4AYID

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 wild type
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
LADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayiD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayiD01
3KVDD 4AYNA 2KDYA 3UAQA 4AYEC 4AYID 3V8UA 3PQUA 4O3ZA 3HOLA 2W81C 3VE2A 4O49A 4O4UA 2W80C 3HOEA 2LFUA 4QQ1A 4O4XA 3PQSA 5T5FA 2KC0A 4U9CA 4O3WA 1YS5A 4Z3TA 3VE1A 5EE2A 4AYMC 4AYDC 4O3YA 2Y7SA 2YPVA 4O3XB
chains in the Genus database with same CATH superfamily
1CU4L 1XGQA 2Q86B 2XYCA 3GIZL 4GH7B 4MGXA 1XF2B 1MAJA 3RNKB 4IMLA 3OR7A 2OKMA 4PW3A 2A4EA 4BFJA 4NQUA 5CSGA 3O45A 3CCHB 3C60A 1J10A 1KXVA 4KJWD 1ORSA 3FN0L 4WJKB 1YYLL 4YAQB 4N0YL 3LD8C 2EDJA 2G2PA 4DZBB 2I7OA 5EU6A 4LNVA 3UYPB 4H26A 1E28A 3VFRA 1TZ8A 1OLLA 1LJMA 4LSPH 3T6WA 1D9KA 3QG7L 3TN0C 4TQ8A 4XO9A 1PJWA 5D93C 3IFLL 2FL5A 4HPOL 3VXSD 4Z5RB 4UT7H 2WCGA 1G4MA 1J5OL 3L17A 2X4TB 4ZDHB 4IBUA 4MD5B 1KLUA 5EA0H 1TYEB 4ZZKA 4UZGA 4QTHB 2A9BA 3P0GB 5T1DL 3OVUB 2JKJA 5AZEH 3UCQA 2VSDA 5D1QD 2R2EB 1NFDB 4QDGA 3HZVA 2V7NB 2R69A 4X9GA 4J3TA 3BKJL 3H4FA 3MKGA 1F4WH 1MIEL 3KS0H 4QRTA 4U3HA 1H5BB 2NXZB 2DBLH 2Y7SA 3L4UA 4OLVH 2AQNA 4GRLB 2K45A 1AE6H 3FKUS 1TNNA 2MHLA 1VERA 3C2AH 3MREB 5FM4A 4JX0A 3BZ5A 3SGEH 4EJ1C 1UT2A 3MMEB 3EJYD 1J8RA 5BZDA 4QO1B 3PE9A 3MLTB 3EUUA 3BUYB 3C5ZD 4L9LA 3FQWB 1CGWA 2VM4A 3V0IA 1KEGH 2Q2LA 4C4KT 5ICZB 1D5ZB 4GUCA 4GQRA 2DN7A 5CZXD 2BY1A 4A2FA 3TEZA 4N0FA 2C3GA 3FRPA 4TVPL 2ADFH 4GCSA 1CF8L 2JKSA 4OR1A 3G6DH 5C07D 2H26A 4N8VG 1HYSD 2XCMC 4D8PB 4ALAH 1WUZA 2AJSL 4W81A 2ZNXA 5E6SB 5I18L 3JVFC 1WWWX 3UBHA 1BT9A 2W9DL 1KB5H 4FQPA 1EGJH 3LRMA 3K6NA 3HZMA 3MJ8B 5ACZB 4PJBE 3L4ZA 3V4VL 4GXVL 1DQLH 2MNUA 4MJ6B 2R69L 2EDRA 1BFSA 4RWYL 5CUSL 2NYYD 5HSFA 1QWNA 1UH4A 1R6VA 4IYKA 1YEJL 5TDNB 3ULUE 1T1YB 1P4IH 1GL4B 5D7LB 1G0DA 3PL6B 4ZS7H 4HUWB 1XZWA 2FEEI 2X4RA 3V0EA 3B7TA 5AAMC 2GTWB 1G9NL 4FLRA 2NY0B 4K23H 3TT1L 4RGOH 4KRPB 2W81C 2XPYA 4WV1A 2YS4A 2W60A 2AKRB 4HF5L 2C9RA 2GITA 2VMEA 3E38A 2H32B 4MNQB 4V1DD 1IC5H 5DT1H 3MYJB 3LNGA 1SHXA 2Q8AH 4OLYL 5FO7A 3WJLC 2E74C 4BINA 4XVTL 5KEZA 2CZNA 3BVUA 3NMEA 3LK41 4XZUB 1X3DA 3I9AA 3FT4B 5DQDL 3UGEA 1YNKL 4PGBB 4A2GA 3NJIA 2E76C 1W72B 1ND0B 5C2BL 5ETUB 5KVGL 4OKVB 1QVOB 2DQJL 4XMUA 4G43A 3N55A 4NO5A 1OWRM 1SLUA 3F7LA 4W6XB 1BAGA 3MUUA 2DM7A 1YECH 1B90A 3PU7A 3QNZA 1GGCH 2XZQH 3BQUD 4J8QA 3NJHA 5FO2A 4A2DA 4CJ1A 1GHFL 2QSQA 3MOAL 4PEEA 5D71H 3GXTA 5KSAD 1X4ZA 1WTLA 3DJ9A 2KQMA 3D08A 2QVTA 1UZ6E 2IOMA 4PRNB 4XE0A 1QUNB 3T6VA 2YWYA 4GFXA 4FZNA 1JRHH 1YEKL 1NGYA 1P1ZA 4UU9A 3BP6B 1E5YA 4IOIB 1WIOA 4Q8BA 4DTGH 5K1NA 1C9SA 3UPRA 1KBGL 1A6ZA 1AHWC 3CN1A 4KROB 2G3MA 4XPBL 2WSPA 3D25A 1R19A 2XG4B 4HEME 4TN9A 4BXSV 2F53E 3ARBC 5DZAA 1T6VN 4EDWL 1CT8A 1S4IA 1F1AA 1YEDB 1FFNA 3HOGA 1QEWA 3MNWB 2N1KA 2FGRA 1Z9MA 4HSQA 4I3RL 1AYOA 4LDLB 3QGVA 2JB5L 5E5UB 3FCTB 4MRCA 4ES9A 3FQUB 4QHNA 4WGKA 5DF0A 4JGMA 1VENA 3JSSA 2RA1A 3GKWH 3HLKA 3O2DH 1PZSA 3MLTA 3RYMA 4HOZA 5BV7L 5ID1A 5CHNA 3AADB 2HG5A 5E8NA 4BWTA 1ZEAH 2LVCA 4UBDD 3QI9B 2NXYD 5B66O 3RWDA 4G7VH 3MBXL 2YPKA 1JGVH 1OK0A 2JI2A 4IHBA 2WO3B 1U3HA 4G8GB 1RUMH 2Q76A 4U0RC 1O9WA 3IPBA 4WJ5B 2OZ4A 2FR4A 3MCKB 2Z1PA 5KVEE 3ZYZA 4DP1X 5C09B 1KLGB 4WGVB 3SDAC 1W8EA 2WWMD 1MW0A 3UBXA 1RPQA 1FHNA 1Q9LA 4R0LB 2VDNB 5D1XB 1JTPA 2I25N 2BVTA 2EDYA 3K81A 3GRGA 5ADPL 5I8CA 1ED3B 1IAOB 1AGDA 1PHOA 2HKHH 5EBLB 4FI6A 1WBXA 3CFEB 3IAGC 4UB0L 1OSEA 2WXLA 1GKEA 2QV4A 3KYOB 5I1IH 3WU2O 1HE7A 4FG6D 2NMSA 3MA7B 3KXFE 4Y2LA 3V5KB 3N44B 4GG8A 4JR9H 1IGJB 5CJXA 4U1JA 5J6GA 4RGOL 4WFFD 5ILTL 5JHDB 3I75B 2NCEA 3MJ7A 4JM4H 5EU3A 1II4E 3P11L 4PWIA 2C7UB 3ZKXC 1K2DA 3P1VA 3DX9A 2X4RB 1EAOA 3MRKA 5DHYA 4YC2C 1J05A 2GBTA 1WEJH 4GBXA 2Q3AA 1IAMA 2IANB 1JERA 4MJJA 3NIDB 3VD1A 5I8KL 5FYJU 4LVHC 2P5WD 2J1KA 1SM3H 4ZUWA 3VI3A 4ODHL 4OJYA 3BT0A 2EDEA 3TIDB 5T5NG 3TVMD 4NWTH 1YO4A 3FN3A 3LVEA 2IEPA 5DUJA 4P57B 1HEZA 4DKFH 1I9EA 4X80H 4P23A 1YEEL 2ZX5A 4LLDB 3L3KB 5CSZA 5I1AA 3D07A 5I1CH 4GUPB 1BZDA 3WCYA 4F20A 5ALBL 1LNUA 3C6LD 3PAVA 2KZBA 3Q5YA 4KTEL 5AVTB 1QJPA 3UADA 3MO1B 4FFYH 5E0QA 3L3HA 1CICC 1MW2A 2PTVA 4G9FE 3QFJA 4NSKB 1HESA 2J2ZA 2IPKB 4FF9A 3L3OB 1N5YH 4X7SL 4BHUA 5I2IA 3TBBA 3OV6A 1KJMB 3MLYL 3UP6A 1OSPL 3SCMC 3HIZA 1WAAE 1JZ7A 3W56A 2C9QA 5E9DE 4AV4A 4AQAA 3AU1A 1J11A 2JIXD 4PREA 2SODB 3GMLB 3IPFA 4XVJH 2XWBB 2IBBA 2JCCF 5DMKB 3QR1A 3LKSA 4NQDD 2JTDA 1FHGA 3G08B 4BZ2H 4EDXA 1FLRH 4NKMA 1DQQB 3UO1H 1PU0A 4LCWD 3LN5A 4XVTH 3VXQA 5TF1H 2ED6A 4OZGA 5LNGA 1H6UA 2FLRT 3RJDA 4QHLA 4YFLF 1MJ8H 4FQQB 4G8EA 2G0LA 3UG5A 4ENEC 5AVWB 1OT1A 1BDYA 4NWUH 5KYYB 5LGHH 5GRYA 4W4OA 5KSVA 2J8UB 3JWOL 2P44B 4LCWB 3IXAB 3VSQA 1ZVYA 4JHZA 3BSHA 4NQXA 5KANG 1XGPB 3RA7L 3X1EA 3A2SX 4MDIA 1ZLVH 5EH1A 5FOJA 2IXQB 4P3DA 3HW9A 4ZXBB 2IV8A 4ZFZA 3PDDA 5EDSA 1XH3B 1S7TA 3TX4A 5D7IF 4G5AA 1ZLWH 4P2QA 1S7XA 2K6WA 