5LXGL 4WNQA 1YG9A 1S7RB 1E0OB 5E9AA 1QQDB 5FUCC 1OSEA 4AUIA 1G7QA 4L9DA 1UB5A 3H7BB 3LRGA 3PFQA 5AZEL 4FESA 1NC2D 1QABA 4Z5RA 1GOFA 5BZDA 2MH4A 5L6YL 4PRIB 4UT6H 4YL9A 3T0EE 2FJFB 3MR9B 3ZYIA 1KEGL 1V7MH 2OZ4A 3MLUL 2CDGA 4DESA 4EOWL 1AZRA 1RUML 3BH9A 3OMIB 1BEXA 4AZLA 1MI5A 3F00A 1UEYA 4B9KC 5A40E 4XZUA 3ZKMD 3BVNB 1AS6A 4PRBB 4LOEA 4U1LB 1BIIA 4JFFE 5JIIA 5EF1A 4WDIA 4OTXL 4P5TB 2WWKO 3IS0X 4N20A 5JHDE 2KBGA 3IJHB 1OSZA 1KJVB 3OG6B 2DM2A 3G3LA 5D2NB 5DJCA 5GGSB 1NIDA 4KDTA 5IHWA 5D8JL 2ZONA 3X12B 5KW9L 3U9UB 3JTYA 4HMDA 4MQTB 4QWWC 2Z6FA 1QRNB 4LLWB 2FVNA 3K2UH 3MRGB 2Z4QB 3CMOH 3PIQB 4MA1B 3WOVA 4I3GA 4P5SA 4GBXA 4BZ1L 2D0GA 4WWOA 3KW7A 2GJ6A 2NT1A 4H0IA 3FFCD 3GMMA 1IBHA 3BIAX 3FPYA 2WQAA 5IUSA 4YK4B 3OHXC 5GTHO 3HPLA 4XXCA 5J89A 2HJFB 1XSKA 2FGZA 2NYYC 4Q4EA 5LNDA 2DLGA 2QKIC 3RWGA 3AADB 3DHUA 2NNAB 2Y25A 4EIGB 4BRVA 4YXHH 4IMKA 1X5IA 1O6SB 4MB3A 2V7NA 2XQYG 1KWGA 2OL3B 3G5YA 4MA8H 4TYUA 1NKRA 3JV4B 2G5UA 1C7TA 4G6AD 2VMCA 3FTVA 2VLLB 4ZSOB 3FTGA 4UOW1 3F5WB 2O5XL 3T2QA 3ALPA 2OMTA 3GUFA 3SE4C 4LFHG 4X7SL 1G7HB 4AMKL 4FNTA 4NQED 3OC5A 4KTGA 3S5LB 2XRAH 5L0QC 2FJGB 4N5UA 1E5BA 4XVJL 4ZAKA 4P4RA 4E0RA 3L4VA 3CCHB 4PGBB 4D64A 1I9JL 1MVUB 2AJZB 3NIFE 1X4YA 1BLNA 1Y18B 1RU9H 2E8ZA 3OAWA 4GYBA 4I4WB 5EIIG 5BV7H 3DVGA 1ORQB 4ZFOA 3BI9X 1MLBB 1ZD6A 1RZJL 2HRLA 4G1EA 4QYAA 1A9BB 5A1AA 1FH5H 4P9MH 3EOYG 5H8DA 4DW2H 4QTHB 3FHEA 2OJZL 4H8PA 1DQQB 4Z7UF 2JKSA 1CJYA 1WT5C 1I8IA 3ZKNC 2V9UA 2XFGB 4UQCA 2AZAA 3B2UC 1KPVA 4K8RD 4PTTB 2HZHA 4WQOA 8PAZA 2RJMA 2B1AL 5T1KD 2D3LA 5FYLH 4PIBA 4XR8C 3BZ4A 3A4AA 1QASA 4EUPH 2WINA 3IFPB 4CMHC 4Y2NA 4OCWH 1X3DA 2VWEE 5IKCB 3PAZA 5JOEA 4ILDA 3L7EB 3MROB 1RIHL 5B1BB 4FA6A 4GG6F 3ZMNA 3BVUA 43CAB 3DURA 4KRAA 1I8KA 1KPUA 1URIA 2A9MH 2IOIA 4KRMB 2H26B 3CQPA 4P3CH 3FC8A 2DMCA 5JOPD 2YRZA 1J8HB 3TOPA 4IKJA 3CZNA 3ZL4L 1XX9C 2R2EA 1WF5A 4G7YL 4Z7OE 1YUHA 2R7EA 3W56A 1ZHNB 2R0LL 3RIFK 3BH4A 2ADFH 1RURL 2UX7A 3IKCB 1VGKA 1P6AB 3VVVA 1H9VA 1E42A 5HD8C 3O6ML 4NO2B 4XXWA 1DBJH 5AKTA 3RU8L 4QXUL 5KVEH 1LDPL 4FAAB 1KIPB 2YZ8A 4I48A 3M1BA 1GPOL 3SY7A 5GS2D 1RUQH 1ES0B 4OLUL 4K2UH 5A43C 4XN2A 2DKMA 3OAUH 3PCYA 4Y4KC 4AUYA 5AFUK 3AXLA 4M62H 1J8SA 3DDFA 4OIIL 4M6NH 2OTPA 1U3YA 3BWAB 4S1DD 5IM7B 4PRAB 2EEFA 4AVIA 2BNRD 2W0PA 5H4ZA 3RNKA 3TNNB 3LQAL 3ZT6A 2GG1A 3QFGA 4LNRA 4NI6A 3DPBA 5D1QE 3L5HA 1EFXA 5F70A 4PJCE 5F9AC 4QXGH 5C3LD 1JRHI 5CEYA 4FA7B 4YSOA 5DHDA 5BZWA 3GSVB 3KPRD 4N6QA 1T1WB 1S7RA 3QAQA 3ZE0F 3R18A 4KJYB 3SDDA 4YDKH 3QUML 2CE6A 4IKLA 5JIPA 1IGIH 5E8EA 3TYFB 2OYPA 3CLWA 2HVKB 5BQ7A 4GS7B 2QPDB 5SX4I 4D0CA 5AVXB 1KCKA 1MREH 5LBSA 1G9NL 1TO4A 2MCAA 3VXOB 1HZHH 3WMPA 1R4XA 5D7IA 4QJ4B 3IAGC 3ZTNL 3OHXB 4PJ9A 5FYJL 4QAMB 4UT7L 4YPJA 1WAPA 4MMXA 5SV3A 5C9JA 2I07A 1DANU 3O6LH 1DANT 3RY6A 4ACTA 3P0YH 4UZSA 3ARYA 4KMTL 3TJPA 4PJHF 4IRSB 3GSXB 3UBXA 4P3DB 2ITCB 2NXYB 2WOYA 4MYPA 4BKLA 3GSQA 5FECB 2X4PB 2WUBL 3V52H 3P30L 3AG1B 3SKOA 4Y1AD 4FYSA 2ZOWA 1LWRA 4PB9L 2R4OA 3HIZA 2WJ7A 1YEDA 2M26A 3FUIA 3RWDB 4NKMA 2CDFB 4NC1C 1WIOA 2VRQA 2MOQA 2COQA 1W6LA 1HT6A 1OTSD 1FL6A 1JGEA 1YN6A 2CQVA 3H9YA 1UA7A 1XTMA 1Z5LA 2B20A 4FXGA 4R5XA 1ONQA 2R1XA 3MACH 1I3VA 2B3IA 3HS0C 15C8H 1EH9A 5JO5B 3RGHA 1MJ7L 3VFPB 5KBPA 3UCQA 1HSBB 1SHMA 1RVFH 3U9WA 2EP6A 1HSAB 4PRPE 5EDXA 2NX5B 4R3SA 3QEQB 2WLJA 2J73A 4XC1H 4JGUA 7PAZA 3TBTB 3D07A 5BS0D 3UTTA 1GHFL 3OXSA 5HTSA 4CC4C 3UBXI 4F7PA 4WV1C 3QH3B 5A2LH 1J1XL 5C0CE 5IROC 4OD1H 4WO0A 1AE6L 1MCOL 3CZFA 3DV6A 1JWUB 2WK2A 4DZ8B 3DJTA 2A6KB 4FZNA 1Y1DA 1HXXA 2AQPA 4U1JB 4EO5A 3DA4A 3L1GA 4TNEA 4RAVA 2DTMH 5IEKA 2EIDA 4BEIA 5B1JA 2B59A 1SBSH 5E2VL 1AQKH 3GS4A 4O49A 3X11A 2WZPA 1XZWA 3TJEL 1LEGB 5FK9B 4AYSA 4BQ9A 2NYKA 5C7ZA 2DLFH 3DSNB 3ULVF 1U95A 4LPYA 4W9JC 3RGVB 2IFGA 3EJYD 3DUSA 4HEPG 43C9B 7PRNA 1BLIA 2JFCA 2R1WA 2VM9A 3NZUA 3ZZLA 1MFVA 2VZOA 4YSPA 3QNXA 1PDKB 5AEAA 4CGUB 1RUMH 4FZ8L 1TTGA 1K8IB 1BVLB 3D9AL 4RGOL 3HE6A 3Q1SH 2YEZA 3FN9A 4AQEB 4QRSB 5IROD 1R3KA 3KL3A 2OQJB 3LHPL 4N0FB 5JIHA 4HFUL 4Y1TA 4O02A 2C9UA 4ODHH 4KK5C 1QPPA 2F61A 2EC8A 1JI1A 4AGLA 4M6MH 2FH8A 2YWZA 3IJEA 1L9QA 2VXVH 4M03A 3RZCB 2AFNA 2EAEA 4NP9A 2OL3A 2VUKA 4L1SA 4U49A 4TVPH 3OR6B 3HEIB 5KVDE 1HAWA 1JPTH 1TTCA 4W4OA 1ETZB 5C0FA 4D0DA 2YSSB 2AZUA 1D9KD 5GJTL 2VQ1A 2J12B 3HS0A 3QJFB 1B4LA 4NCC1 4HIIA 4FHBD 4FQXB 1XF5A 4GQZA 5PRNA 1SQMA 3QUKB 1U8PB 2FJHA 2IBBA 3MA9L 1NCCL 4IBZA 4GUPA 1N6VA 1ZV9A 1B4JH 3QHZH 1ZLWH 4TULL 4IS6B 4ZQTA 5TK2A 1U3HB 2QSQA 3LRHA 4R0LB 5F7KC 1ZANH 3A67H 5MERB 1I8MB 3D4GA 4KRPB 3AXIA 2ADJA 4KJWC 3SBWA 5LDSA 1DQDH 3O6KH 