2EDOA 2WNXA 5GHWL 1CLOL 2H1LM 2CHZA 4RGMB 2V2TA 2W38A 1WFMA 3ZZLA 1CFBA 2GI0A 1FNAA 4WI9A 2B16A 1XR9B 5EZLB 2G9HB 3OKOA 2NQDA 3BSZL 3HE6A 2J71A 1EJFA 3X13A 1E4WL 2X28A 4G9FA 3CBJB 3HC3H 4I87A 4IRSD 1I3RA 3K6OA 2PETA 1KBGH 2EDNA 1GAFH 4NNPH 4UMSA 5D4HA 5FUCE 4LCWE 3C6LB 3REVB 5F7EH 3TJEH 5CEZD 4F5CE 1CXIA 2XN2A 5D1XA 1ACCA 2AJUL 1OAYH 3II2A 1OM3L 2BFVL 1S78D 4PGJA 1XCQB 5IJVB 4XX1E 4H8WH 1J8HD 4Y5YC 2HA1A 4X6EB 2HLFC 1MCHA 4ZOCA 4LP8A 4ZSOA 5BV7C 4JKPL 2WBJB 3WUWA 5IVZA 4KUCD 1OCRB 5DRWB 2IAND 3D69A 3LRSB 5IHUH 3SPVB 2CIKA 2F1CX 2X89A 1E50A 1GZPB 1M6OB 4Z95L 4D7PA 4JQIL 2FJHA 5FDWB 4NC1E 2GFBA 2BHZA 1NFIB 4NM4L 2RQ8A 3ASWA 3QA3A 4DKFL 2OMXB 1N67A 1RPKA 1FNLA 2Z92B 5BUGA 1BVOA 2FYYA 2FSDA 2O5YH 1WS7A 1DFXA 1NGPL 4D65A 2KBGA 3QQNA 2X05A 4R97B 3BDXA 4JDVB 3TNNB 3RAJH 1ZV9A 2XTJB 4HCRA 1MI5E 2O26U 2DLFL 4CBZA 3UTSE 1J0KA 4YHIB 3O3DB 1AZRA 2CNYA 5T5NF 4N86A 3WI9A 5DRNA 1AMXA 1X9UA 3D87B 3T24A 4HA1A 5FB8A 3GNMH 3ETTA 4HDIA 2WXIA 3BEVB 5HHXL 3TO4A 2H0JA 5SWQB 4JHVA 2LHAA 4M6AA 4NPKA 5L6YH 4L8CB 4OT1H 2HWZL 4FI7A 1W16A 1AC0A 2FX7H 1FFRA 3QQ9D 1EQWA 3ARGB 4GCQA 2WQUA 3KGSA 5TF1L 3LRKA 2ERJC 3G5VB 1YJDC 3QZOA 2I07B 2OR8A 2XTJE 4WKZB 4RVBA 4BELD 4URTB 4YDVB 3DGGA 4Q52A 3MLPA 1NFAA 4OLUL 1GFNA 3ARDA 3K71B 3G7TA 2AJXL 3RUGF 4RFEB 2IANA 3D2UB 3HI5H 2FAUA 4NYLB 1LE5B 2FX9L 1YJDH 2V37A 3WEOA 1KELH 1WFIA 4OD1H 5CGMA 4JDEB 3KH3A 4HXBL 1EEZB 3EDJA 4ODBD 1NGZA 2BLFA 1IGYB 1B3JA 4FHBD 3WJMA 5KYYA 1QJ9A 5BZWA 4BFIB 4KROD 1DQKA 2R0KH 4PJ6A 4Z0XA 3RZCC 3IXAA 4RH4A 1EERB 4LLDA 2HJKB 1EJOL 1H0DA 1MM5A 4UQ9A 4ZG1A 3QJTB 1NOLA 4PWFA 4MKTA 1BCIA 4U1NB 4U3CA 1N5YL 4U7KA 1R3HB 3QFDB 3DRQB 1MREH 3ARGD 4GQ9H 4L4VD 6PAZA 1LEKB 2J21A 2E7LA 3QULA 2J2ZB 1VZIA 1OGTA 4CC0A 1UGNA 3F62A 2Y2XA 1JS4A 2VL5A 4UNUA 4UQAA 3IF1A 1MAML 1NBQA 1UOVA 4JFXA 3UAJC 1OP5H 3NCFB 4OZIF 1PLBA 4KO6A 5F9OL 1OPGH 4LIQE 3TEXA 5C0BE 2QJDA 1CGXA 2CLRA 1JPGB 5DEZA 5LBSH 1WCQA 3QRCA 3Q2NA 4Q2ZB 3K6SB 1BXAA 2C9PA 2EIMB 2MQCA 5AKSA 4OLXH 2OMUB 1DP0A 4A7VA 1Q9KB 1WC7B 3NGBC 4UF7C 1GYWA 2RR3A 3N1QC 2I26N 1KLFB 3T71A 4F7MB 1PZ2A 3JYBA 3CFMA 1WZAA 3TYGL 1GW0A 3BZ4B 3KLAA 3DSFL 4X0KB 3PHOB 2DI7A 2XU9A 1E43A 4TPRL 4KRPD 1A7RL 1LQSR 3OTTA 4O9HH 4NQDA 5IB4B 4U1LA 3BKYL 4F2MA 1JGDB 3Q6GH 4KKQA 5ISZD 1NEZG 1PPIA 3E3QE 4U2YA 1IM3B 1F0LA 4U3XA 5I9QB 3TBWB 4J4PD 2VDNH 4DCQA 2NY7L 2A2QT 4IM8A 1IGCL 4XI5D 5ABDE 1EVUA 4C4VB 1MFEL 1T21B 3IE9A 3U1PA 4FTVE 5EZIL 5LBSA 1XH0A 2PWHA 4XT1C 1N7ML 2PXYB 4JFOA 1J5HA 1P4BH 5D2LE 5CGBA 4DEPB 5DA4A 4MCYA 5EO9B 4OF7A 2EH8H 3QJXA 3PXJA 3C6LA 4HHWA 4I88A 3V4UL 4OM1L 3VRJB 4BQ6A 4H5SA 4FI8A 4XBMA 3TWCH 1A9BA 1RHHB 2OM5A 4JRYA 1ZS8B 1XCQA 3OZLA 1XGRB 2Z65C 4M5YL 3CBKB 2D3VA 1IFHL 3TVMA 2X6MA 3VJ6A 4RCAA 3BUPA 2VXTL 3HI1B 1D7CA 4LVOC 3VB9A 1PFOA 2H8PB 3WUWB 4RLDA 3Q6FB 1TQCB 4WK4B 4B61A 1XF3A 1FDLL 4D0BB 4JFWA 1UWYA 5FUZH 4U0QB 2DMKA 4MBRA 3LTVA 4P3CH 5CJOH 2AJZA 3T3MF 4L0ZA 2OW7A 1OPFA 1HL9A 1E2WA 5L4JA 4E1SA 3FQRB 3FC8A 1BIHA 4Q6IC 3BDYL 3TA3A 2K8MA 3KWTA 4TTGA 4X9FA 2HH0L 1X7QA 2CG9X 2FECL 1J8SA 4APQC 2VDQL 3JV4B 1YN7A 3PP3K 5HJDA 2BVOB 1XGUB 4QY8B 4TV3A 2WZPA 3ZDXE 4K9EH 2HJKA 4B7LA 2FJUB 1UYWH 4KZDH 2ZKHL 1XZ0A 3DHPA 4K3HA 2VWEC 5C97A 4OGXL 3FO9A 4Y2OB 2KXPB 3Q8EA 2GYSA 1EXHA 1E9QB 4OCSH 2SEBB 2A6DA 3QWOB 4PRHD 3K46A 4YAQA 2DJ4A 3GWJA 4NO3B 1DVFA 4ODSH 4I7ZC 3NFNA 2RCSL 4R7NB 1CU4H 1TOXA 3O6KH 5L9DL 4TUJA 1AS7A 4WKXA 1GZQA 2LTQB 1Z9LA 2Q2EB 1I1YA 3INUL 1DDTA 3GSRA 2BIHA 2JK5A 4YBHA 5E08H 1CBVL 2JKIS 1OSMA 3WMPA 4WCYH 5A2KH 1ZTXH 4BE6A 1IGMH 1VACA 4J3OD 1NFDE 1PDKB 1EAPB 3QJZA 3RVXD 4UV7L 2A9ML 2DIJA 4XCEA 5I15H 1ZT4B 4LSPL 3ATBA 2DQCH 3KEHA 3OAUL 4PP1C 4Y2NA 2XXFA 3QG7H 1UM4L 4B27A 4NQQA 4KO9A 3BGAA 1MFVA 1A1MB 2BIMA 5A3IC 1A6AB 2V4LA 2Z35A 4QRTB 3H42L 5DCCA 1GJIA 1HKFA 3F84A 2WNWA 4A6YH 2NUPB 2XKNA 4YSTA 3WIAA 1R5WA 4J28A 2OJEA 4N90E 5K5YA 3SPJA 1Q1JH 3I3DA 1WLHA 3NDZE 4R4ND 1RMFL 4QF1B 4XPHL 1BM7A 1WHPA 5GGTA 4C56D 4Q0XL 3IGAB 1D2PA 2WVVB 3V7AE 3CTTA 3ARBB 4I85A 1MDTA 4KHTL 3ZQXA 3AGVA 3R1GL 1FFOA 4OB5L 4QTIL 5LHDA 3U48A 4ZXBC 4HOWA 1NAKH 2BP0A 1E9PB 4FX5A 1GIGH 1OSYA 3MLZL 3S0PA 3NJKA 3IBEA 1NCHA 4JY4B 1JV5A 2K7PA 4F8LA 4H5SB 3C9NA 3STZB 2R39A 3PWNB 1K4CB 4ZX5A 1ZS8A 1CXKA 2OLDA 3BP7B 3VUAA 4G8GD 5HYJD 1S7UA 4M03A 1MFMA 4PRIA 1O7VA 4PRBB 2VTFA 2DH2A 3O4OC 2KC0A 4U6XA 1EDHA 4JFPB 1TQTA 5A16B 3KLAB 43C9B 2XRAH 2P80D 5EE2A 1CVSC 1HNYA 4N1CA 4X5WB 3S96A 2VDKL 3W11C 2N2LA 2QGEA 3NCWA 4HUXB 4I13B 1OGAB 1IM3A 3EO1B 4NPJA 3N2JA 3QUZC 4S11A 1OB1B 4DCQB 1JRHI 4GXVH 5C0CA 4MVBD 1BW8A 2R69H 2W94A 2MOGA 2X4UB 1DJYA 5FYLH 4FOZA 3T8XB 5DVKA 4CC1A 4OSUH 3U6RA 4AJVA 3L81A 4WEBL 4FNRA 2G75B 2H6OA 5D9SA 5JO5A 1C08B 4JBSA 1RUPH 2H3XC 4OFKA 4EUPH 3MGAA 4ZAKC 1F97A 4IBSA 4G5ZH 2PWEA 2GY7B 2R15A 3EGSA 3VZUX 1HSAB 4HLJA 2DRUA 1I7RB 1V7NH 3BSGA 3UACA 1RZFL 3CFJB 1SMDA 3LKOA 3LMJL 4YDMA 4CU8A 1U8OA 4N20A 4TQIA 1E8XA 5H2FO 4QJ5B 1R5VB 3O4LD 4WCYL 2O4EA 1DVFB 4V2BA 2XN9D 7PAZA 4JFSA 4YSAA 1RERA 1H3PL 1AAJA 4MJIE 1PJ9A 32C2B 4KZCA 1AD0B 4FHJA 3QH3A 4R7DB 3VSTA 1TMQA 1SZNA 2X9WA 3PG2A 2AJZB 3C09C 4CTDA 2BOBB 2WWKO 5F6HJ 4IBVA 2HLAB 2DIBA 5IFJB 1XAKA 5D5MF 3E6HA 4J27A 4PJAF 5J8OA 3PHAA 1S2EA 3T0EE 1HVXA 4ZK8A 1AD9A 1ZKAA 3AQYA 3AFLA 2VR4A 1QAWA 5CEYA 3EGXB 1A6WH 2AJVH 2D4FA 2E27L 2WLZA 1WA0X 3CFNA 3MBED 4LLUA 5FYKD 5GGSB 1MF2H 3K6IA 3M86A 5JW5A 2Q7AA 3MRJB 4I0PC 4H8PA 1IGTB 1MUJA 2NCMA 4PJGB 4WSGA 3ZE1E 1E2VA 3JV4A 1IC1A 1A0QL 2A9AA 4IS6A 3SJVD 1M71A 3ZL4L 1XH1A 1BAWA 1IM9B 5ENWA 3T0SA 5HD8D 2DAVA 3VXMD 2ATAA 4Q0XH 4E0RA 3VXSA 3HMWH 3GLDA 4OIIH 1AHKA 3BW9B 4FEIA 4GW5B 4NS0A 1U6AH 4KDTC 3RVTC 3RUGE 3E1F1 2FD6H 3HG1E 4IHOB 3S6CA 3SGJA 4OZGE 3L1GA 2XVGA 3SDDB 5C3LD 2CO1A 3TESA 1NFKA 2BMKA 4E2OA 4HZLB 5I1HL 3M46A 4NCC1 2JB5H 1AQKH 3A67L 2KLSA 1PKOA 2NY4B 4Y9FA 3T65A 2CUIA 1BVZA 2EINB 5AOJA 1E5AA 4EN3C 2CDGB 4O4YH 5CCGE 3NN8A 1A8ZA 3FQNA 4MXQD 3ZKND 2DY2A 1OB0A 2ZSWB 1TO5A 2JFCA 1DBKL 1PZCA 4P4KD 1YEHL 3MCLH 2CO2A 2WAHA 3GS0A 3PLYA 5D7SH 1BIIB 2ZUSA 2V6HA 1CI3M 5AW5B 3OKYA 3EOBB 1V3JA 1RUML 4WIQA 3NCBB 2VDKH 4JB9L 5I0YA 2J1NA 2B39A 5MENB 3ILEA 1JZ8A 2VERN 2Z34A 5HVWA 4JNXA 1T89A 4U3SB 4EXPX 1GY2A 4NPYA 2LR4A 4P2RA 4EKXA 1E5BA 2XVKA 4FYTA 2HJFA 4Y5VA 3HCVB 1OT4A 2ICEB 1JN6A 5ES4B 3CC5B 1D9KB 4NHUB 1QG3A 5GRVL 6PRNA 1UQSB 5EU3B 1X5LA 2YXFA 2B5IB 4P46B 2OSXA 1JP5A 2WWNA 4L29B 4LP5A 3QNFA 5AUMB 2P26A 4AL8C 1Q72L 3AZUA 5JDSB 2Y23A 2YEVB 4RQQA 3GDBA 3X1FA 2Z1KA 2R4PA 3K91A 1WJ3A 3CWGA 4M56A 4JVUA 4AGMA 3MLSL 3F8UB 3WIFA 1IO4C 3AC0A 4Z7UB 1GR7A 3OKMA 1BZEA 2EEAA 2HTLD 3MLWH 4KTDL 4L8DB 4TUKH 4LSTL 3GJFK 2XBZA 4YVNA 3VGAC 7PCYA 5KVDE 2ATKB 4M1CD 3KXFA 4AYFB 2OZ4L 3PGSA 3CVCA 3EGSB 4L3ED 5D7JD 4EBQL 2PKDA 3BP7A 3PGFL 3MO1A 4ZMLA 4IU2A 1I7RA 4PIRF 4HV8B 2IFFL 2OTUB 2EVJA 3HVNA 3P9MB 3W9EA 2IPTL 4WTZG 4LBEB 4LE8A 1VFUA 2YD4A 4XO5A 3IMRA 3DBSA 5E8OA 5HI5D 2F61A 1E4HA 1KMGA 5SWSB 4R97C 3ULUC 1UADC 4KTEH 2H45A 4H8QA 3RKDD 1U9KA 3IJ7A 3AAZA 5AQ0A 3OSKA 3ML8A 4PBWD 5IMLB 3Q2LA 3DV4B 4UZSA 1L0QA 4YGAB 4XRCA 4DK3A 5ICYB 5FM5M 3HB3B 4GG6E 3ZKXB 4BA0A 1CFTB 3EF4A 4G6AC 1HEJC 5EOQH 4X6CE 4AW7A 3ETBJ 4EDXB 3B6SA 2HKFL 2NZ1A 3QZBA 1VSCA 3KPQB 3U1QA 1CYGA 1F11A 1IILE 43CAB 4JN2B 3HMWL 1QPKA 1L6ZA 4TQHA 1JZ5A 4AY0A 2XXGA 1HXMA 1PLGL 1PY9A 1XCXA 1ZHKB 3CDYA 5JZ7D 5KBDA 4GAGL 1Z9PA 2R29L 5CR8A 1MCJA 2Y69B 1O5PA 5GRWA 3ULAB 1JTOA 3EBGA 3QFJE 1A4CA 3FYXA 4JCHA 4XNLA 3LH2L 4HKXA 4PJ9C 2EVIA 2ZWKA 3V0VA 2AERT 1DVZA 5F3HB 2Z3FA 4NQED 4LL9A 3RTLA 1C7TA 3N1PC 4CN1A 4M93C 3MCYA 2ICWA 4JJ5B 3VWKD 3KCPB 2JH2A 2Y3NA 5BS0A 4U6VH 4S1RL 3FUHA 1X7SA 4OU3A 1TTUA 1ET8A 4JG9A 3BZEA 4Z7OE 3FT4A 2OR9H 3HC0A 3DROB 1AH1A 5INDA 4BGLA 4ADGA 3G6DL 5AD0A 1GFMA 3NCCB 5E4IA 4ZMPA 3QXVA 4EZMA 4BGDA 4M4PA 3ZDZE 1U8PA 5CD5C 1LK3H 2QKIC 4OVUA 4LSUH 1LMKA 1YDPA 4UM8B 1BSIA 3VY9X 2WLLA 3JWNH 3PAUA 1UOLA 2LFGA 5D1QE 1G7JA 4MQ7A 4Y19B 1KTDB 4WNJA 3SBWA 1DVQA 4AYNA 3LS4L 3GHPA 4YE4L 1OW0C 4HFUH 4HWBA 1U8LB 2KT6A 2I9LA 2O1AA 1SMOA 2ZXCA 3QRGH 3MRFB 1EHAA 1A6ZB 3A6CH 1AQKL 3A67H 5DEFB 3MTXA 3SDDA 3DBXA 5IROD 4JFEB 1Z3GL 3N85L 4X9IA 3IKCA 5PAZA 1U3NA 1LYQA 2RAMA 4KPHL 2PTTA 3OJDA 4ZUSB 3NBNA 4K23L 1UXSB 1IAIH 3GYRA 1E8ZA 1FYTB 4L4JA 5EBMB 4XX1G 4AFKA 4A7TA 3OAZK 4ABVA 3V6BR 3O8XC 4F8PA 1B6UA 3P0VH 1NAMH 3BEVA 3RVVD 3HOLA 5ABAA 1TZHA 4KXBA 1EDYA 5G2NA 1FNSH 1E90A 2B9BA 3JWDC 3QZPA 5DC9B 5BXFB 4KTGA 1H9VA 4H8HA 3LPGA 5E5RB 4YPJA 3MCKA 1NCTA 4MSWA 4I9WE 4EOWH 4I1PA 2W65B 5D6CA 2H2SD 5J11C 1K8DB 3K8LA 1BX2B 4AYDC 2UWEE 1PYWA 3BS0A 2X5PA 4JPSA 1N12A 3STBA 4NZRH 5JOEA 3IKKA 4LCCB 2YD6A 5B7FA 3ZE2B 4KJQC 1P5UA 3SD5A 1E3FA 1JGEA 5E9DD 2HVBA 2HX9A 1ZVSA 1UB5A 2WUBL 3MOAH 1OL0A 3D2UA 4NYLA 3F05A 4XTRC 3H54A 4YEFA 2WBJD 3VFGL 4DF9A 4HS8L 1X6NA 5D72L 1PKQE 3ZXAC 3P3SA 2XTRA 4MDRA 5DD3L 1NPNA 2J1YA 5B38A 1LWJA 1DHKA 5E99H 3CZEA 4P5SA 3PL6C 2Z4QB 5H94A 4WUUB 3OB0K 4F27A 3DX7B 4FG6C 2E8YA 3WNKA 4JRXE 4OJFL 3DC0A 5GJSL 1ND0A 2PCFB 4UIKL 1CWVA 3CDGA 4FXKB 2BNQD 2W0FA 3KLKA 4OKVA 5FW8A 1E6OH 5JQHC 3W9EB 5KYNA 3LPWA 2V2WA 4J2XA 1QPPA 3BPLB 4DGVL 4X8GA 2XXCB 4RRPG 4HZAA 1XCTB 3RWJB 4XPAH 4JFXB 1RUKH 5HY9B 1CFVH 1FG9C 2OJ1A 2ZXQA 3GO1H 3PXHA 1XBRA 2FGQX 5ICYA 2APTA 2XKSA 4ZXBD 4EZKA 1QLFB 3S3DB 3SKUD 4P4RB 1IMHC 5AVXB 1FZJA 3B6SB 4KAQH 5EN2A 3QNXB 1IGIL 2OCJA 3T8MA 2WKGA 3SY0B 4F1ZA 3L3OA 2ROXA 3GSQA 1CGUA 5H37G 2YKKA 3E0GA 3TIEB 1FSKB 1LDPL 4NX0A 2WLLB 5E8DL 3A3YB 4L05A 4Z7IA 2Y0KA 1CG9B 3GTNA 1X5JA 4WWKC 3VRIB 4UDUA 5DJXA 1TNMA 5I1IL 1KTDA 3UG4A 2P8LB 4U1GB 1EX0A 4GIPD 3KVQA 1KC5H 8FABA 2QGCA 1NGQL 1MHPL 1IE5A 1JK9A 3NCJH 4ORGB 1OTSC 3HEIB 1ZV5A 3FSZA 4PRPB 4XN8A 5KTEH 3UPCA 4JRXD 1Y0LA 1EO5A 2BC4A 2A6IA 5KN5B 4AM0B 2XZCH 3G7GA 5IFAL 5T5FA 4Y5XA 1Z0NA 3QO0A 1P4TA 3OJDB 4ERSL 1JV2A 4G42A 4BDVA 5E6RB 3EOTH 5I19L 5DJ2B 2JJSA 2PPEA 4GPVA 