1FF5A 3II2A 1CDGA 4X4MA 1L3NA 1CD8A 2C5DC 3GHEL 3MOBL 4X0KA 4ZMLA 3WTTA 2YQBA 5HHVL 4X6DE 4UILL 4K7PY 4GBXB 5E2TH 3PAVA 3RTQA 5T8IA 1D9KC 2P80A 1OAXH 2QZQA 3OGCA 4QEGA 5C07D 4UUJB 4KVPA 3EOAB 1KEML 1MPAL 5E95B 2NCMA 1RIUH 3LMJL 5DD1L 4L1LA 1PBYA 2NLJB 3SDYH 4Z7NE 4FXKC 1P4LB 3QG6A 3N41B 4I18A 3U36B 1I1FB 4P2OC 1PZ2A 2JV6A 5A2FA 1MW3A 3D5OF 4ZO6A 4M4RB 2VQTA 4Y1AA 4ABVA 1Z3GL 4F7KA 1EVUA 5I24A 2IWWA 3S34L 3D6GA 3QDHA 3LY6A 3O3DB 3Q2VA 4IBTA 3O45A 2FBJH 3FFDA 2P5WE 4MNQD 4N9OB 4OY9A 1K3ZA 4X0NA 1RIVH 3ABGA 1DUYA 1Z5YD 4JRYE 2OMNA 3V0VB 4P5KB 5CJQH 1JZ8A 4TL5A 2VE6B 3QQDA 4HS8L 5I1AA 4WI0B 2FLRT 2RCSH 3T5WA 3WDHA 3U6XS 4OZHB 3ATFA 1XD0A 4L9LB 4JNXA 1IV8A 1N0XL 2ZOLB 1Z9SA 3QK0A 2PW1A 5DJCB 3VDAA 5IM7A 1MCEA 4C56A 1CICC 3NCFB 5CCJA 4QXUH 1N5AB 2HX7A 2OZ4H 2YPVL 4AQ1C 1OALA 1J86A 3KPTA 3L3OC 3L5WA 1E8ZA 4HJTA 3JV0A 4LL4A 4P2QE 3MSPA 3D0AA 1SEQL 1Z32X 4BFJA 3KEHA 4UOQA 35C8L 1EFXD 1UCBH 2VDKB 1PZUB 3HE7C 4MXWH 1LO4H 5D1QB 3ZKXB 4AYMC 1KGUA 4KROD 4JHBA 4F7MB 1U92B 1BMWA 2KZBA 2WQWA 3VXMD 1MFCH 3ARQA 3IGFA 4KX9A 3H0TA 4KVCL 3O11B 2Y4SA 4TNGA 2VJ0A 3NRQA 4MJIE 3Q7JA 2XIDA 3T77A 5FKPA 1J8KA 1RAMA 1XF1A 4NWTH 2VDPB 4PB0H 5HGDB 1MRCL 3CVBA 3SDXF 2AV1A 3EZ8A 5HHOE 1YPZA 2EICA 2HKAA 4RAVB 4F33B 2Q6WA 1OTTC 1G6RA 4FABH 4YHML 4NT6B 1CD1A 5H94B 2VDNB 3LHAA 5IR1B 3U2SB 5DD5H 4ETYA 4LSIA 2BY1A 3KR3H 3HNSL 1A1OA 3JYBA 2VRKA 4R96B 3N43B 4RISH 2IADB 1AAJA 4OD3L 2C9SA 3C5OA 5AB1A 4TNFA 2X89D 4Y5XC 4U9CA 2EH7H 2IGFL 2KPWA 2UZYA 3O2DA 3PHAA 1TQSA 4FHKA 4PLJD 5JW4M 3MRDB 1SYVB 4HQQH 1BAFH 2GUYA 3CK0H 3MUHL 4OZGF 5TQ2H 3UTSA 4QO1B 2XVGA 2CJSA 1JGEB 1XGYL 3L3IA 5I1CH 2GC4C 1GGIL 2BW4A 1L7IL 3BD4A 3V7MA 5JW4N 1CGWA 2DL2A 2QDVA 3TCTA 1JJUA 3S5LA 4KO9A 3BP4B 1CGSL 3B2PA 4KJPD 4YBQD 1A6TB 2DD8H 2Y7NA 1SYSA 2XN0A 4MMZB 2ZCHH 1IB5A 4Q14A 4KZEL 2ZCLL 3LKRA 4ZNEE 5EU4B 2ZCKH 1HKLH 1ERNA 3MRJB 3PL6B 4HCRL 3L3DB 2PXYD 1TETH 4ES9A 4IBLT 4BHUI 5E8EB 3TYFA 2YSSA 2A6KA 1UA3A 3ORJA 1T03H 4JO8A 3S7GA 2Y7MA 1BOYA 2AHIA 2IPUK 4ZUSA 4LCYA 1QSEA 5DUBA 3BSZH 4B0MM 1F90H 5CZVH 3MXWL 1HNGA 2Y72A 2ZUTA 1H8OA 5F3HA 3MLZH 4NC2B 4UINL 5DUPH 4PJIB 3TT1L 2C1PB 5JXEA 2DMBA 1KJ2L 1BM7A 4RDBA 2G0LA 4E42B 4X6BB 5I8KL 4NUJA 4LSDA 1I8AA 3PWPA 4MJ6A 2ATKB 2VLRB 1NEZA 4U6XA 4LMQE 4XP4H 4A2HA 2GTWB 4HHGA 4YDMA 3IFLL 2P44B 3JTSA 4NKDA 3VH8A 4NFCA 4KKRA 5IW1B 3BUTA 1IX2A 1PZDA 2X28A 2WCSA 1TYJA 4FJZA 5AAWC 5BPPA 5DMGD 3GWJA 1F2XK 1T0NA 4Z7OB 3KPRE 4KKBD 3SKJL 3B7TA 4ZO7A 4M3JA 1NA8A 5B4MC 1OPGH 1QOKA 3N5AA 1DQKA 3RPIB 4WFED 5B1CA 3OLIA 4Q97A 3WN5C 1V27A 1ES0A 1IL1A 1YLBB 4LLDB 4AIXA 4J27A 2ZWNA 2YAEA 4A2FA 4XMPL 1NAMB 1ZV5A 2DAVA 4WJKB 1XGZA 1MNNA 1MF2L 4NHUA 1OAZH 1K4CA 4ZFGH 2HLFC 3NCJH 5D7JB 2X1XR 3UAJC 1TU2A 4PJ7A 3I02B 4M6ML 2WLYA 1FNSH 2VXVL 4BH8B 1CWVA 4X8JB 4JFZL 1MFAH 4ZTPL 4W9HC 4IKIA 3MO1A 4OGXL 3UZEC 2EEXA 4P46C 4TVPL 3TVMA 1FNGA 3PDOA 5IMLB 5B3SB 3IDMA 4AI7A 1KCUH 3IMWA 3EFFB 3AY2A 5B4MD 2ZXBA 1U95B 5MERA 1I8MA 3CFDA 3G04A 1YEHH 4PQXA 2JNZA 4ZK8A 2PP8A 4ZUUB 7FABH 2TSBA 3L08A 3VQMA 3ARBA 1JWUA 3AS1A 3VU2A 1INQA 3NIDE 5HJ3B 3NCYP 4JFXB 3WFCH 3BIKB 5ISZB 3HE6B 1DJZA 2YEZB 3B2DC 1ZGLA 3V4LA 2UZXA 1CLZH 4YAQA 1NGZB 5HDQH 3ISWA 3FH5A 3F7VB 1LDSA 3RI5K 1YN7B 5F6IB 4B9YA 1JZ3A 4NERA 2PPCA 1NFDE 4IIQB 3QCUH 4BQBA 1CI5A 1QVOA 3HJ0A 4DEPB 2J1YA 1FNHA 4PJXA 1JE6A 1WZMA 4DTGH 4FFYL 1H6EA 3WJMB 4OLEA 1S4IA 3DIVA 1SY6L 3PWLA 2I9TA 4S1QL 5I18L 3VG9C 4LGPB 4Y16D 1KOAA 4I1NB 4NZRL 4Y2LA 1M2VA 4NKMB 4Z7UA 3FQRA 2DDQL 3AZUA 2J8UB 4KTDL 3WXWH 1ADQL 5EZLA 4U1JA 4FFVC 3E7JA 3P4LA 5C0JB 4QAWA 5L2KD 4K3JL 4OKVA 1BM3L 2EECA 4GIOA 1OEZW 1WBYA 3DGGB 4GSUA 4N2IA 4PW9A 4UT6A 4YMPA 3HOLA 2KDGA 4KI5E 3EHBB 3X1NA 2P7TB 4S0HA 4LESA 1LD9B 1S5IH 4YSAA 1T5XB 3GXPA 3WLBA 3RL1B 1ML0A 3MRIA 1JWMB 2Y0LA 4ANVA 4NQEE 5IHZB 2WM0A 2HRPL 3QEQE 2BCKB 2R69H 4WRLA 3OKYA 3OL2A 1DEDA 5LBGA 5LWYH 4GS7C 4FRTA 1YEJL 2XE1A 5CN1A 5DF0A 3FUFA 3L5WB 5F1NA 2BZCA 4M5ZL 3MGTB 5F1IA 1UUNA 4HEMA 4PG9B 5F1KC 4DGVL 5IT2L 3G5YB 4HS8H 4B9IA 3OKOA 3EYUH 5EBLA 1MAJA 1EANA 3X12A 1TQUA 4RGNC 1BDYA 4LIQE 5DEZA 3D39E 3NCXA 4KOBA 5JUEH 4W9EC 1EZUA 4XCCH 5FVNA 1CZ8L 1QEWA 5D2LF 2PPFA 3PIQA 4KGJA 4OZIA 3O8XB 2IDUA 4ABWA 1UWGL 2YMTA 5EFIB 3L4UA 1F13A 4UDTA 3E3QC 3QNXB 1ZV2A 2R89A 4P0DA 3SBPA 1I3RA 2ED6A 3WTYA 2A9CA 1BMZA 5DJ2B 4PJ6A 1G6RB 4OH2A 1RH8A 1UD8A 4L5FH 5EORL 3C08L 4L4TE 2I5YH 4LLYA 3HS0B 4HAKA 5KJ7E 4EZLA 3V8UA 2XE2A 3ARED 5B39B 3I84A 1C1EH 3HOGA 3IMSA 3VYPA 1BZ8A 3WGVB 1CC3A 4HH9B 4DSYA 2F68X 3T04D 3BFOA 3NFSH 2V6HA 4JJ5B 5GZNC 3GMMB 3QPKA 3GO1H 1JFQL 4JPWH 1SF3A 3A6CL 5DD0L 3WEBA 1OCZB 3QIBA 4YZFF 4NQDD 4TPRH 1LE5A 3SPCA 2B5IB 5IHLB 4YFDB 1H3PH 1AGBB 4FI6A 2CDEA 5C0DB 3TZGA 3TASA 2EDFA 4KH2A 3WAJA 1F3JB 3V95A 3U7YH 3C6LB 1T0PB 4Z7QB 2AI0L 2CKBA 1NOAA 5GQBA 3L5IA 1IIKA 3T24A 3ULUH 3HCVA 3D3VA 1YY8B 4J8QA 3UPAA 3WDIA 1LWJA 3TM6A 2PMZA 1K72A 4X99A 5DD3H 2VDPL 1AYRA 3ATBA 3PYCA 3V6OA 1JVLA 3HAEA 3KPRA 1PG7H 4H1LA 5C0IB 1BREA 4MDRA 1F2QA 1M71A 1QLEL 2B14A 4YXKH 5D1QD 3RA7L 3O0LA 4M9PA 4P3WA 1MWAH 4X4ZA 1VPOH 2VLJD 2X4QB 4Y89A 4BZ1H 5ADPL 2YGNA 2CR0A 4RMBA 1T04A 3D69B 3ZE0E 5HYFA 4QHNA 3UADA 2VDOH 3NSCA 4FNQA 4LRIC 5I26A 5K9JL 2VLME 1TJMA 5CGBA 3K72B 3NFPB 1CD1B 1RJCA 4LPVA 3D33A 4FG2A 4L0ZA 4GI9A 1RZ8A 4CADA 5FHBL 5I2IA 1MHPL 2ROXA 3HR5B 5HHOA 1I53A 5LNGA 3LVEA 4XZ4A 2E8YA 3HI1B 4L1DA 5D1QA 1UWXK 1JN6A 3PNRB 1NDMB 2DYRB 3L4YA 2DIEA 3AA6B 1BZDA 3F58H 4F8LA 3QZOA 1N18A 1MVFA 2YPLD 3G04B 4A39A 5EO0B 4DUXA 4HKZA 4OZHA 1EEUA 1F90L 4R90H 2NNFA 3QNFA 4HGWB 1FG9C 1S7UA 4L29B 3IGUA 4QRAA 2ROYA 1NM4A 1KCRL 1CUOA 3GSVA 3VE2A 3QUMA 4AJVA 1UACL 4Q6IB 3WUZA 4FNUA 1J0JA 2XKNB 4M6OL 4NQDA 5KS9A 1Q94A 4U1NA 2DI7A 2NY4B 3LD8B 1G9ML 5T3ZE 3PQSA 3TXAA 5IOKA 3SDAD 4HMEA 2R2EB 2GEQA 4Y2DC 4A67A 2CWRA 2BS9A 5CU5A 3VXUA 5JHAA 3HE7A 4F24A 3FT3A 2JCCB 5F7AA 1I1CA 4LOFA 5T1MA 4LEXL 4FI8A 3VFRA 1KWKA 1ET7A 4TUJA 3KYKH 5GRWA 4R0LC 4L9LA 5J7CC 4N0YH 5DRWB 2ZX7A 1WBZA 1PLCA 1J9RA 4K2UL 4G3YH 5HHNB 4AQ1A 2VUOA 3GMQA 3T77B 2D31B 1AHWA 1Q72L 1PX3A 5C3TA 1CYGA 2FX9L 5HHME 3KS0H 5BZZA 1U3NA 5FYLL 2EH8L 4UAHA 1AC6A 5IZ7A 3D06A 1YEDB 3N6YA 2OMYA 5J1SC 4PJ0O 1NC4D 1CG9A 4B97A 3ECBB 4Q9BA 1EQWA 2WIIB 4LAJH 4G11A 4JZJC 1Y6MR 4CRPA 2YKLL 1E27B 2HPOA 3MFGB 4KITB 1P53A 1OHQA 4JO2H 4QXGL 3WFHA 2PYFA 1FA4A 2OKMA 4AL8H 3MJ8B 5C0NC 3PWPB 3T1FA 3WUWG 2DTML 3LZQA 4FKHA 1G0XA 3OBAA 5KANI 1MFAL 1AQKL 4G9FB 2EYRB 2FD6L 1IBYA 4F58L 1FZOA 2CR6A 4OF5A 1VJSA 4D2NA 4DP4X 2PO6B 3LN4B 4U0RB 4XOAA 1OOAA 1HHJA 1AD9B 3WIHL 3QBTB 4PWFA 4XPTL 5IG7B 1MREL 3ZSSA 4UNVA 2WO3B 4WTQA 1N4XL 2BNUA 2EDJA 4KI5F 4NYLA 3RL2A 4B3VA 1A3LL 3FRPG 4PFEA 2FGRA 4U3SA 4FTVA 4YXLL 5IJKC 3P02A 3CSTA 2QLYA 3IDXH 3ROOB 4BUQA 3F5WA 1NSNH 3QB7C 4ZS6D 3VXRD 4OLYL 2VM4A 2XKUA 5A2AA 5I0ZA 4RGOH 4TSAH 2RQEA 5DK0B 5BMFH 1HILB 4NPKA 3PL6A 2JKTM 4HETA 2VW6A 4L1BA 2HFTA 4ELMA 1BX2B 2Q86A 1AFVL 3GP6A 3OMNB 2XU9A 1B6DA 1CK0H 3MU3A 4IHBA 3MX0B 4I9WE 1ACYL 2Y7QB 4EQ3A 4MMYB 4ANKA 5FGCE 4K7PX 3VCLA 1BLNB 1Y18A 1QLFA 1T0MA 3B43A 3EG9A 4JHZA 3FTZA 1TYEB 4NI3A 3FU6A 1NL0H 1INDH 3LEXB 4K23H 4GW4A 2LFUA 1BPVA 4Y16A 5B7MA 4H2AA 4L3FA 3PHQA 3QDJA 4WEEA 4JG0H 2D7MA 5TK4A 3K80A 3LN5A 4UTAH 5G3AA 2DL9A 3HC4L 3V4PL 1MFUA 2VXQA 1JGIA 3T6ZA 2VXTH 1JF6A 2UUDH 3EFDL 4Z0BH 1JMXA 2P8MB 5DUMH 4HUWB 4WEUD 3UMTA 3KYOB 3ATEA 4G2AA 1A6UL 4ONHB 3VO0A 1JNLL 4JRWA 4OF7A 5GISL 4MZRA 3GNML 4YHPB 3B9KB 4IL6O 4OQ1A 5HJ3A 2YWYA 2ZF9A 2R1WB 3NQIA 2DLIA 3WKQA 1WS7A 3X3FL 1L5GA 1HCZA 3BUPA 1KY7A 2A6IA 4WGVB 2WKOA 4UV4L 4X99B 5I1HH 2JI3A 1T80A 3FO1B 2AQ3A 5AD0B 1ZHLA 5BS0B 4WFHE 2G9KA 1TITA 2ESVB 1D5BA 1XZ0B 4XN8A 2V0AA 2WD0A 3BWUC 1RJYA 4HWNA 4MJ6B 3ZZQA 5IESH 3VW3L 1E3FA 1QWUA 3JYCA 4ADGA 1IBFA 1SXZA 4ZUUA 1EUUA 3LSOB 1PAZA 2ZXCA 3HE6C 3DSNA 1VEPA 3Q8FA 5ADOL 1F0LA 4JN1L 2X2YA 4YHNB 3BE1L 4XBPA 4XPBH 3EGDA 5JW3L 5M7QA 4UM9A 2ARWA 1TU2B 5SWZD 5B3JE 4HPOH 4JFEA 4N6RB 3WL9B 1IC7H 1IEBB 4FFTA 5TISO 4X4KA 5EC2B 4IOFD 5I2IB 1A4AA 3GRWH 5KVFH 2VSCA 2DQDH 3QORA 3QEUB 3R8QA 1MIMH 3FUKA 2H0JA 4Z76A 3CZUB 5EEVA 3OJVC 4Y4HA 4PJEA 4Q58C 2VITA 3APCA 4MAYB 1HCFX 1B3IA 1LP9B 2V7NB 2VGLM 4S1SL 1K6QH 3GJFH 4GXVL 4YXHL 2O6DA 2MCMA 5I30H 4N9GA 4NHUB 4F80A 4PJ5E 2V2XA 5CN2A 5AOKA 1IZNA 3RIAF 3NTCH 2XWTA 3PAUA 3PGDA 3OWRA 3CV5A 3TJHD 4DGWC 1LTXA 5DVNA 4P57A 4M1GL 2J1NA 1KLUB 2XBZA 3LRLA 4XN7A 1YPZF 4Y1AE 4I3RL 4F2FA 4N0UB 3H3BC 1UZ6F 3T3MF 4X9YA 4CC4A 2ADJB 5D6CA 1UB6B 4P4RB 4ZD3H 5I8CB 4N2BA 1Z9OA 1MJ8H 5KOVC 3FN3A 4AKQA 3WLBB 1I82A 5INCB 4FZ8H 5AW3B 2FJHB 2O5YL 2P5WD 3AQDA 2X40A 4UT9A 5D5DA 3Q2CA 3SDCC 4RBPH 4IBUA 1UCBL 2CLRA 5CWSA 2ERVA 5JW5A 3GM0A 1FG2A 1JGVL 1XBDA 1CFVH 2D7OA 5K1VA 4OM0L 3AWFA 5D2LE 5IGXH 1Q4NX 2PP9A 3V6ZB 4D9QD 4HOXA 3QS3A 3SB3A 5CLZA 3O6FA 4Z77B 3QFJB 4FT6A 3F12B 1WA2X 5B7FA 2J43A 4BCYA 1KY6A 4Y2OB 5D8JH 2WB7A 4XCFH 3BRDA 2CM5A 4U3CA 1DBKL 2BRRH 3LNHA 1CLOH 3ME0B 3MYJA 3W5MA 1G1KA 3QEGH 3AS0A 1BVZA 1WS8A 2W88A 3G5VB 3LNDA 5FCUH 4UUJA 2D3NA 2DWSA 2VR6A 1HX0A 5EDSA 2YXFA 5IQ9B 3MJ7B 1YUHB 2R7EB 1QO3B 1DEEB 3PWUB 1TPXB 5F1NB 2DWDA 2ODHA 3BPCA 3KDPB 1E54A 1NCCH 2Q8AL 3NJKA 4AM0Q 5DMKB 4YVUA 3MA7B 2AQ2A 5A2BA 1IGML 2ENQA 2GK0A 4FERA 5DA4A 3W38A 2AVFA 5K9QI 1KIPA 