1U41A 3TGXA 5GRUH 2D03L 4BK5A 2NY3C 5BMFH 1GYUA 4R0LA 3F5WA 3DTXB 1QSFE 5ESVB 1NM9A 2WINB 2DQMA 3IDGB 3UGXA 4N2IA 2NY6D 1HXYA 5I71B 4RIRB 5C0EA 3NQKA 4X80L 4FESA 3TVMB 4UAOB 4MAYC 5EF2A 2WTPA 1YDPB 4Z78B 3KYOA 4UYPA 3M88A 4P2AA 3ZX1A 1KFGA 2F54B 5I66B 1I8KA 3DIDA 4MA8H 5CIPB 1RY7B 4JPVH 4Y19A 5C2UB 4XBGB 4XWGH 1RZJH 1PL3A 2BM3A 4P9HC 4Z5RA 3V55A 5J57B 1YHPA 3LV3B 5F1NB 4Y4KD 3SDCC 5C6WH 1TTCA 1SFDA 2BZ7A 1T0OA 3OMNB 4LSIA 4N90D 3P4OA 4CSPA 3LK3B 1U3JA 5JHLA 2WUCH 4N2HA 1CZ8L 3UYOD 1IVLA 4P59H 3QDMB 5DZVA 1WBYB 3W0WA 5IIEA 4QJ3B 1UH3A 2XVLA 4NGHL 1G9MH 3EO9H 3QEGL 1K6QH 3U2SB 2AXGA 2ITCB 3CG8A 4D94A 5A2CA 2PN5A 1FNSL 1WFTA 3QXAA 4FQ2L 2G0KA 3BDYH 4OCWL 6FABH 3SKNB 2JI3A 1JPSL 3VXUB 1C1EH 1F90H 1U42A 1HWHB 2W0FB 3L3HB 1O9ZA 4LF3B 4TVUA 3ZTCC 5J4MA 4AQ1A 4F7CB 4JW3A 1FZMA 4X4MA 2W5PA 1AYRA 1A5FH 4H13C 1CD9B 4I9WD 2OMNA 2NY5C 1IAKB 1S7VB 2IWEA 2X2UA 4JRYE 2CBMA 2WQ8A 3KW8A 1INDH 4H0IA 1JZIA 4DOHE 3HZYB 1UXWA 4PJBB 1BXXA 1BEXA 1GXEA 3FQTB 4PGDB 1DQLL 3HN8A 1XBDA 1RU9H 3IDNA 4NRZB 3SODB 3FNKA 3LHAA 3SE3C 3VU1A 5IUSA 2MMXA 3SPIA 4MB5A 3BSZH 2PO6C 1YG9A 3O6KL 3OHMB 4WW2C 5L9DH 4JN1H 5AYQA 4LNRB 5E2UL 4BRJA 2J8HA 3RWFA 5A2JH 2AK4E 4FD0A 1TQSA 1XR8B 5D8JL 4P05A 2QFPA 5F7EL 1OAXH 3E1ZA 3ET9F 5T1LA 4AENB 1Q9FA 3EUDA 3FTVA 4O3WA 4EI5B 3HE7A 3DWOX 5EOCL 3QCVL 5SWZA 3S8FB 2F9BT 4B97A 3ZTEA 4KKLD 1WV7T 3EMNX 2JKWA 1CLYH 3WENA 5IFAH 1A2YA 2Y3AA 2CCVA 2WGXA 1NJ9B 2TSAA 3Q0HA 1SY6L 2GT9A 4LK4A 4RFNC 1YLBB 3G6JA 4M8QB 2C9XA 3V4VA 1JAEA 1PW3A 2R29A 3ZR6A 4B3VA 2ZYRA 3B2XA 3VXRB 3RIFK 3IMWA 4D0DB 1AQ8A 2D3NA 1JPTL 3AY4C 3MRIA 5FHAH 4CSZA 1DZ0A 35C8L 5T3ZD 2D0FA 1AFVH 3MYJA 4LPWA 4Z3GA 4TM9A 2Z91B 1Q9GA 3DO7A 2NXYC 3NSYA 4UWQB 5F7YC 5BRQA 4WFGD 1JPST 4EUPA 3VW3H 5M7QA 1I1RA 15C8L 2NNAA 1FL5B 3BEWB 5L2KD 3X13B 1U8IB 4JRYD 3SZDA 4LSVH 3QQ4B 1ES0A 5LAPA 4JFDE 4L2LA 2WXKA 1IGIH 3KVDD 3IDIA 5DJ2A 3NIGB 1UT9A 2KPWA 3O41A 4IQHA 2MCPL 1BQLL 4DPCX 4PRDA 3AA7A 4FQLL 4WW2B 4O58L 4AVJA 1QVOA 1M3JA 1FJ1B 2AXJA 1RUQL 4KHTH 2WY3B 1ZE3C 1Z7JA 3BPOC 2X7LB 1XQ4A 4GOSA 5CO1A 1A3LL 4ZNEA 4L3EE 3LH8A 3BP4B 1PRNA 2WNGA 4KXDA 3K5RA 2CBQA 1KC5L 4N2EA 2EDTA 1U8QA 1QBBA 4URKA 1KGYE 5M94B 2VAAA 1U36A 3HBZA 4M6NL 3BMVA 4NI6A 2P8LA 4YHLL 3P0YH 2NY0D 4HF5H 3G5XB 2APBA 4LPUA 2YKLH 3DXAE 4WDIA 4UU9B 4C69X 1U21A 4GSQA 4X99A 4QAMB 2PWDA 1CL7L 3VNZA 1NFIA 2CPCA 4XNQB 3MNZB 3QUMB 2V7HA 3UBXI 3C09B 3ELQA 1KUMA 4G71B 1YNKH 4OLUH 3O0RH 3TBYA 1T1ZB 2XWTB 2JTYA 5I1KL 3L3JA 3WLBA 5FYLE 1OGPA 4S1SL 1JVKA 1G7PA 3VFPB 1FUNA 3D85B 5DJDA 4RMBA 1HDMB 4GKZA 3QORD 4FGMA 3H9SD 2XA8L 3PGDA 4DQOL 4IU3B 5DRNB 3FDWA 5C07B 1E5UI 1TKWB 5I75C 4PY7A 5DO8A 3KNBB 4AKOA 2P24A 1NIEA 4U1IA 3LKOB 3S5YA 2YPKB 5IQOA 1EJOH 3VFUA 2DMGA 2ZKXA 3PQSA 1MHEB 2DI9A 2IGFH 3OZKA 3RIKA 4NNXB 4K3GA 2VLLA 1I8KB 3KPNA 3RRQA 1IAKA 1C7SA 1S7VA 2KZ1B 3GHEH 4L4VA 4AZUA 1HJCA 1QR1B 3PP3H 2G60L 4YE0A 3GXMA 1N68A 1JF5A 3H2QA 2NDGA 4IEFA 1MQKH 2A6JB 1MHHA 3RHWF 4HIEA 5EOCH 1PF3A 4B60A 7FABL 5HGAB 4GSXA 1NPUA 3EYOA 1NCBL 2NSQA 1OPGL 1I1CA 2NXZD 2IG2L 4BZ2A 1J0JA 4FADA 3D51A 4YEEA 1RZPA 3MJ9H 4XP5H 4RMUA 5CILH 4ZZFA 5C0FA 2CCLA 4EBQH 2VITA 2ZFGA 5DMGD 5D1QB 3UO8B 3D18A 3RURA 3ARDD 5F7LB 1OXYA 1E5ZA 1P7QB 5GSVB 3ARRA 1FVCB 3FUEA 3O2WH 1CLCA 5EUOF 1JWMB 1VGKA 5DHMC 3VXSB 2R59A 3TF4A 3K2MC 2AJYH 3D52A 3MRKB 4U1NA 1RSYA 1VZHA 1RKRA 2A74C 3QFDA 4ZFQA 1J9RA 3FCSB 4OCXL 3VX0A 4D0DA 4ZMOA 5D5MA 2F58H 2PPFA 3VI3B 1K85A 2W07A 1EH9A 2OSYA 2ZCLL 1F3JB 2RTTA 1BPLB 3B7UX 5J6HB 1RU9L 1UZ8B 5ESAA 2WSKA 4I0KA 4M6MH 4NJAH 3VFTA 3QDGD 4Y9BA 5AZUA 4E9YA 4B53A 1S7SB 4KC3B 12E8L 1FYTE 1VCAA 4N5UA 3NN8B 1PVHA 3RWHA 1ES0B 5TGBB 2FJGB 4WNSA 1RIHL 4HS3A 4QCIA 4F58L 1IEHA 4WW2A 2Y2YA 5MI0B 1R5IA 4HUKB 3QCVH 3KPMB 1OAZH 3QFJB 1QSZA 2BVPB 3D34A 3KVPA 3QJFA 3WNJA 4ODWB 4KKCD 4I5BA 5CMAA 1UC6A 5J1AB 3VRLE 1NIBA 1RUAL 1R24A 4H0LC 4OUUB 4YO0A 2ZWNA 1A7OL 4N26A 2P28B 4ZD3H 2Y36L 3CC5A 3GD1C 3AWGA 4KJYA 3UZQA 4H2CA 4ALAC 4EQ2A 2IFGA 1IVTA 1U8HB 2GC7C 4LMQE 4HOXA 1RL1A 2OYPA 4AMKL 2BRQA 4OZIA 4HX1B 2F1BA 5F7MC 3L48A 3I74A 4B9PA 1HH6B 1W0WB 5B8CA 2V5SA 3RWIB 3QPXH 1Z5LB 2EIZB 2VWEE 1Z9SA 4IJTA 4YUEH 5AUMA 4MA3B 2DQIH 3PGCB 1WHOA 4QRRB 4UOJA 3TT3L 1BD2E 2A1WH 2EC9U 3A4FA 4LPXA 4CVXA 1KBBA 3BJLA 2AAAA 3DO7B 1HHKA 5ITFA 4K2UH 5T1KA 4X7TB 4KUZL 1OP5K 5EUKA 1NDGB 3RLSA 2VAJA 3NP4A 3UTSB 3TCLA 5FO8B 5D7IA 2R1WA 5D1XD 4Z7WB 2ZF8A 2QV2A 4HGMA 2QADC 2AVGA 4YFLI 4BFGA 4X7SH 1MHCB 2OJEB 4WI8A 2IH8A 1H3VA 3GMRB 4P2QB 3F2LA 1ZHLB 1V8HA 2XG6A 2TAAA 3ZTDC 3P9LA 2OTUA 2Y1ZA 2LFUA 1OAYL 3HI1A 5JW4M 5AW3B 3SGJC 2BCKA 3ASOB 5E5MA 2VAAB 2HZHA 3OLEA 2WP3T 4XOCA 1G9HA 3ZHLA 3CVDA 3QORA 2JF1A 2KL6A 3CN2A 3HNSH 4ZTOH 2R4SL 4PJCA 2FZ3B 3ME0B 3LZOA 4PY8I 1LO2L 2VZTA 5E8PB 5I26A 2Q6WA 3ARTA 2XZZA 1KCKA 3HFMH 3SZKC 5CJ8A 3KPQA 3QDJB 4ZOAA 4K3DH 2WKLA 1JGUL 2AEQL 4M5ZH 1FNFA 1WFOA 4NM4H 4MCNA 4PLJD 1ZJBA 3T1FA 