5C6TH 2VZTA 3FT9A 2APXA 3GGWB 3V0HA 1BAFL 2AV7B 4PY7A 4OLVH 3QIBD 3V4VB 1SOKA 3QRBA 3L3OA 1SN0A 1UD4A 2B5IC 1H9DA 2BCKA 4ZFZA 3ZMRA 1Y6KR 2WLHA 3ABMB 2X4UB 4NKOB 3DROB 4GXUN 5I73B 4X6DF 3UTSE 5D5ME 3O11A 4A66A 3PGCB 1MXDA 4OZFA 1A7QH 4PS3A 1R5IA 1W8NA 3H9HA 2UVFA 3A4EA 3QXVA 4TTGA 3G6JB 5GGRY 2RACA 4CMMA 1UA6L 2MPAL 3CBJB 2B1HH 1CFTB 1P4BL 4XNMB 3HZVB 2BVQB 3BQUC 3AA0A 3MODL 1CL7L 1O7SA 2OI9C 4YDJA 4QRTB 3BUDA 3IKKA 5AW2B 4U3HA 4B9FA 4KHTH 3GC3A 4FE9A 4DGIH 4J7RA 3RBGA 4K5NA 3BPOB 4ODUA 3S34H 4YHPA 4JFHD 1XH0A 2JB5L 4A7GA 1XCQB 3QIBB 3VSTA 3ZE1E 1LGVA 3O4OB 3CC5B 4OI7A 1AD0B 1U36A 2ZOUA 5LBVA 3PGFH 4BZ2L 4ODWB 3B6SB 4UV7L 4N8CL 1ID5I 3VRIB 5JQIB 1WISA 5IVZA 1KGWA 5HPMB 1FRGL 1LO2H 4JRYA 3LKPB 1CGYA 1AGDB 2COVD 4MCZA 4BKLB 1EVTC 1N0XH 1IGJA 3AS2A 1CTNA 3OZ9H 4AC2A 3U2SA 2NQ3A 4AM0A 2XYCA 1JZ7A 2ICCA 2I60L 1SDDB 5JZ7D 1QJPA 3GSRB 2C9QA 1II4E 1PD6A 4J3OD 2D03L 3TTYA 2Y7QA 5CS7A 5BJTA 5I8OL 1USZA 1NMAL 2EH7L 1S9WB 3FUMA 1HHKB 3ARDB 4LCWE 4XAWH 5GS0H 4HQQL 3NK3A 2FEEL 4HIHB 2VR3A 2GTWA 2XETA 5IEHB 7PCYA 2EDEA 5E23A 5I1CL 4FGMA 4YHIB 1UYWH 2FEDD 4XMPH 3EDJA 3D39B 3LKOA 3FOLB 5IBTH 3MRMA 5DL7A 1RK0B 3AC0A 3ABLB 2VLKD 3FQWB 3G9VA 3GKWH 4HXBH 2FO4A 4WUKH 2XJLA 1OCRB 4FP8L 5KBLA 2FE0A 1OQOA 2P47B 2Z7WA 4J4PC 4PRDA 2DBJA 1WFTA 2PCPA 1AOHA 2ZCKL 1CFQB 2X1QA 1BP3B 3LK41 1CE6B 2AJVL 2P5WB 3FB6A 3RTQB 4O51B 5D4IA 4ZTOH 2OP4H 5DJ6A 3EOTL 2QKIB 3BGAA 3IFOB 4G9FA 4Q56A 4E42A 4CTDA 2GJ6E 1KTLB 4M5TA 1ZT7B 2E6PA 3FJTA 4PRID 5E5UB 2HVBA 4IJ3C 4OUUB 2KL6A 1UM4H 3EF4A 1VAHA 1AD9A 2EDHA 4A55A 1G7QB 4F9LA 4PAZA 4IMKC 5HP5A 5EE2A 5F8QC 4UDUA 4Z0BL 5BZDB 2X6AA 2Y2TA 5E6IA 2YAQA 4X5PA 2QQLL 2I27N 4ZFQA 1Z2KA 2H32A 1WZKA 1Z9MA 5DVKA 2VSMB 4HP5A 2CCWA 4OGAD 1D5ZB 5HYEA 1JV2B 4UZGA 2KDYA 3DUSB 5BNXD 4FQJH 4TS6A 1J5IA 5D96B 4GBXC 3EYOA 1NM9A 5F3HB 5JPNB 3N1QC 4JFTA 2EYRA 3F6JA 4G8FA 2D31A 2XTJC 4FMVA 3ZPDA 2WTRA 5L88H 2ORBH 3CTTA 4X4ME 5ITFB 1A2YB 3UC2A 4NZDA 1NBVH 1AZCA 1Y0LA 5AWNL 1QTYT 4X4XA 1M57B 2DMGA 1UQSB 1U6AL 1P2CB 4O02L 2AQ1A 3BMWA 3EDEA 4M8RA 4UB6O 3CX5K 4HWEL 4QGYA 3DSFH 3FH7A 1CGUA 2JKXA 3CFQA 5D2LA 1Q1JL 3BE1H 1J5DA 3LTVA 2P48B 2H8PB 3DK2A 3JWNE 4EE2A 3HMXL 1TJXA 4HUUB 3VGDA 1OCWH 3VI4B 5FO9B 1HI6A 4ZI8A 2A0LC 1MCPH 2D3JA 4QRPA 1S9YA 4KQ4H 1F97A 2NY2D 3GK8L 3N40P 1AHWB 5AZ2L 4N25A 4I2XB 4NQXA 5DEFA 3JT2A 1KB3A 2JTDA 3ZHLA 4PI0A 4R9HA 3IF1B 5IROA 1TTFA 3RX7A 4EUPG 5B38A 4ZMYA 1WIPA 1M1SA 5T5FH 3DARA 3NAAL 4GG6E 4YPGA 3WLWD 2FQEA 3VD3A 3W9EA 4EI5A 3GJEB 4KUZH 4YBLB 3DWOX 5HDWA 1DBML 1S5HB 3GTNA 4GUPB 2AQNA 1QZ1A 3E38A 5J1AB 3MR9A 2B4CC 4K9EC 2GY7B 3FN0H 1IGYB 4CDGC 1AR1B 1YPZB 4YGAB 3RWIB 4F20A 4LL1A 3Q6FB 1H8SA 5LVEA 1VFBA 4AW7A 1F45A 4FXGC 5K93A 1ZT1B 4NNYA 4PGBA 4LB8A 4LSPH 3F7VA 3KPOA 2LTQC 4B3EA 2EXYC 3DX7B 1UJTA 3EYUL 1G87A 3K91A 4BCZA 4HAFA 5BVPH 4PGJA 3G5XA 1W0WB 2ZSWB 4OZFB 4LPCA 4X83A 3AAZB 4PLOB 2C7FA 3BPLC 3DVFA 1YYMH 1MI5E 4MMYA 4X7TB 4XB8A 1S9VA 2QQNL 3A4FA 4JFEB 2E27L 1SPDA 3NJJA 4DHLA 1RXLA 3C5SA 4DP9X 1CLYH 2HKHL 1NBYB 4JKMA 3MRNA 3ZN6A 4HSQA 4Y5YA 1Q38A 4TRPL 5DL8A 3LN5B 1BD2A 1IBDA 2IWGA 3BO8A 5HDLA 3SPHA 4L5FL 4PJ9C 5DD1H 4EDXA 2HFFA 4AYID 3K5SA 5CJOH 5JYMA 1IQDA 4DT2A 1BVKA 2CBPA 2Z8VC 3LD8C 4M5YH 3TF4A 4KVNL 4JG9A 2F8OA 4AWJC 3DTXB 5IJVB 5IBLC 3U6RA 3UYRH 5SWZE 1ECZA 5ECGA 1QA9A 5E4EB 1DUYB 3DA0A 4HOMA 4ZO9A 3DK0A 1N70A 3BXNB 4Z7VF 3VDCA 4YDLB 1L0PA 4GRLB 3KWWA 1ZGLP 1OT1A 3MGTA 3NSJA 5F1IB 4PRPB 3VFOB 1GGBH 5H4YA 4LLYB 5EEZA 2WO2B 3GMLA 1WZAA 4WFGE 1VZGA 4Y4KB 3FZUD 3D51A 3PABB 5J9PA 5TPWL 5KVDH 3VD1A 5HGBB 3UACA 5DHMC 1RJZB 1J18A 4Q9RL 1VACB 5KAQF 2XIBA 1BMGA 1LD9A 4M7LT 2X4OB 4GIAA 5CKGA 2BCMA 2RGSA 1PQZA 3PRZA 5E2UL 5DD3L 4WENB 4FFZH 2LGNA 5EFIA 1TTRA 3MMEA 2WHVA 2JKIS 4APQA 5TF0A 4OLVL 2YEVB 3H2QA 1QUNB 1IC5L 1AKJD 2J4UP 5C0CD 1MW1A 3KXFB 5GGVL 3W0WD 1TFHA 1NCWH 5FW8A 2VXQH 4ODSH 4FNLH 1QRNA 3G7GA 5BO1H 3LH9A 2UUDK 5FS5A 4DKEL 5AQ0A 1ZVNA 4WWNA 1PKQE 3X14A 1DN2A 3P4NA 4LFHD 5J0BA 4O51A 4ZW6A 4XXDB 1MCQA 4AZ8A 3IGKA 5SWSD 3QZNA 5KJRH 3UJJH 4LRNL 4BBWA 4ZMWA 1HTYA 1O6VA 3TBWA 1BIIB 1ORSB 1OW0C 2B3RA 2CPCA 1X4ZA 4NRXB 1DCLA 3VXMA 1MHPH 1UADC 4I88A 4MQSB 5B22A 5HYJE 4CW1A 1S9KC 5DFVC 1KLUA 3V4PA 2XTQA 4A2MA 2CSPA 4AIZA 2ZJSL 4JLRA 2PYED 1BJ1H 2SODB 5A6IA 2F5BL 3BAWA 4TXVB 3KJ4B 3SJVB 2I5YL 1IQWL 2WP3T 1FFPA 2WY3B 4WTXA 1YYCA 4OIBA 4H26B 3MCYA 4JFFD 4H88L 3O4LA 5DD6A 5TE7H 3UTTE 3WNNA 2HRPH 1IBGH 4KXBA 3F84A 3D39D 2FYYB 2MPVA 5C2BL 4FEMA 2OSYA 5C92A 5HHOB 5ACMA 5EBMB 3EOBA 1E4XI 5CBAA 3PGFL 4O58L 3CBRA 5FM5O 2IGFH 2DKUA 3AMKA 3LIUA 3NJGA 2WVTA 1BFVL 1E65A 1RPQA 3BVNA 4PJHA 4PRBA 4TQEL 4Z95L 1DJWA 2ZWYA 5JXAL 1U2CA 3PV7A 5LDUA 3S5LG 2GPZA 1RHHB 2VN7A 3QA3A 1NFDB 3DOSA 1M42A 3L13A 4H1LH 1M3JA 4P2CG 4YHIA 5JUEL 1FVCB 3SPGA 2RCSL 4OV5B 1RZPA 2NY1C 2X9XA 5DA0B 2R23A 3H42L 2WLNA 3V5KA 4K4KA 2D0FA 3POUA 2A6JB 4ZAKC 2X6CA 3BKYL 2H5UA 5J8OA 3OMAB 3NGBC 4Q2ZB 4KZDL 1YY8A 4LO9A 1RZ8B 1ZPUA 3RWHB 3VI4F 4Q6IC 4QPEA 1JF5A 1IC4H 4ZMXA 1FLTX 2X4NB 5EUOB 2XWBB 3HE7B 3VXUB 1NPUA 4CBZA 1JN6B 4IOSD 5JPMB 4QMEA 1F4WH 4MWFB 1K5NA 5DLMH 1MCSA 2NRDA 2BSED 5E24E 2Q3XA 2ZUQB 3KPSA 3POCA 2ZFGA 1DQLL 4D9QE 1QVOB 3P11H 2XN1A 4JFOA 3BSZL 4QTHA 4CMMB 3RURA 4ODWA 2WN2A 3B6SA 2DF3A 5E08L 2N59A 3V9FA 5CSZB 5FGCB 4ZSOA 4XNZB 2W60B 3QULB 3R0MA 1I8IB 4RIRA 3DMMC 4JPWL 3X1BA 3UPRA 4MAYC 3C5ZD 3TIDB 1Q9OA 4ZXBB 3MYJB 1LXMA 3C5JA 5AVQB 4UT9H 4WUUE 3CFUA 2FGWL 1XMWA 2FJGA 1BH3A 3INUL 4L1HA 4U6TA 1UD6A 5BQDA 1YEEH 3EGXA 3VZUX 3QWRD 1FCGA 3AQZA 2EO9A 3RBHA 5ANMA 4OZGE 5FA3A 4KDTC 9PCYA 3WY1A 4GAAA 1U3HC 1OB1A 2LLLA 1E5CA 3NZHL 1AXTH 3I6LD 4HA1A 2Q76A 4XWOC 3FB7A 3QWRA 4AUJA 4NO0A 4IDJH 1XR9A 1T7VA 3JTTA 1JNNH 4R2GB 4XPFH 3MV7D 3FQXB 4DH2A 3P77B 1FL6B 3MNVA 1AFVH 1YN6B 1PG7W 3TC9A 1SFHA 3IU3A 4RJWA 1HHGA 3IRZA 1MKFA 1HOCA 2K8QA 5IB2A 3GI9L 4J1UB 3BCDA 1KPVB 4PTTA 5CP7B 3TWCH 4Q0XH 1OARH 2WXGA 4XO3A 4G7QB 2AJYL 4TKWA 3UO1H 1DZBA 1ZA3A 2G75B 2DQCH 1UM5H 2GHZA 4MXVF 1HL5A 5DJ6B 3PG2A 2QTKA 5K9JH 3CDGB 1WFIA 2H6UA 3P9MB 2VLKE 4NPYB 5CR8A 2YLKA 1A9BA 1T1WA 3QQXA 3S37L 2DEYX 2JMRA 3BUBA 2CU9A 4JGJA 4OCRL 3UEQA 4UDTB 3VI3B 3VD5A 4JANA 4KKLD 4JFZH 3MJ9L 3GXUB 5EO9B 3LKOB 2N2MA 4DPRA 4JKPL 1YNKL 1HINH 4EIBA 4ENEC 4LCWD 2W5PA 5KVGH 4KXAA 4U1KA 1DVFD 1P7QD 2QSCH 1ZWIA 1BGXL 5JPNA 3BWSA 3NAAH 1MCKA 5TJWK 5F7MC 1JXJA 5JQHC 7FABL 3FCGA 2YBRA 2D7NA 2ITCA 2NMSA 3MBWB 2WTRB 4LOUD 2J71A 5D7LB 5I1EL 1BFOA 2GEEA 4XCNA 3E3QE 1KXVC 4MJ4A 3V9CA 1H15B 4NAQA 1LM8V 4YO0A 2DQEH 5HHQB 2GJJA 4JO4L 5L2KB 1IZJA 3O0RH 4XVUC 2CK2A 3CUPA 5CR1A 3D39A 2CJUH 3KYKL 3CSBA 1VA9A 4AYFB 3CXFA 1AO7A 1T83A 4PRAA 3QJHB 4N8PA 4RGNE 5KN5B 2BZ7A 5FDWB 12E8H 4AGOA 3N9GH 3FTXA 2ED9A 3OGCB 4NSKB 4JB9H 1ZHLB 2B9AA 1BVKB 3UTTD 5BS0A 1N10A 4FFYH 6PCYA 3SQBB 3QUXB 1S9WA 1PJ9A 2F6AA 4OUOA 3OKEA 3GMRA 5CEYB 1F86A 3LCYA 4JDZA 2Y0KA 2KERA 3QWOA 4RMVA 2G60L 1R19A 5B3JF 1ACYH 5C97A 3WNLA 1RD6A 2W07A 3ETBF 4W9ZA 3CSGA 4GKSA 3ULUE 3WKML 2BNQD 4XBPB 3KWWB 4S1SH 1VADB 3W5NA 1KCSH 2MQ3A 5BRZA 2D2CC 2IH9A 1MF2H 4WFFE 4AKRA 2GVYA 3ARGC 3MV01 4AQZA 3MRKA 1T5XA 4XVUD 3FH8A 3KYMA 2AJSL 4FTDA 4J3OG 3IJSA 5FO9A 3IDGB 1ZT1A 4NNYB 3A21A 3DPDA 1WGOA 3WIIH 2H6PA 3W2DL 5G26A 3DX7A 4APQD 4PJEB 4ZD3L 4JO1L 2AK4B 4BXVA 3S6CA 4FI7A 4Y4FD 3QXDA 3ARGB 1F11B 5AG8A 4H8UA 3OXSB 1OSMA 2CCLA 3AA1A 1DSYA 4OLWL 5E6ZA 4YXLH 4XMXA 3U46A 5F9DC 2WXKA 4GUOA 3O9WB 5KSBA 4GRMA 4YPGB 3QPQC 2EVIA 2F7RA 2EC9U 2CRZA 3C5SB 5A3IC 1QTSA 3LRKA 1OVZA 3MV8D 5D6DA 3UOAB 1KIUA 3GRWA 3V6OE 1JYWA 1S8DA 2XKNA 2OFQA 3P73B 1Y1UA 4FG6C 1JGVH 2R4RL 5D7SL 3S35H 3BESR 4ICXA 4MJIB 5I1JL 3LNIA 2D9QB 3JWDC 2VDRH 4NJ9H 1CLZL 2LVEA 1S9YB 3RZWA 1XBRA 1D5BB 1MFEL 3KPQB 2DI8A 1ET5A 32C2A 4DQOL 4X6DA 4YSQA 5CCKH 4IRJB 3GT6A 2Z35A 2ZQKA 2G9HB 2ZKMX 1PDKA 2A4EA 2L4OA 3MNWA 4BDVB 4UTAL 1HCYA 5EN2B 2P24B 2ICEC 2YK1H 3SDXA 1KGCD 5FCUL 5IMKA 5I6MA 1WCQA 4N90E 4JAMB 4KBPA 1G7JB 4NGHL 4AKMA 1IAKA 3ZTEA 3FS9A 1WA0X 3FSAA 5FO8A 1QR1A 4NCC2 1A6ZA 1S7WB 2NNRA 4FSOA 4FRXA 2UXGA 5I1AB 1NUNB 4MB5A 4MB4A 1IEHA 2WIIA 4GMTH 3U82B 1T22B 3K2IA 3SGJA 2Y3NA 4X7SH 2DJUA 2DQFA 4PYHA 5INCA 2WUCL 1KGYE 2XWJA 4GQ9H 1U8CB 1QW9A 3D2TA 3F64A 5AVVB 5C2BH 1VEMA 5FGRA 4OZGA 3ULVE 3RWFB 3BZ5A 2NY5L 3ARVA 2LQRA 3ZQWA 1TVHA 3VY9X 1KIQA 3QISA 1CXHA 4E2OA 4QRUB 1PNDA 3UJTL 4Y0GA 1E9OB 3T0EA 1O9WA 2IQ9H 1SYSB 3T8XA 4D0BA 5ABDE 1P7QA 3Q13A 4HK3N 4K5LA 2P4AB 4MXQD 2EEAA 1JZ2A 3UBXG 2OMWB 1FN4A 4KK8D 3S3JA 2QQQA 4J6RL 1T1XB 2HT2C 1J5HA 3IETA 3QHTC 3P2DA 3SOBL 1SLUA 1A25A 3K7UA 1NIFA 2AXHA 3BAKA 3WE6B 2W60A 2FX8H 3QULA 1NCIA 2EIKB 5E8OA 3NN8A 3QRGL 3MLXL 1LK2A 3JWOH 4NDMB 5J4MA 1T20B 3PPEA 2UWEF 1NLBH 1YEGL 3X14B 2HA1A 1F42A 2E9BA 2NXYC 4YHZH 4Z77A 2G5BB 2IH3A 3T0AA 4EDXB 1NGYB 5GRVL 2V8LA 4M3HA 1J05A 4F2MB 4GCQA 3HFFA 2KHAA 2IAMA 2X4TA 3T65B 3KLAA 5L9DH 5KEZA 2VT0A 1H15A 1TNNA 4KK8C 1OV8A 2C3GA 1RLBA 3MOQA 3KJ6H 1M2OA 1M6UA 2R0LH 3FQUB 3GZQA 1OK0A 3N3EA 2DLEA 4OVUA 3T08A 2BC4B 5FV2A 2I60H 4MD0A 4A68A 2GCYB 2KLRA 3A22A 1RPKA 4PLKD 2UY6A 2Q8AH 3DO7A 1P84J 4OZFH 1T7ZA 2VN6A 5EHFA 3RU8H 2D03H 2F9BT 1AGFB 1JD7A 4EDWH 1ZHBA 5IIEA 4IM8A 1TNMA 2VN5A 1OCOB 2ZUQC 5CP7A 5CEZD 2EILB 2EVGA 1QKZH 2FWUA 1FORL 3BWUF 2NYYD 1KCVL 