1L6XA 5GHWH 5I15L 5FIEA 3L3IB 1P1VA 4QLRA 1KGJA 2XX1A 3PGDB 4ZUVB 1I7TA 2YBGA 1J8HE 2QSCL 3DMMA 3RB7A 5C0CB 4XMXA 1E4XI 1KB9J 1PLGH 3IT8D 2IDTA 2IWWA 4HULB 4XCFH 3EIFA 4JZJB 2FYYB 4A63A 3FU9A 3TL5A 4O02L 1L9SA 4X6DA 2OK0L 4MMZA 2HFGH 4FL4B 5TQ2H 3LH2H 4NZDA 1LP9B 2HT4D 3Q5TA 2YD2A 1BH3A 3S2AA 1Q4NX 3E8VA 2XFXA 3BX7C 4Z7UE 2JK5B 2VXUH 1INQA 4HFWB 5L2KA 3MRHA 5ADOH 1KENH 3MRNB 1BQUA 2OP4H 1XF5B 3VWJB 2Y36H 1DBBL 3CFJA 2PF6A 5DD1H 5I17B 1DVYA 3NJJA 3NZ8A 4ZW7A 3V7AG 1LEGA 3ILQD 1A22B 2YC1A 4KQ4H 2YQBA 2ICCA 4AQEA 2VDPL 4AUYA 3VG0H 1DDHB 4QHUA 4WSJA 2AVFA 3ZE1B 5AW8B 3EW3B 3L3GB 3K72A 3SE3A 2W91A 4QYOB 1UHVA 4MJ5A 2K4WA 2EO7A 1FL6A 3QIUA 4HGKC 2EYRB 3B34A 2F58L 4KV5F 1EAQA 2IH3B 5ADXL 3S35L 5BRZA 2O5ZL 1JVOA 5H2BA 1WAPA 3DBXB 5H8DA 5EORL 5B39G 3WXVL 3OB8A 4LO9A 5IBLC 5HGDB 3BWZA 1RZ7L 3WIIH 1HHKB 5BZWB 3GXDA 2V7NA 1IC7H 1JWSB 4XHQA 1IQWL 1ORQB 4GRMB 5I71C 1WGOA 2KQNA 3U4BH 1YPZF 4YHZL 1ZSDB 4QXGH 5AL0A 3B4NA 5FO8A 5KVMC 5DS8B 4OSUL 5B7MA 2E7LC 1U0QA 3PY9A 1LMIA 5BS0E 5IW3A 5B39A 3SJVE 3T2QA 1BXWA 3MMEA 4BBWA 4ETQA 5F9OH 4J3OG 3PWNA 3DRQA 4P2YA 5FCUL 1T20A 4M29A 4NJ9L 1IJNA 1EFXB 3H55A 4AG4L 3CHRA 4M7LT 1S46A 2WTOA 4YXKL 4I2XE 4GMSH 4S0TD 4JJOA 4JL1A 5FGBA 3RZCB 5HHQB 2G2NA 2DKMA 3AREA 3CQQA 4YO0B 1C8PA 1DQMH 1E28B 2EVHA 3BAWA 4LU5H 3CFKA 2HX8A 5E5MB 3AAAB 1KTRL 2W65A 3LKQA 5D6CB 3O6ML 2R0LL 2H26B 1NIFA 4TTDD 1JPGA 2WIIB 1UKSA 4S10A 2VQ1B 4BKLA 1B0WA 3ARUA 3B2VH 2Y6TE 1RD6A 4KMTL 4QRAA 5BVPL 2ZKWA 4QRPD 1JGEB 4N6QA 5GRJH 1Z9SB 3Q6GL 4KOCA 4G6ML 5DLLA 4IK6A 3FB8B 1M05B 1WD9A 3BVDB 4IDJL 4OCNC 2YPLE 3QDJA 1N5AB 1QABA 1YPZA 1H3TA 2ODHA 3MRMB 4MA1C 4TOYL 4PJ0O 4OZFH 4E41D 3VQMA 3KYMB 1M4KA 4HJIA 2J72A 1MREL 3CC1A 5TJWK 1L0PA 4WHYG 2XE2A 3QWRA 4L23A 5BRZE 4LCYB 4P46A 3UAQA 4A7GA 5KSAA 4PWJA 4PJHB 4Y19D 1BJ1J 5CZVL 1R3IH 4OFVA 4GCPA 1H3UA 4F7TB 2WLKA 1MLCB 4HUNB 1UD6A 4IW4C 3NSFA 3EAKA 2DMBA 2YD7A 2BIOA 5T3ZH 1QRNB 3DSNB 3ZIYA 3WTSA 1T4KA 4HLZG 4WFHE 2R0ZH 4KVNL 1PNDA 5TDOB 3W2DH 4UT9L 2JMMA 1AKJD 5GJSH 1ZT7B 3H3KA 3DETC 1HJBC 3FULA 4N2GA 4FNPA 2BNQE 1TQBC 4JG0H 5DVNA 2F74A 4DW2L 1PD6A 1HINL 2FE0A 2R0WL 4OM0L 4A2HA 2HLAA 1QLFA 2B14A 5IB1B 3GQFA 5E70A 4RNRA 1F1DA 3UTSD 2F1VA 3GRWL 3VJ6B 4J3UA 5JLZB 3PABB 4P2OA 4RAHA 2YQ3A 5G3AA 3MQIA 4JRXA 1N64H 4X6DE 5DWUH 3GINA 1H19A 1QRNE 2XACC 5DVPA 4YLBA 1EIBA 2F53D 4FQHB 1A3RL 3BZFB 3BH8B 1NINA 3E7JA 5DR5H 1OAJA 5DJCB 4E0RB 3O11A 1S9YA 2G5RA 4HWZB 3ROLB 5GIRA 1QSEA 4O2CB 4RWYH 1FO0B 3QRLA 1E7VA 1LDPH 2Y6SD 3T77B 4BRVA 5BUAA 5BRZB 4C56E 4XP6H 2F1EA 2XN0A 3MFFA 1UYWL 3ULUL 1ADWA 3HE7D 5IJCC 2A0LC 1SN0A 3MUZ1 1JFQL 1UOWA 4A55A 5JUEL 5L4IA 4OVVA 1ZHNA 5F72S 4NRYB 3U0PA 5T1LD 3CFQA 4YXLH 1KXTA 1G5AA 4ODSL 2UY7B 4M5YH 2FUTA 1IFHH 1ZSDA 3APNA 2YMXH 3FQNB 3UAFA 1INQB 4HFWA 3T0EB 3TH2T 1BJ8A 4ZPVB 4DGIH 1HQ4A 3FQUA 4QHNB 3ZTJG 3LYRA 5AWNH 1OF0A 2F5AH 4J12A 2IADB 3OM3B 1OALA 5AW4B 4LEOA 4PWKA 1UD3A 1IQDA 4ERSH 1MFBH 1KJ2L 1QRND 1JZGA 4RIRA 5E8NB 1I85C 5BVJB 1SDDA 1T03H 4ELME 4O4XA 3EGDB 3D4ZA 1PSKL 1MCOL 5E8EB 2DMCA 4R8WL 2CBPA 4HQQH 1KCSL 3N9GL 3ALPA 4BFKA 3BO8A 1AZVA 5KVGH 3RGVB 3ZPDA 4IIQA 1A8JH 1UJ3C 3RWGB 3NIFF 1KLGA 3DROA 1ZD6A 4U6TA 2BIPA 3B83A 1BQHG 4WU7A 1RXLA 3KJ6L 3Q1SH 1P1ZB 1H6FA 2R1XB 1YMHB 3RFZB 1NL0H 4Y2DD 4ZFOL 5PRNA 1NGWA 2H9GB 3K5SA 3U0TB 1OGSA 1X7TA 5FW6A 4PB0L 4CW1A 5EF3A 2VQTA 3U4BL 1OF2B 3CVHL 1UVQA 3APMA 5L8JB 4UQ3A 4KZDL 3OKEA 4OGAC 3EJJX 5DRZB 4ZTEA 4B95C 1XHHA 2FX8L 2GTZB 4GFTB 4FA8A 4YFDB 4FFZL 4Y4KA 1XGZA 2WUCL 4KRLB 1AVAA 2UXGA 4GAGH 2DJSA 3DJSA 1EZLA 3W2DL 1J87A 3B8YA 4XVOA 4I18C 3SKNA 5CHNB 4QNPF 1NGXB 1CJYA 3B9VA 3REWB 4PV9A 1PQZB 3QCTL 5D6DC 2DOCA 2J88L 2TRHA 2PTTB 2AK1L 2AXFB 3ZRSA 1WF5A 3J2PA 3TIDA 4RZCA 1GC1L 2VH5H 2P48B 5HI3D 4PCSA 3LKQB 1KZYA 1IT9H 5C0JA 5LDSA 3MRLA 1HEZB 4X6DF 2APWA 3B2UC 1JV5B 2DQCL 3QQXA 1NCDH 4PJIB 1BFTA 1FL3B 1MWAH 5AKRA 3LY6A 4AL8L 3TBSA 3V95A 4LARH 1NLDL 3SDCB 3KPPB 3ABGA 4Z23A 1FE8L 1MFUA 2HLEB 1INDL 3JUZA 5C3TA 5J12B 5BJTA 5IEKB 5JLZA 4PCKA 3S8GB 2NNCA 5HYQA 2QTKA 4L5FE 2XE1A 1FG2A 3CH1B 3V5KA 1MW1A 2EYSB 2ZAGA 1FZKA 25C8L 4TUOB 1JHTB 5IFHH 2OMVA 4XNYH 5I28A 4KKZA 4LCYA 1HOCA 2ENJA 3HJEA 1PG7H 2AMGA 2XY1A 1ZLSH 5A40E 2ZAIA 4X6FB 4IRJA 5ISZB 1S9WB 3T09A 3KDMB 3G6JB 3K4ZA 3LXUX 5T3ZL 1MFCH 1MPFA 3ROLA 5HYFA 4K3EL 3ZE2E 5I1JH 1A14L 3VXRA 3V52L 4B5ZA 1BPVA 4G5ZL 2UZYB 3MBEB 1MKFA 1MWAB 2NW2B 4HMCA 2BS9A 2G75A 2PR4H 1SNRA 2VLME 2X4OA 3SHSA 2EDFA 1TIUA 4J5VA 3LKNA 4EUPB 3BUQA 2CGRH 3K80A 2OAAA 2VLJD 3ML9A 2BIQA 5I8EB 1G1OA 1IBFA 4ZQKB 2FT6A 4HUVA 4MX7A 5LNDA 2GTQA 2J8UF 1KZQA 1WAEA 4X8CA 5IB1A 1DUYB 3U1SL 3DZMA 2EXYD 3POQA 1N9PA 2F15A 2X4PB 3W39A 3VWKA 4RSVA 5D5DA 1YY9C 3FXIC 4FTVB 3RBHA 1A4BA 2A74B 2OMWA 2V17H 5FO9B 3CMOH 5FC9A 2Z31D 1MNUL 4B50A 1R5VA 1SDDB 4CDGC 2V5TA 5KYXB 1QR4A 3HAEG 3WDIA 4AXWA 3KCWA 3HB3C 3QJHA 1SUHA 4U1SB 1URLA 3T3PB 4D64A 2X4NB 1CGVA 