4IEFA 3OKKA 1TENA 4D7BA 3SPIA 4LLUB 2QKSA 3ZHFA 3FCTA 1A7NL 5T1DL 5LG6A 4NIYE 4JRXB 1FV1A 3UG5A 5BO0D 2Q20A 3NFNB 1N26A 3O2WL 5KZCB 1SDDA 3N41F 5DHVH 3KPPA 4KROB 5DHYB 1MZYA 1YMMB 3VFUA 1XZ0A 2KQMA 4RAHA 1EAOA 3ZRFC 4BWTA 2N7AA 3DNKA 4JFOB 2HTKD 5DRXA 5D1XE 1ZA6B 1QLEH 5FO7B 4D8PB 1L9TA 2NXZD 2NY0D 4A37A 1R3LB 3OX8A 2B1HL 4PJ7F 2A6JA 2OMBA 3T71A 3AJ7A 4B7LA 4OSUH 1OLZA 1HH9A 1A3ZA 1F4HA 3CPUA 1E9QB 1TLKA 1ZLUH 1PEWA 4IBSA 5DQDH 5KOMC 2YNKA 4AEHL 5KTEL 3L4ZA 5C0EB 1JCKA 1X9UA 3APNA 2DJSA 2GSIA 4NPJA 4OFPA 2B0SH 2Y36H 3UZQA 3KWXA 5FF6A 1UT9A 2BSDA 4KQ3L 5CLXA 5DFTA 4HBQA 4OGQC 1U91B 3V0GA 3ZDZE 4U7MA 4QUOA 3BUQA 3S88H 1EMTL 3CLEL 5IWLC 2YZ1A 2NY7H 1FVCA 3LH8A 4YDNA 5HGDA 4PEEA 5LNEA 3EJCA 4X8XA 2YD4A 2CRIA 2DQ6A 4LSRL 4P23A 3RIFF 4DEPC 3BZFB 4YE4L 1B90A 2B1OA 1IM9D 1L6ZA 1SXCA 1Q9OB 2CGZA 1BEYH 2LU5A 4PGEB 5DK0A 4NAMA 3HZYB 1IFRA 3TO2B 4X5LA 1KC5H 1L4IA 4X7FC 3C6LD 4PS8A 2IPKB 5AWNH 5JHDB 4M6OH 2OW7A 3GRBA 5TE4H 3BP6A 5EMYA 4JFFA 2M06A 5AW6B 1HXKA 2XZAH 3D48R 4GEIA 5JYLA 4J5VA 5D5MA 1F3DJ 4PJXF 4DVRH 4N4YB 3ECVA 3DBSA 4LSHA 3UTOA 3BYYA 5J11B 2JKRM 3B4NA 3MODH 4YDIL 2F53A 2HT4C 2W8CA 3CLFL 4C56B 4MD4B 4JANB 1MCPL 4AL8C 4HJJL 1WQVT 4G7SB 4NZUH 1XF2B 2CKBH 3DA3A 3S36X 2GT9B 3IMRA 3ZO0A 4ZX3A 2RB8A 5IHHA 2O4EA 4G8IA 1SM3H 3CVHH 3KLSA 5LCVL 3VWJB 5IHBA 1J0IA 5C86A 2GBTA 4WWPA 5ENWA 1WAAE 4XCYA 4JHVA 1AE6H 2AJVH 3TA3A 2E6JA 3LEVL 1KB5A 1HHIB 1CFMA 1E4WH 1FVEA 1ZLWK 3VG0H 3K6DA 4ECNA 1OB1B 3ETTA 2YUXA 3PAYA 3QW9A 3O8XC 2WYZA 4YDKL 1UKTA 3QUMH 3JWNH 3X3FH 3F83A 1NFIB 1FGVL 4Z7VA 4XVSL 2PABA 4BKTC 1D9KB 1DDTA 3BGFC 4G80B 3KLKA 1N6QH 1JD9A 4LU5H 4ZO8A 3TIDA 3V0JA 2BHYA 1HOCB 2KUTA 2MCPL 1AHKA 3LK2B 4HX1B 3BP4A 4FSPA 1NINA 3U4KA 3MBEA 1BQHG 4L4VE 2V2TA 1ED3A 5E9DB 1BVNP 2DM3A 3LXBA 4LMQI 4TUOB 3ZGIA 5IP4A 2VAAB 3FAXA 3VXTA 2OTUB 2AVGA 1EO8H 3H7LA 1NEZB 4AE0A 4OJCA 5F7UA 3L95A 1LO3H 3R4DA 2ED8A 3IE9A 5AVTB 2E47A 1NBQA 3C6SB 2ZXEB 1E8YA 2K6YA 4B5EA 3UU2A 3LXUX 5DJXA 5AAMA 2H4EA 1U6AH 4JHWH 1HKFA 1MIML 4RFNB 4H25B 4XCEA 4M5YL 1UOKA 3ABKB 1W0VA 4LSTL 5AW1B 1T21B 4I3SH 3LJ3A 5GRYA 3JWDH 4HZ1A 3Q3GA 2YGQA 2Z1KA 5PCYA 1BYPA 4A7SA 1K3IA 3QQ9D 1K4DA 3MUY1 3P0VH 5HVGB 4F57H 3AA0B 2Z8WC 3FFOA 2WWKT 4K55A 4N2NA 1SUJA 1PRNA 3ARGA 5FGBA 4JDTH 4UTBL 3RGVC 1QQDA 2OJEB 1LILA 1BA9A 1UZGA 2OV0A 3NVQA 3OV6A 2ZYIA 1G9NC 3L9RB 2BP0B 4IBWA 2PUQT 1K4CB 2IMMA 4AKOA 3TBTA 5I8EB 4CN6A 5DJYA 3MRKB 1KIUB 4KRLB 3FN0L 1C7SA 3HA0A 3QQ4A 1S7VB 3OB0H 3A67L 4CC0A 4BXSV 2H6PB 1OKEA 3RVXD 5HPMA 4MZIA 3A4DA 3BLBA 3AGWA 2Y1VA 2XZQL 3OAZK 2P45B 4V33A 2HJLA 2VXQL 2NY5H 1NCTA 2MNWA 4ODSL 1EAJA 2DLFL 4GSDL 3QWOB 5B7EA 3HG5A 4N59A 4HGKC 3GINA 1ZTXH 4GRMB 2A77H 2E7HA 4N1CA 2YOAA 4X7DC 1W0WA 4M7KH 4M3KB 1LO0H 4RETB 4FHJA 3H53A 1PVHA 4B96A 1OAXL 4LSSL 1KEGH 2XVBA 3VG9B 3I02A 1OCWL 4KH9A 3CFEB 3K2UL 5KN5A 1F58H 1UXSA 4KQ4L 3VFMB 3S8GB 1AANA 1T4WA 2GSMB 4UAOB 3X1GA 3SQBA 3RE0A 3ULSB 2F5BH 2VR7A 1DYZA 1QHPA 5E99H 3MLXH 1MVYA 2F53D 2J2ZA 2BNQB 1XIWA 5CSBA 4AQ8A 1GH7A 4GCSA 1LNUB 2DJ4A 4HWZB 1VACA 2OMTB 2OW6A 3MFFA 4K8RH 3U4EA 4ZQKB 1AO7D 4KK5D 1PAMA 4XH2A 2GJ6B 1DLHB 5D4HA 3STZA 3AG3B 2E9JA 3MLPA 3SJVA 3D3VB 5FLVA 4XI5D 1SJEA 2XXFA 3DJ9A 3M8OL 3QNZA 3RVTD 3T8XB 3US9A 5GS1C 4XMTA 3VRLF 4YWGL 3VFRB 4P23D 4OM1H 5AZUA 3ZDZB 5I17A 4XMLL 4CU8A 5LGJA 4NRYB 2RHEA 3RL1A 2A73A 5AB2A 2ALAA 3CVIH 3VD2A 4NZJA 1I9IL 3QXAB 4FQIL 4KZDH 3T6VA 1AZZC 2XIIA 4ORGA 5L2KE 2CLZA 1ZANL 3RDTC 4QJ5B 1ROCA 4NX0A 1CFNA 1MQKL 3WE6A 3L3GA 4G72B 3KLDA 4IS6A 5C0RH 4B9ZA 4APXA 4Z7NB 4NQCE 4MJ5B 1R5WA 1E9QA 4XPGH 4GO8A 1I85C 3WJLA 3RWJB 1KPRB 1RK1A 2F53E 3U6XA 3BAEL 4P2RE 1KBKA 5IFAL 5CJ5A 4K5OA 2ZG1A 5M94B 4FZEL 3EO9H 2YLHA 1EZVX 3KPQA 2XG4A 5C0AE 1GFOA 3H4HA 4G9FE 4XI5C 4KNQA 1DBAH 2IAMB 4NQQA 3MJ8A 4DAGH 1BBDL 4O00A 3OJDA 4DGYH 3FPXA 1J9SA 1OK8A 3ILEA 5D1XD 1GCYA 2OJ1A 3O2DL 5ITBH 1R1CA 1OD7A 1REIA 1KPUB 5KWYC 3CXDH 5TDNB 5A2IH 4OCNC 5G39A 1B2WL 1OTUD 1KTBA 1T66D 2Q7NA 5MENA 2ZYHA 2O61A 4P3CL 4CKVX 3D85B 3DUUB 3F6IA 1F6AA 5DQ9A 4OT1H 3FSZA 4J12A 1Q94B 2FJUB 1IQWH 3C8DA 3CHQA 4GLRI 3I6KB 4U1NB 4FOZA 4BFNA 5C0JA 2ADIB 1BG1A 1XF3A 4D5UA 3X2QB 5J3HC 2FBJL 3U30C 1KZQA 3HJEA 4DN3H 4C59B 3UZVB 3BP6B 3GXIA 4JFPA 5FKAB 1CICB 4FNSA 2VXUL 4J2XA 3W11D 4QHUB 3E8UL 3MLYL 3TFKC 3D85D 2DBLL 1G5GA 2OXHB 2WQSA 4YHKH 5DRWA 2OYKA 3JV5A 3A0HO 3MLTA 3SYCA 1J9CT 3Q6FA 4HKJB 3VSQA 1I1AA 1L7IH 2X0VA 5HPOA 2CR3A 3FDWA 5BO1L 5JIQA 5DJXB 3OWEA 3I50L 4WLCA 4CMHB 5JPMA 2IAMD 1AHMA 2X4RB 1FYTB 1WUZA 4BE6A 1XH3A 2CDEB 1KIQB 1QTPA 1GYAA 4AGQA 3B1TA 3EDFA 1W80A 5TE6L 1T20A 4XPHH 