3EHBC 1SXBA 4M7JL 4XCYA 2CJUL 4KOBA 1KIQB 3UX9B 1TQVA 1N59A 4XP9H 1T5XB 2XC8A 3CDCA 3GT6A 3WEXB 4E5XA 3CXHJ 3O11B 3JYCA 2CDFB 2J6EL 4NB7A 4Y16C 2H1XA 3AXLA 3TPUB 2NSXA 5C0GA 2DLTA 3NDYE 3MNZA 4LEXH 4XN9A 3D30A 4WTXA 3SDXF 1JCKA 4WI3A 2FHFA 3QPQD 3JZ7A 3AA6A 2JI1A 4KJPD 1NPJA 1MCWW 1V7MH 2C8NA 2WCPA 1ONQB 3EYUL 4KKBC 5F96H 2EDQA 1E40A 1L9QA 2B4CC 4WU5B 1QBML 4PS3A 2W8CA 5ITBL 3EH4B 3BYTA 4ZMTA 4ORGA 5CF3A 3U9UA 1ZGLM 2RALA 5E79O 1TVHB 5JR1L 1XTMA 1UATA 3BN9D 2ZIDA 4FE9A 5GZOC 4MWFA 2ZUQB 5LB1A 4PY7B 4AM0A 4TOYH 1TJGH 2NX5B 3PFQA 1N6UA 1KT2A 5B7EA 2VN3A 4G6JL 2QQQA 4LASL 3QO0B 3VFUB 3HBGA 5CGYD 5AVSB 2KS0A 2X9KA 3HRZB 5CEZH 2HB0A 3MRDA 4L3EA 4JDVA 3VFSA 3KXFD 1LO3H 1VCBC 4RSYA 4YBLC 3HN3A 1R3KA 1NANH 3DPBB 3HG1D 5K9OA 1MJUH 1E3ZA 4D8PA 2LU7A 4JREB 3TPKA 1XIWC 2ESVA 1THQA 2OYMA 4BZ1L 2NY4C 1WS8A 5E1QA 2XTJD 2E6PA 4AKRB 3KYAA 2B1HL 1QUPA 3HMXH 2X6VA 4GIOA 4TSCH 1PEWA 5HDQH 2J12B 3M6DA 5HYQB 4X4YB 4GNKB 3D39A 3QZWG 2C3XA 3V5DB 3D18B 3LIUA 5DJ8A 3C5JB 3FH7A 3V52H 4CUCA 1PKQA 2F1TA 2CIKB 1OAKL 1G6RB 1T1YA 1UM5H 3WSQL 5GSVA 1GZPA 1M6OA 2Z8WC 5J12C 2QPUA 4OW6A 3FT2B 3X11B 3AABA 5I1HH 4CKQA 1JDCA 2G4GA 5EO0B 2OI9B 3H0TB 5LUMA 2ZOKB 1CTOA 4WTWA 1BFOA 3NGBB 3EDFA 4P2RD 1KY7A 2JXMA 1L9OA 4RQQB 1AHMA 2AXFA 3TFKC 3KLHC 4AQ1C 4MA7L 1EEZA 3U1SH 2X4OB 3HNVH 4TULL 4XVUC 4FCHA 3UJIL 1NLDH 4F91B 4GSDH 1EUUA 4OCXH 1HHJB 1ECZA 4P07A 3P40A 1JHKH 2J25A 3OKLB 1ZIBA 3P2TA 5B1JA 3MBEC 3SPCA 3V9EA 1R3HA 3GSNA 1I75A 4O00A 5BS0D 1QYGL 5C0BB 1KCWA 4BIKA 4OJCA 4UV4H 1F56A 4JCWA 4F1SA 3VD2A 2VLKA 3V0WH 1V3KA 1NQBA 2QPFA 2BP3A 2X6UA 4D9LL 2OMVB 5KYWA 5DYOB 4X50A 1UENA 2HAZA 3TH3T 4M8VA 2YMTA 1H9DA 4OZIB 1M42A 4CC4C 3RILA 4RFEA 5AENA 2UZPA 1M53A 1RUAH 4IOIA 1ET5A 2W60B 5C0GB 3CSYA 4JM2B 1UCBL 2JJUA 4G1EB 1Z5LA 1QBMH 2DLHA 2EIZA 4P0DA 1N19A 4QHMA 4LVOB 2J56A 3SE8L 4PVBA 3BOVA 1FVDB 2P1YA 2B59A 1S5HA 3H2PA 4OCYL 3WI4A 3W0WE 5HYIA 1JXJA 2E86A 2Z6FA 2Z9TA 3LB6C 3MACL 4JM2D 4XPBH 3BDBA 5JIPA 3NPSB 3ARQA 3U9WA 2ZUWA 3ZHDA 1WT5C 4PGBA 4WU5A 3T4AC 3TA3C 2QPDB 1TTBA 5EC1A 3QO1A 1F4HA 2RD0A 3FSAA 3LPFA 4IKNA 5FYLD 3VM5A 4L3CB 5DJ6B 5AB9A 2EH7L 4MKMA 4I3RH 4X4KA 4N2OA 3H9SE 2XN9A 1CURA 4K2UL 5FYJE 5JIQA 4AV0A 4Y5XC 1ZMYA 1QNIA 4MNHB 3FT1A 4DK5A 4OLVL 5FUOH 5CJ5A 2IALA 3GXUB 1J7VR 4PJ8B 4RRPM 2VDMB 5DJAB 3Q9QA 3W9DB 4LCIH 3BAXA 4WJ5A 3NJTA 5DQ9B 1GGYA 3BKML 5MP6H 2XOTA 4TSCL 1N59B 1M56B 1R3KB 3QCUL 1FIEA 1A5FL 3DVNA 3MX0A 3K0WA 4P8QA 4KKRA 3GZKA 1IZNB 2E6QA 4PS8A 1M1XB 1VFAA 4UBDC 7TAAA 4CGUB 1KPUB 3FS9A 5DEGB 3NIGE 2VLJA 1OK8A 1UACH 2ZG3A 4NIYE 4ONFL 2XWZA 3H4HA 3F58H 2X7LA 4RBPK 3P4OB 5F2FA 1DE4B 3U30B 1YNTF 4N4YB 4N22A 3U4AA 1F00I 3VM7A 1GZHC 1RIUL 2EXSA 5J9PA 1FFNB 3CVIL 1LO0H 2B20A 5FV2A 5DO2D 4GG8B 1KFAH 3C5JA 4U1LB 1IM3D 1G6VK 3O2DL 4WV1C 1D7BA 3NAAL 1G6RH 4OQTH 1H3WM 5E9DB 1TPXB 4NC2B 4NFDA 3AB0B 3ZHNA 2W9DH 3QIBB 2EECA 2C7UA 5K9JH 4AM0Q 1JHLL 4APXA 4FOMA 4NDMA 1G7QA 4X99B 4CBPA 5I30L 1FNEB 1HZHL 2P80A 3TYGH 1GGIL 2EDDA 4U31A 1IX2A 4XNQA 4L8SB 2OMFA 2C9VA 3F12A 4KQ3L 3BT2H 2UY6B 3T3MB 3ZE0B 4DUVA 4F7CA 4PRID 1N2RB 3RVWD 3X1NA 4H8UA 2BNUB 1CQYA 5HYJA 1U8KA 1OTTC 3HRZA 5B4MC 1HX0A 3D4GA 3W57A 1R47A 2PYFB 5T1JA 1K8IB 4B6ZA 3BI9X 1BEYL 1HL8A 2CRZA 35C8H 4Q6IA 3E3QC 4MJID 1SJHB 1ERNA 4XMVA 5GS1A 3PS6A 3QUXB 1VKXB 1DSFH 2ZWZA 5L2KB 4W9DC 3RY6C 1SN5A 1P4BL 3O4LE 4JPKL 2HFGL 1SJEA 3VFWB 4TXVB 3FQ4A 4NZRL 3TASA 1LD9B 4Y1AE 1I3GL 3UERA 1EO8L 4B9IA 2PYEB 4KRAA 2R1YB 4LBAA 1RURL 4U6HA 3T08A 4NO3A 1OWWA 4UCFA 2GIMA 4ZMWA 3VD5A 3SYSA 2BSTB 4QOKA 5I2IB 1IGFL 1J1PH 3IS1X 1DJXA 2BVQB 2VUOA 4ELMB 1KENL 2XPGB 4PM1A 4Y8AA 2FGZA 1FC2D 3QQDA 2YUZA 3WFEL 1ZDQA 2CHNA 3GTVA 1A2YB 1P5UB 3DX9B 3FRUA 3QQ3A 4XXWC 3C75A 3TFBA 4IBWA 1P69B 3IN2A 5LWYH 3GTTA 3LVTA 4F57H 1OO2A 3O2VH 1IJ9A 2GCYB 4EI5D 1SEBA 4PTTB 3NSXA 4EVNB 5GISL 2Q7YB 4AZ8B 2GJRA 1VAHA 4FQQA 2XY2A 4DKEL 4FP8H 4XMWA 5DVLA 3RIAF 2WHVA 3BP5B 5B1JC 3C5ZC 1DUZB 4ELKA 1MH5B 3WMSA 2KKQA 4LLMB 1XIWD 4XPFL 3L8QA 4ZYKB 1KYAA 3ECBA 2X70A 1GJWA 2HH0H 2XBTA 2WWMC 4ETQB 1Y07A 2NSMA 4QOKE 2IQAB 3GSNB 4F4BA 1LWHA 1Y6KR 2W0KA 1HKLH 4FRXA 4TNFA 5E6IB 2V2WB 5F1SA 3RTQB 3UZVA 5I5MA 5I24A 1OE3A 4N25A 1ZV2A 1JI1A 1F3JA 2OQJB 4LT7A 3ENEA 2QBWA 4KK5C 2LGNA 3O4LA 5IVXA 1RJCA 4GMTH 4NQEB 5EZLA 1AP2A 4NZFA 1KV3A 2D0HA 1C12A 3GSXA 4HPYL 5HY9A 3P2DA 1DQDH 2WWOA 1HL4A 3ABMB 1CDIA 3QUXD 4G9FB 4HC1H 4PJAA 5FCUH 3CK0H 1CR9H 1KPRB 2W1NA 4U4BA 3VFNB 4KX9A 3WFDL 3MBXH 2JELH 5LKNA 1BOGA 5ISZE 3QNXA 2WYHA 1SFHA 3CZFB 1UKTA 4HAFA 4NENB 2ZWLT 1ZT4A 5ADXK 3QUMA 3SY0A 3QJRB 1IU1A 2E3VA 3PNWA 3VVWA 4I5BB 2YD0A 4NAMA 1CO1A 1LVEA 1XF1A 1KY6A 1VESA 2BNRA 3QRFM 4M5TA 2HVJA 3RA7H 3FU7B 1A1MA 3CV5A 5J9PB 2FQGA 3B2VL 3H85A 3LSOB 2E4TA 2J57A 4HCFA 3O3EB 5AOMA 1WQVT 1VEPA 3IN0A 5AW2B 5FX3A 4EI6A 1AR1B 2YA2A 3VD0A 1EZVX 1XGPA 4HS6A 5KYUB 3V0HA 1WAAA 3CIQA 2WLIA 4LKXB 1RZQA 1AI1L 3NJFA 3MNVA 4J3WA 