3FCUB 2DV6A 3IJ8A 1JPSL 3OKKB 3TH2T 2LT9A 1TETL 4O4UA 5CSZA 1U8JA 3IFPA 3LS5H 3MBXH 1E9PA 2MTAA 5E2WL 4QCIB 5J3HD 1R34A 4FQCL 4HH9A 2QV4A 4ZUWA 3JSSA 3WS3B 1M71B 3IT8D 1FLRH 4TLSA 2R1YA 4ODVL 4L05A 2WO4A 5G4OA 1MLCA 3TFKD 2P9RA 2PP7A 5CILL 1NFIA 2KS0A 3WNOA 5BCAA 1J8HA 1I7TA 3HAEH 4HC1A 5DRXB 3P9LA 4G5ZL 3SKUD 4ZMZA 4I5BB 4HOZA 5K39A 2WYTA 1PFOA 1ZHWA 3FU7B 1Q9WB 4UTAA 4MMXB 4R83A 1I3GL 2VQ4A 3HE7D 3R8BB 4JQXA 3VXUD 1J0KA 3VMNA 3U1SH 1WA1X 2EDLA 3NJLA 4BA0A 4DP1X 1GFPA 4YLBA 4KKCC 1EJ6A 3UPRB 2FRGP 4HHWA 3T65A 3SPVA 1FPTL 3SDDB 5LJYH 5FYKE 2XPGA 2A9DA 3CDZB 1SRDA 2Q86B 1VFAA 3CFKA 3F3HA 3PABA 5D7LE 5GGTA 3VNYA 5J9PB 1ORMA 5KSBF 3D0LB 3B37A 1MG3C 2CUHA 1SOXA 1U8HB 4N87A 5GGTH 3L4TA 3SKMB 3CDGA 2V2WA 2ZSVA 4MNGA 5DZAA 3RY5A 2AXFA 3O4LD 4R2GC 4QKXB 1DE4B 1QD0A 2PCFB 1NMAH 4BK5C 4LKCB 2X2UA 1EWHA 1FIGL 1BD2E 3SZ6A 8CGTA 3FRPB 1GGIH 2CMRH 5I5JA 1NCAH 2ZOTA 3O41A 3S3BB 1JPFA 3VWJA 3OAYH 3S5YA 1R75A 1P4UA 4NM4H 1FDLL 4RZCA 2WQXA 4LHUA 3WHE1 4QI3A 3NCJL 2PN5A 5AOMA 3GXNA 4YC2B 1ND0B 4J3VA 5GV0A 3T4AA 2XJKA 2YQ3A 4FMKA 1TZHB 3T1FB 4PG2A 2Q8BL 1WFMA 4HJ0C 1R9FA 4YHOL 1HEJC 4FDWA 1T16A 4L8BB 5BOPA 1D5XB 3W0WE 2KT6A 4Z7NF 4PJIE 1DQTA 3VXOA 5C3IA 2J88L 2UX6A 4KJPC 2WWMD 4GINA 4DN4H 1OGPA 4N2CA 1MW0A 2OR8A 4FQQB 4NIKB 5I8CA 3MRQB 5SWSB 3IK2A 3WUWA 3AAAB 2A9NH 1CDHA 4FMFA 4XBMA 3QYCA 1SBSL 5E2VH 3H85A 4KDWA 3V0DA 4CBPA 1TQVA 2FJFA 3Q8AA 3QUHA 1BGXH 4KK9C 2J4WH 3AAZA 5JMRA 3BEWB 3BH9B 2WMPB 3WFHB 4JREC 2Y7LA 3VXTB 4GW1B 1RUAH 2G2RB 5LGHH 3DZMA 2C4FU 3UDWC 3U7WH 1JZDC 4KRPD 2XSKA 3IPEA 5JLZA 4X5WA 5TF1H 1BVLA 3VX0A 3RWCA 5ESVB 1JZ4A 2V37A 5A16A 3QUMB 4U7KA 2NY1B 4KUCD 1UXSB 5GGSA 4IGBC 3VFMA 4GUQA 2XPYA 1B0GB 1QFOA 3HMXA 4JKKA 4YVNA 4N2EA 1EA9C 4U1MB 1XGPB 3QYNA 5FHAH 4FQXD 4Z8FL 5DZ9A 1DO6A 1JNJA 1IQDB 2A77L 4OFYD 2VITB 4JFFB 1L9OA 4P46B 3KH3A 2CLVB 3QIUC 1JWSA 4JVWA 4JY5L 1PCXA 3NABL 4MJIA 3GTTA 5FM5M 1R3HA 2GK2A 3HC2A 4KK9D 4FG4A 1JK8A 1CR9L 4GG8A 3VE0B 2LABA 7CGTA 2BRQA 3FQ1A 5HI4C 4DZ8A 1YJDL 4PJEE 4X5XB 1ODUA 5I19H 3ATDA 5I0YA 1R3KB 1JPTL 4GT0A 4JM4H 4X80L 4PVBA 3UBGA 4WNQB 4PJ7E 5C2UB 3KBPA 2CJ3A 3D7PA 3LKSB 3O4LE 1PSKL 2UWEA 5DJYB 2E86A 3BKMH 2G5RA 2N0MA 2IFFL 4JKLA 1U8OA 2OK0L 1DVTA 4OKDA 2DWTA 4IGBD 1KTRL 1MCDA 5I1IH 2IPTH 4AKRB 1VFUA 5B66O 4OGXH 3TN0C 4ICWA 3RGVA 1JXFA 2R4NA 1UC6A 4PSPA 3RY4A 5CEZL 4M6AA 4BCXA 5EOCJ 2WVVB 3RUGE 1DBMH 1MRDL 3VACA 2ODJA 1SVBA 4UNUA 1CTMA 1WJ3A 3DECA 3BP7A 4ADIA 1LVEA 1A3RH 2BIIA 3O81A 2N3JA 3P2TA 2Q2LA 3IGAB 1U58B 4R5VA 4ZFOB 1IC5H 1TVDA 3CZJA 4AQEA 1BF2A 4ALAH 4HCGA 3NA9L 5HI4D 4XMZA 3LK3A 4XNMA 3UERA 2X7LB 1P1ZB 4AZ8B 4WHTB 1KN2H 3LEXA 3SODB 4LCWA 1INQB 2B2XL 4CU6A 4UILH 2X27X 2XFXA 3MBEB 2CK0H 2CUMA 4ATTA 3C8KA 1ZHKB 4RSVA 5DCCA 5C0BB 4UTCA 5EBWA 1ILUA 4GRLD 1CXLA 2XY1A 2K6ZA 5EZOH 5GS0C 3B7UX 5D1ZB 4HFWB 3TN0D 1CXEA 2KMWA 5GJSH 2CAKA 3MREA 3KBHE 1YY9D 4L8CB 5MENB 5E6IC 3DOHA 2KKQA 1UT1A 1FZJA 4TSBH 3Q8BA 2VDKL 4A7GF 1PHOA 4M1CD 1O6SA 2EIMB 2Z31C 3HN5A 4P4KB 1UOVA 4Y8DC 2J6EL 4P4KD 4P9HH 5T1LD 2ADIA 1F18A 5SX5K 1EZVY 5D2NE 5DSCA 3UAQA 4N2OA 3VM7A 1WG3A 2W9DL 1XGTA 1C5DA 3ZZSA 3V4UL 4YQXH 1KDJA 4OZFG 5FLUA 3VXRA 2VB5A 4LLAA 4V1DD 3EYSH 3MRLA 1BQLL 3V2AR 1FE8H 1BBJA 4HIPA 4WI7A 4NRYA 1KXQA 4NO0D 3E6FA 4KX8A 4BK8A 3TA3C 2JTYA 1Z9SB 4XMKL 3H9SA 4G6MH 4G8EA 4BQCA 5HJGA 5KSBE 2BJML 3HNVL 3K81A 1M56B 3FFDB 4TUKL 5MHSD 3N85L 5J11C 4AV5A 2QLVB 5L4IA 4Q9RH 1R5WB 5D7LA 1NAKH 1UCTA 2Z31D 4HS3B 2LLGA 3MRMB 5BOJA 4MLIA 2DWYA 2HFEA 1SJHB 1Q9KA 4G43A 5IB4B 5L8JB 2HG0A 4JFUA 3TO4B 5I5MA 4KR8A 1CS6A 3T2PA 2BZDA 2BVYA 4ODUB 4KVCH 5H37H 2D2OA 3IDIB 4QOKA 4U1IA 3OKNA 3QJSB 5F9OH 1LNUA 5AOLA 4KGLA 1HEZB 3L1OH 1LEIB 4F33A 3QRGH 3WL9A 2R9HC 1IC1A 2HVKA 4PS4L 4KQ3H 3CAFA 2EE2A 4P5RA 1AMYA 2XKSA 2O30A 2K3HA 3BGFB 1FLRL 3AQXA 3NSYA 1GFMA 1O5DT 1QYGH 1XH1A 2A83B 3H0TB 2F74B 1OAJA 4L4TB 5ANMB 5FA3B 3Q8CA 3OLDA 1VGKB 2LHAA 4N2LA 2ZP8A 1YEEL 3DHPA 1RJLB 5AFUL 3WD5H 4LNVA 5I6XB 3VA6A 3NFSL 4DUWA 3S8FB 4MVBD 2X0WA 5CCGE 5EPMB 3L3OB 4LT7A 3BHBA 4BRJA 4LLVB 2Y0HA 4JZJA 3FQXA 3B7SA 2CIKA 1VFMA 2UZIH 5IQNA 3LAFA 4HIHA 3UTPE 2J72A 1N5AA 2IQ9L 3FO9B 1YS5A 3R7RA 5HVWA 4DFHA 5CLYA 3KPPB 4LP5A 4GT7A 4S10A 4TPRL 5DHYA 3VFUB 3SBQA 3ZHDA 1MRFL 1V3MA 2Q7YA 1KLFA 3QXDB 2DYPA 3ZYZA 3HG0A 1XTLA 5HY9B 4DP8X 2XWEA 2PWHA 1ZA3B 1AHWC 4PPTA 2CRMA 4NZ8A 5F21B 3BD3A 1FC1A 3FT2B 2MOGA 2VDMH 3FL7A 3OLEA 1L9PA 1CU4H 4MCNA 5T1DH 5MEPB 4HUNB 1ANUA 1DBBL 1UENA 1OF2B 2FX8L 1PTZA 1NICA 2PYEA 4FQ1H 4NZUL 2EQDA 4H8WH 3P73A 1PY0A 1TKWA 4JRXA 2VL5B 2ZAGA 2K1MA 2X4UA 5HXMA 4RNRA 4Y2DA 4EI6B 