4K7PY 4XNUL 4AEHL 2J8OA 2MSPA 4QF1A 3NZHL 3RDTC 3RZWA 2F8IA 1TCRB 3EH5B 3NJXA 3OR6A 5KN5A 5KBPA 3VMPA 4W6WB 3P4NB 5DK3A 3U9PL 2AJSH 2Y2WA 1PLCA 2BNUA 5IHHA 1JYVA 1DBAH 3PREA 1GFOA 1NCWH 3C60C 3WEMA 2AJ3B 4HJJL 4ZT1A 3UU2A 2GE4A 1X5AA 3UTSA 3HG4A 1EGJL 3WFBH 2E7HA 1FNGA 3DVNB 2LOEA 1XMEB 1Z3RA 4A7QA 3FO0H 2XE3A 3SBPA 1RV6X 2NR6D 1M1XA 1VFAB 4HK3J 1X9QA 4GW1A 4XBPB 3LNHA 2FQFA 4JFVA 1OEZW 2DWDA 4Y9CA 5HDWA 3HW7A 1HXYB 3SGKA 4JKPH 2VABA 4KNSA 4FEMA 2YK1H 3AQDA 3KG5A 5E2JA 4BH8A 4G3YH 3V0JA 2UXTA 4BSWA 2E75C 2YGOA 4MS8C 2OMZB 2CGZA 2DJMA 2V5YA 5IVOA 4G8GE 5GGRY 2GJZA 3BVXA 4PRPD 4LESA 4JQIH 5DRWA 5AOIA 3PDOB 5ANMA 4HUXA 2YRBA 4R7DA 4QXUL 2UWEA 1ADQL 4ILDA 2E7BA 2XZCL 1F2QA 2VLKE 1OTTD 3KPRB 3LV3A 1NUNB 2GJJA 2NOYA 1G9ML 1B2YA 4M4RB 2V9UA 4P46D 4UNTA 3V6ZA 4AMWA 5GZND 5HGHA 3UIZA 5C0NC 3KBHE 5DL5A 2NUTA 1NGPH 3IDMA 3VXPB 2K6ZA 3FUNA 2X42A 4H25B 3RPKA 5D5MB 4PTTA 4E41A 4ZO8A 1RK1A 3GBLA 5EU7E 1Z5HA 1EBPA 3BXNA 3AS2A 3E8UH 4KXZH 4JDEA 3RFZC 1HQRA 2D03H 2Y24A 4XXDB 3LOWA 3WXWH 5C2BH 2Q8BH 4NZUH 5D7KE 4NKIH 4QD2E 4XVJL 4F24A 4JFDD 3QPXL 3V6OC 5JA8B 5LJYH 4LSQL 3EH1A 1BMWA 3GRWA 3VD4A 3IDYB 3JTYA 1MEXH 4PG2A 2A1WL 4Z7OB 4QRPA 4ANUA 5D96B 5LCVA 5AFUK 3KGTA 4NXKA 5TGBA 5ICUA 2RHEA 2WJRA 4UQ2A 4AC4A 2BSSA 2ZCZA 4KXCA 1JTTA 1IGFH 2FRGP 2IADA 5F0JB 4AQ1B 1R5IB 2VJXA 2VXVL 2CE6A 1BLNB 3HHRB 4H20L 4C55A 5I6NA 5KJRL 3T2PA 5C0BD 5IP4A 5IB3A 1RZ8A 2C9UA 2H6UA 4LDOB 3JT2A 4KKAC 4POZD 32C2A 1S3KL 1V7NL 1BVKB 4W9IC 1T1XB 4FNLH 1XL6A 4MD0B 5D2LF 1BP3B 1H8NA 3O9WD 5C9KA 5I6OA 4WUUD 4Y5YA 4NKOA 4BE5A 3FQ2A 1S7QB 4NP4L 3SN6N 3DGGB 4X7DC 1GOFA 4MYWB 1MPAL 1UWXK 4HZ1A 5FK9B 3LZQA 1LEGB 4MLIA 4N3UA 1LQBC 3UL4A 4ZNEE 5EHFA 3CLWA 2P5WB 5JW5B 3RX5A 5HGBB 3TZVA 1QD0A 4P2RB 2R2EA 3QEUB 4TS6A 3ZDZF 4X8XA 3BLKA 1TFPA 2FNWA 4YDIH 1P5VB 1BBDH 5BRZD 1KJVA 1URIA 2C1PA 5D7IB 2W0PA 2E27H 1O6SA 4WVRA 4GKSA 3FUMA 1NC2A 2LAAA 1BM3H 3DRTB 3VAEA 3T0EC 3QIUD 4ZFOB 3GMRA 3FCGA 3U7WH 3BE1H 5D7LE 3ZL4H 2YSSA 3QULB 5K9KA 5HPOA 2FX8H 3MLVL 5J0BA 2A77L 5HHMB 3MOBH 1NUFA 2DDQH 4S1DD 1T89C 4LAJH 4Z6AT 1N26A 2V3DA 5K1JA 1UOKA 3S88L 3QUHA 4L4TA 1MAKA 2Q5BA 3A6BH 3GI9H 5CWSA 2M8XA 5DFVC 4HHAA 4Q4IA 4N9GA 2ITFA 1S7RB 5GGVH 4M48L 2XVBA 4Q2ZA 1KYOJ 5CBAB 1M2VB 2JLPA 1WC7A 2JKRM 3A6OA 1BBJB 5E8PA 5HJ3A 4PJ8C 4YSUA 3BH4A 5AL8A 3MUGB 3EJTA 4NQCB 3TWCL 1N6QL 3QEQA 3P77A 5HHNB 1AXTH 1IT9L 2KHAA 4TNGA 4XMLH 5I74C 5BOJA 3KPOA 4D9RE 1RZKL 1YEHH 3MCLL 4P3WA 3UTZB 3QE5A 4AL8H 2H0EA 4EI6B 4YNYB 2KPNA 1Z66A 1LK2B 1YEGL 2C3VB 2MTPA 2NY7H 3EADA 3UMTA 4HCIA 3V4PL 1JDAA 1KIUA 4J4PA 1MFEH 2GABA 1SOKA 1U91A 2WLIB 3K2UL 4LKXA 3N42F 3U4KA 1D6VH 1IC0A 1CFTA 4OZFB 1L3NA 3JTBA 1NCWL 2WOYA 1DSWA 1TQUA 3GK8H 3QZWA 4IOSD 4DQOH 1CFNA 2QKIB 4FHKA 1KJ3H 3LQAC 1FH2A 4WFEE 5BZZA 4F8OA 1IE4A 1ZLSL 3I85A 3MUY1 1G7PB 4MCYB 3KLDA 4KR8A 3K3QA 3NH7L 5EF0A 1AACA 5EFIA 2YD3A 3GMNB 1RUQH 1TU2B 4JFBA 4YSOA 5G38A 3IWUA 5G4NA 3BFOA 3ZKMD 4QRPB 5CZXC 2DF3A 3UBXG 4G8FB 3V79C 5FWRA 5D4IA 1JZEA 5EF1A 3TN0A 4UQEA 3GBEA 3IETB 5F1IA 3VWKB 1VEMA 4NN5C 1U58A 4R7VA 4AQ8A 2R7EA 1MG3C 5DJ0B 5IB2A 3EYFA 5JW4N 3ARBD 3JTTA 4S2SB 4PCYA 1ID2A 2CKBL 1BVNT 3OL2A 2ICWB 3ZHFA 1BZQK 4XCCL 2ZX9A 2WTRA 5HHOB 3S9DB 2BS8A 4AWJC 5IMLA 1BVKA 5D6DA 1WUNT 4GQ9L 4HJ1A 1P0SE 2E56A 3GPSA 4HIEB 4JZNB 3A24A 4GXFA 4FFWD 1PDKA 2FYVA 5EDXA 1ZLWK 3PABA 1QI5A 3GZQA 1CBVH 3PWVA 5T1KD 3S2CA 1RK1B 3DHJA 1TTAA 2GVYA 1B4RA 1BJMA 4IGBB 4MNQD 5MERA 4PJEF 3FB5B 3BUIA 3PXLA 4HWBH 4J2QA 3FTYA 2J6EH 4JMNA 3FFDA 2B2XL 1SXAA 3GM8A 5B22A 2BVOA 3OAUH 3PWPB 4GKOA 4E1TA 1RZJC 3EG9B 2AQ1A 5F7AA 3SDXA 4F80A 3MHZA 1E4KC 1SYVA 2XKUA 1G1YA 3OAYH 4FFVC 1DJWA 2X9XA 1S9YB 3KW7A 2FEJA 4GKSB 4HWZA 4FA6A 5BNXD 5FA4B 4A2LA 3N06B 2KXPA 5AOZA 1GRWA 5E2TL 4A6YL 4R9HA 3GBML 3RPIB 3VD7A 5K39A 3ZUNC 2W95A 4E9QA 3NFNB 4FNLL 1MFDH 3NP3A 1XB8A 3INUH 3AT0A 4JKMA 3IGAA 5EU7C 1U92B 1D5IH 4PGCB 5EEZA 1E5CA 2YHGA 3IFPB 4DN4L 5DEJA 4F8NA 5DFWH 1G7IB 2VLRB 4HKZA 3UTQA 5JIMA 2OMTB 4GXUM 4NUMA 4ZMZA 2VZ3A 4DVBA 1Q9LB 3ESMA 3OKNA 3LRGA 4G7SB 3IJHB 3RG1C 3WS3B 2ADGA 2BP8B 3KPSA 1T0PB 3DX0A 3TWYA 2BSBA 1RPUA 4UI2A 4LOUC 3C6SA 1OCWH 3EDEA 5IHUL 4AKRA 2XIBA 2HVKB 4ZO6A 3H7BA 4XMZA 4KNUA 5KVEH 3COOA 4CL7A 1HXUA 1M7IA 1DLFH 4PJXA 3KWWB 3VMNA 5IMKB 4WK0B 2ARWA 4GBXD 5FM8A 4J6RL 4KO7A 4W70A 3OQ3B 4D3CL 3HR5B 1HCYA 2VDQB 3SKOB 4Y88A 3QAQA 4QKTA 3LZLA 3NCYP 2C1PB 4BZ1H 3Q8AA 1KJ3L 1U2YA 2AGJH 1LK2A 2PW1B 3CXFA 2O5YL 3OKDA 2QDVA 2J4WH 1K2DB 1N64L 4P4KC 2M83A 5HDBB 1P4LB 3UBFA 2OMBA 2XJLA 1AY1H 1CICD 5AB0A 4F7TA 4QXVA 4X9YA 2V5MA 1FORL 1L5GA 3CSBA 4PYGA 5FUZL 3KM1A 4JEGB 4TMPA 3ZL1A 1O5DT 3VTAA 3U79A 1BZ9B 1RP9A 2IWGA 2VMCA 5AALA 5IGXH 4WFHD 3JWDH 1E9PA 4OT1L 3LKRA 2UZIH 1DVXA 5JYMA 5E1HB 1SYSA 4P57A 4Y7OC 4A7SA 4PD4J 1ASOA 2F1AA 3UC0L 2ZYIA 4WUUA 5IHWA 4IRJC 4MJ2A 4KMQA 3ZGIA 1LNUB 1U3YA 1RZIA 1RZKH 4ZS6D 3WJJA 2YPVL 4AJ0A 2BY3A 4Z7WE 