2PXYA 2CMRL 3VXSE 1R5VB 2BOLA 1WP6A 4OCRH 3BPOC 3QZWA 2WWNA 2NCEA 2VDMB 2VLJA 2W65A 2NSXA 3IRCA 4KZCA 4KAQH 3SGDI 1Q9WA 1U8OB 2WN3A 3CFNA 3VFGH 1XXDC 1M9SA 2ICWJ 1D2PA 4AL8L 1XVSA 2JSFA 1H8LA 1L9RA 4JFSA 3V0WL 2GK0B 1N19A 5EN2A 3WEAA 2XY2A 3KL5A 3N44B 4UF7C 3T2NL 5B8CC 5C7XH 3GB7A 5MEOA 3P3RA 2KYIA 2LFGA 2R8AA 1E8WA 1TEGA 3GBDA 3P3TA 3EBHA 5T3ZH 3RZCC 1TTBA 3BZ4B 5CAYB 4E5XG 1U58A 4C83A 5K69A 1RZFH 1H6FA 2QPSA 7TAAA 4PP1C 1IM3B 3VE1A 3LQAC 2XXGA 3O6FC 4BHUA 2WSDA 3RB7A 4NNPL 1JNHA 3FO0H 2CO3A 3ZIMA 1XGPA 3ILQD 4JG1L 3JV4A 1Z9PA 1E6JL 4E41D 4Z7VB 1LO3L 2BHZA 3NDZE 1C16B 2WSPA 4NQEB 4IRZA 1Q0XL 3OKEB 4HCIA 4AX3A 5I6OA 4HKXB 2K0RA 4GI8A 2MNJB 5IVXF 4K3CA 1UM6H 3MLTB 2X1WL 5EEWA 4QRUA 4NO5B 1LQSR 1AZBA 2CM6A 2EXWC 3JTSB 4NKDB 3VH8B 4E0RB 1DVUA 3BDYH 4C4VA 3C75A 3T4AB 5CD3A 4X5XA 3FF8A 4K23L 1GTNA 1Q9LA 5ENWB 4OSUL 4WWKD 1FWXA 1CXIA 4Q0XL 4L8BA 5DQDL 4FC3E 4F27A 2CO7A 4Y88A 5IY5B 1UFUA 3VH8G 1Q1PA 2YOCA 1P4IL 3MRQA 2WLZA 3EFDH 1KV7A 1RK7A 2VO8A 3CVHB 2JLLA 2WCPA 3VFOA 1A6UH 3F7PC 3ILQC 5INDB 2FO4B 3MYZA 1BXAA 1ECYA 4A2EA 3TZVD 5I19L 5AVYB 5EF2A 3QUZA 5IESL 1U8PA 3H9SB 4X80H 5E56A 1CURA 4Y4HC 4NENB 3RUGB 2EE6A 3O9WA 4JKPH 4JRFA 3G6DL 4UIKL 3RVUD 3GSWA 5KSAB 3T6WA 3QORC 2EXWD 4KWUA 2Y23A 2WBJD 1X5YA 4OUUA 3TT1H 4G8GD 2BMKB 5IW6B 1ZPLA 3FRPA 3RQ3A 5I1EH 5E6RB 1BD2B 2QGCA 4MJ2A 2HAZA 2OCCB 3DGCR 4NS0A 2VDRL 4NJ9L 4AQAB 3T0SA 1JPST 3IGLA 1LDPH 5L0QB 5DC9B 3MREB 4L2LA 5KYWA 2VUYA 2XBDA 1VRSA 2AF2A 4MA1C 1RFDH 1XAKA 5IFJB 1EO8L 4PVMA 1HL8A 5BMFL 4I48B 4QRPB 2HJLB 2J1KA 1PIGA 1QI4A 1ZHYA 2V3EA 4NO3A 4Y4HD 1KGCE 4ZTEA 4PU2A 4HVBA 1R33A 3PWVA 5LCVH 4BH8A 3EKCA 1G4MA 4HV8B 1QWNA 3BQVA 3QORD 1TO5A 4GRWE 4QOKD 5H2BA 1KG0A 1MDAA 4H20L 3O41B 5I73C 3LQAH 4UIMA 3ZKMC 1QW8A 2R88A 2BK8A 2UWEE 2W9LA 4WKZB 1D2OA 4LARH 1NH6A 1J5OL 3P0VL 3VFPA 2ZKHH 4OZHE 2CIKB 5C0EA 3MV8E 2WZ6A 1SGKA 5IQ7H 4PH8A 2HFGH 2ZSWA 3NPZB 3QQNA 2HMID 2P8MA 3GNMH 2FEJA 4V2CB 4WUUA 4DNLA 1G6VK 2WQRA 1EBPA 5KBMA 2IG2L 1RZJC 3AWGA 4WI5A 4U1SB 1KCUL 2FAUA 2Z1PA 3BAJA 1YN7A 3QQ3A 2R4LA 5F2FA 3CN3A 1ASPA 1S7SB 2OSXA 5DMIL 4POUB 4P23B 5IBUB 4Z3TA 1MQKH 4HUVA 5DTFB 4J6IA 3DX9B 3BRYA 4QOKB 2X4NA 3JWNC 3PWJA 5EUOA 1A7RH 3VI4A 2W9EL 5DYFA 4LVHC 3GUTA 4JZNB 2NY4C 2NLJA 5AYQA 4E9XA 5LBSH 4AIZB 4FFWD 1LO0L 5KAIO 2K0LA 5F8RC 3G08A 3WFDH 3ULUD 5EORH 3H3PH 1WRFA 3FK3A 4DQOH 3VXSD 2EO1A 4ELKA 3NJVA 4JL1A 4WHDA 3P0GB 3DTUB 3WXVL 1QACA 4MJ5A 2X09A 5T3XL 3MRRA 2X70B 2MTPA 3O3UN 5ICUA 1KXVA 5IVXB 3KPLB 5BV7B 2BS71 2OX5A 3ARDC 4MSWA 2Z9TA 1IGTA 5D1ZA 1R3HB 5GJTH 3FQNB 4ZT1A 2ZWZA 3ULSA 4KXDA 3VWKC 3VXRE 4TUUA 2FH6A 5DJ2A 4DKTA 1HSAA 2FSDA 2EUZA 1KIRA 4PJ5A 3FO9A 1BXWA 1LP9E 4IOFC 1D3CA 1D6EB 1RUPL 3MV7A 4HKBA 1NIEA 4LF3A 1NKGA 2IDTA 2IDCA 2V2XB 3MRPB 1EHAA 1BPLB 4IEFB 1M7DB 2OMXB 4YDVB 2I69A 3HI5H 3FT1A 1BHGA 4HKXA 4NN6B 2JIXD 5AOJA 5JXED 5AB0A 4Y5VC 3PXHA 5C08E 5KSUB 1YEJH 2X12A 1U30A 3QR2A 2BFGA 4M7KL 2WKGA 4XMLH 5D4JA 4M5ZH 4U0RC 4AJWA 1MRFH 4XPHL 3DTDA 1DN0A 4YLQT 4RL9A 3S37X 4XHJC 2PO6D 2HP4A 1QBML 4WWKB 2D73A 2XV6B 3ZVVA 1WBXB 5C6WH 2Y5TB 4H5SA 3VMOA 3HB3D 4NN6C 5AAWA 3SYSA 1QUNA 1NC4A 4I0PD 5I6PA 1UWGH 1QBLH 5JW4Q 5JHLL 1KELL 3P69A 4K71B 2AJXH 3CHSA 2BERA 4G6AC 4HF5L 4ABQA 5MEQB 3ESUF 1J48A 1YEIL 1HHHB 4QF1B 4Y9GA 3C5JB 4R4BA 5L7XL 2TRHA 3EXLA 2HTLD 4YSTA 4RX4D 2IH8A 2IF7A 5JXEC 4X6CE 3UL4A 3P3UA 5DZVA 4L29A 3TBWB 5DJAA 4DP7X 3N44F 1RIVL 4HCRA 2IDSA 4Q6KA 5DWUL 3VVWA 1H3XA 3I85A 1OL0A 2YMOA 3BISA 4JPKL 4L5FE 4PCTA 3UROR 1FL5B 1NEZG 4LRIA 2O5XH 1S7QA 3OZ9L 2JE8A 1M7UA 1FPTH 2E3VA 1JGDA 2LR4A 4RQQA 4A2LA 4EN3D 4F37F 2DYPB 4P9HC 4UB0H 4X9HA 2GBUA 5BRPA 3J27A 5I71B 3FU7A 1F4XH 1FNEA 2K45A 4H26A 4J2QA 3VXRB 3A6CH 4D9RE 3NMEA 4P04A 3GMPB 4OQTA 5D5MB 3L4WA 4DO4A 3ZKND 3VAEA 3V6OC 6PRNA 3TEXA 4QY8B 5C0RL 4POZC 5DRZA 4CA4A 4F3FB 2P8PA 2Y6TE 2X4QA 4UI2A 1TKWB 5JORB 2XWBA 4G3YL 4QCIA 4Q6IA 4OBRA 1XO8A 4RDQG 5IW3A 2B9BA 1W9XA 3O6KL 2AK1L 4BZ2A 3NIGE 1MFCL 1EEYA 3HKFA 3L3HB 5C08B 4EMZA 1SJXA 3O0EA 3GHEH 5D7JA 1RULH 2E7CA 1IE4A 2AXJA 3ARTA 3BVXA 4DP5X 3QIBC 4M4RA 4S1RL 5CGYD 1KACB 3UMNA 1JYVA 1UA6H 5K39B 1JPSH 1OAKH 3GIVB 1XWVA 1AJ7L 3C12A 3KYMB 3VB9A 2D7PA 4X2UA 1FVEB 5MEPA 4JDVB 5GGQH 3VWJD 3ELAT 1CFTA 5C0CB 1AKJB 2YJLA 2YKLH 2DQGL 3RWHA 3NEXA 3O2VH 4WFEE 5EULV 5BOZG 3PXJA 3LNFA 2WGXA 2OTWB 4X42A 1AKPA 3BHBB 4QD2E 2ARJA 1HEZA 3T0VA 3ZZ1A 1SJVA 5KVEE 4C56D 2GIMA 4NN5B 1UH2A 4I0PB 3HRZC 1OLLA 3LK2A 1UWXH 1UZ6E 4FRWA 3T3ME 3E8UH 4MKMA 4XOCA 4Y4KD 4IU2A 3VGHA 1KJ2A 2M8XA 3WFZA 4K7FA 3G6DH 3ZDZF 2H9GB 2ZSVB 4UYQA 3GLEA 1ED3B 3O3DA 4L4VD 3AT8A