4TULH 1D5ZA 4FRWA 5EZJB 3Q06A 5DSCA 4PJ7F 5AAPA 4HJ0C 4WK2B 4ZX3A 3KPOB 4DN3L 4X5XB 2AEWA 1MCRA 2CO7A 1FAKT 4A68A 1I1AD 1S9XA 3WU1A 2DICA 3QR0A 2AJXH 4HJGB 1JNLL 4AE0A 4C4KO 4QXTA 1GTFA 2K9FB 2Z0UA 5KVFL 2J1ZA 1Q94B 5DUPL 1GGBL 1TJIL 5KJ4A 3T0ED 4O51B 4QHKI 1FA4A 4AYEC 1KIPB 1DANU 2WLJA 2Z7YA 3QUXC 2R4RL 3N9GH 4PW4A 2RCSH 4LFHD 3IVKA 2GJ6D 2QR0B 2R0KL 5E2VL 2HT2C 3WMQA 5DMYA 3MGOB 1DQJB 5IQ9A 1NCIA 4QHLB 4WWNA 3RUGB 2EE6A 2PLTA 5D9SB 3FB5A 5JO5B 3DVFA 5E08L 3EYVB 4O2FA 5EA0L 4RETB 4J8RB 4G1MA 5E5LA 4LPYA 4YPGB 5BO1H 2OCFD 4LQFL 2LE9A 2MQGA 4YHMH 2JQMA 3EO0B 2GUOA 3LXAA 4RAUB 4IRJB 4WWOA 3MV9D 5CJXC 1I9RH 5DK2B 3U46B 3QFGA 4PRPA 4WV1B 2XN9B 4JZJA 5IMOB 2FBJL 4BQ9A 2V2TB 3HA0A 3MACH 2BVYA 3M1CA 3DOSB 1U8CB 5EEVA 1AGBA 2UZXA 2DD8H 1HL5A 5FV1L 3QFJD 4GG6A 2DIAA 4PJFA 3BD4A 2ZP9A 1JWUA 2AQ3A 5E94B 2VLMD 2X09A 4HMDA 4M5ZL 1T7YA 1R46A 3CUPA 4CGTA 5L8KB 1HE8A 3F5WB 3M8OH 5ESVA 4YN3A 4G8IA 4DP7X 1T0MA 5IJVA 1UFGA 5FO9A 1MCBA 4JFFB 4RLCA 3SQOL 4JPQA 4AXWB 3TIEA 4NNYB 3WTWA 5D7SL 2I5YH 1GIGL 3MLZH 3QUZB 1NBCA 2WYIA 2QSCH 5KSAC 5A2BA 1UVQB 2HJFB 5J6SA 1FBIH 1VFBA 3S37X 5F1KC 4OZHA 3D69B 3PF1A 2ZF9A 3HZKB 4PUBL 1KBVA 4UDTA 1JXDA 3RFRA 4AJWA 3PV6B 3I2CH 3F58L 3MREA 4OAWA 1EXUA 4K9EC 5KS9F 4YSRA 2Q20A 4XMPL 2WXFA 1QSVA 4LRNL 2JQZA 1E7UA 4W9ZA 4L9LB 3UROR 5F70A 1A1NB 1NGXA 1FP5A 3BKCL 3HG3A 4FNQA 5SWZD 3TF7C 2JCWA 2V8LA 4TVPD 4HAKA 2YXMA 2B15A 3AA6B 1TLMA 3QQ9C 1MFAL 3WN5B 2DKSA 4ADJA 5I1JL 4NQSA 2YPVH 7PRNA 5T3XL 3TNNA 3L5WB 4D9QD 3IE4A 2LAGB 2OMTA 4HJTA 4K8RH 5TF0A 2P7TB 3U36B 4XOEA 3A0BO 3DJZA 3O3DA 3JV0A 1WK0A 3QUXA 1VKXA 1KXQA 3QIWD 3ATEA 3BJ91 3OX8A 5CU5A 3SQBB 3FONB 4NP9A 1NFDF 1VA9A 2ORBH 3RDTB 1GJUA 3SPGA 2NNXA 1G7MB 5HHPA 4C56B 4WRLA 3CZSA 4KMTH 5IJKA 1Q0YL 4OZHF 2VR9A 1PAZA 2GIXA 2HTLC 3SD2A 3AUWB 5JQIB 2X4SA 3NESA 4MMXC 5E2VH 3HZYA 3QXUA 3NFPA 3RX9A 3G5VA 4PV1C 2KDYA 2VQ1A 1YEFL 1ZIAA 3O3AA 2IVFC 2WMPA 3WD5H 3NCXA 5DTFA 4BSVB 4FYRA 4B9ZA 5CNHA 1KF9B 2GCYA 1I7UB 1XSIA 4C8XA 1ADQA 5C0AE 3VI4B 1X5XA 1J88A 4HIHB 3LZRA 4LPTA 1CGSL 4ORZC 4P5KA 3RUGA 1R9FA 1AIZA 1KB9K 2Y06H 4EI5A 1HXMB 5AVQB 2FWSA 1DJZA 3WIFB 4WO4C 3U2SA 2CIIB 3LXCA 2BOLA 4Y0GA 2WZ0A 4RMQA 5LQBH 4QPEA 4ELKB 1N4XH 1J1XH 3MUJA 3WHXA 1T0NA 2R29H 2EC8A 4GLRI 2E47A 1G43A 2IPTH 4M8QA 1QATA 1MF2L 2VDOB 2X70B 3H0TA 1DUYA 3NACH 3PIQB 4GYBA 4IRSB 5EU6D 4PJ5E 1XAUA 4FTVA 2XSKA 1BREA 5E23A 3GJFB 3I9GH 4JK0D 1UZGA 1CK0L 2DEWX 3IJYA 5CLZA 3BQUA 3SDAB 2M26A 3H3BC 3JWNE 1KBWA 4ODVL 1NMAH 1I8IA 2VMFA 3MXWH 2AQTA 3FTGA 2I9TA 3MBWA 2WQXA 2XTSA 1FH5H 1N8ZA 4UOW0 1DQIA 4PJFB 4ELDA 1CMOA 1FCCA 4KMLB 4N2BA 4CSSA 2GC4C 1IARB 1KWKA 2EQDA 2YJQA 4MJIA 4RGNE 3WEXA 3QUYC 3NTCH 3DX6B 1OP4A 1D5MA 3SGDI 5E51A 3L95A 2VIRB 1B88A 2OMUA 1FNHA 4Q56A 3ZBMA 1MI5A 2ADYA 3MGOA 3CBRA 1PX4A 2EABA 4ZNCD 5IQ9B 4G80A 3PNWB 4HH9B 4JDZB 3FUDA 5JHBA 2CLVA 1CE6A 2OXGA 4J8RA 2EAEA 4EQ3A 2E4FA 3D48R 1DFBL 1PFCA 2ZUYA 3DUUA 4FQ1L 2YFOA 5B5EO 1WA2X 5A1AA 4LCVA 4YHPA 4J1UA 5CJQL 1UXMA 2WXMA 3OPZH 4I48B 3S5LG 5C08D 3NEXA 2Z8SA 2BHYA 2AZAA 3FUKA 5E03A 2PYEE 1ETB1 4JM4L 4X6BA 3U2JA 1G7HB 5TK4A 1EFQA 4GEJA 4U6VL 5DURB 4OF0A 1FFQA 2LW3A 2NX5A 1S5HB 2DYSB 1X5YA 4HGWA 2CD0A 3GBDA 2VZVA 1YYMH 4Z18A 1Z3GH 1TEYA 3M8OL 3N85H 3QQ4A 4XGZB 1XSKA 1AS8A 1NEZB 2OSLB 3DPBA 4HW6A 5F0MB 3TYFA 4HD5A 4JPWH 4WEEA 2DPKA 1RHHA 4G8IB 1OQXA 1XGTA 3ILPA 1GFQA 1IAIL 1U2CA 3IDYC 4BK4A 4MQXD 5C07A 5I6MA 4M5SA 4CAGA 2VABB 4GSDL 1U8PB 2XZAL 1EZVY 2V2XB 3N04A 1UB6A 4NNYA 2WB1A 1HXXA 4WEUD 4A37A 3FO0L 4RDQF 2MQ3A 4ICWA 4UQCA 3KYNA 4DVRH 1PZ3A 2H0PA 1KGUA 4PB0H 5J6GB 2YRZA 2BNQA 4IK7A 1LHZA 5C08E 1BX2A 1N6VA 2WYZA 4BD4A 3DECA 1JF1A 5H37H 4TVSa 3WL9A 2IFFH 2OZNA 5CBEB 3ZT7A 3STLB 2ZKYA 5IG7A 5JOFA 5HGAA 1CDHA 4D9LH 3IDMB 2ZJSH 1I82A 1UB5B 3UTTB 4L5FH 2ARJQ 3FQRA 2EXTA 5T3XH 4XP4L 3EFOA 3ULVE 1F4XL 2MCG1 5BRPA 3TBYB 2WSDA 1N0LB 2BERA 2ZYHA 5DJDB 4E9XA 5F7UA 3L5WA 2H6PA 3VWKC 2XXMB 5EOQL 1X5HA 1MJ8L 1MRCL 1W8NA 4Y4KB 3MVSA 1CXFA 4IU3A 4QUOA 1CF1A 4I0PB 4XE5B 3J07A 2IJ0C 1BQRA 3GEWB 3VTTA 5IMMB 3FAXA 4GO8A 5FFGA 3GF8A 4QRBA 3CFUA 1NCGA 4FA7B 1E9QA 2XIIA 1K5WA 4HIXH 4PP1D 2QADD 4Y19E 3GMOB 4HKBA 1MCNA 4UILL 1A4KA 2X0UA 3ESPA 3N1GC 3RTQD 4PJDF 2ENQA 2PYFA 4YSQA 1KXHA 3NFPB 1V10A 2WPGA 3C60D 2WUBH 4YHIA 5AZEL 3DOIA 4NUQA 5DVOA 3KYKL 1LE9B 1KB3A 4YBQC 2FJGA 2IWFA 3FQXA 4JRWA 3DX6A 1KN2H 2IWKA 1QQDA 3M1BB 1S9KC 3ATDA 3QDGB 4LCUB 1ETZA 3GHEL 3LRHA 4C47A 1NCAH 2ADJA 4BFEA 4EPSA 1GAFL 2DBLL 4NNPL 1E3XA 1NKGA 3VI4A 1MI5B 2CM6A 5JHLL 5LQBL 3ARSA 3GSQB 2Y5TB 5E2WH 3LS5L 4QGTA 4TSBH 2XNAA 5KAQG 3HNTH 5DURD 2PMZA 1PGRB 2X2HA 2IAMA 4XZ4A 2E9WA 5TDNA 3VRIA 3L4VA 3FU5A 1FVCA 3C08H 5L88L 3B3IB 2AV7A 3RVUD 3FH8A 3WKPA 4AIEA 2VDMH 2J88H 1U8HA 1RIUH 1DZBA 3FRUB 4FKEA 2V9RA 5EZPA 5LG6A 5I0VA 2XX0A 3ARDB 3HS8A 5G55A 1EO7A 2A6KA 3OGCA 4KK8C 3SPHA 4KKLC 1HH6A 5B8CB 3Q8FA 3O2DA 4YSCA 3GLEA 3LDBC 2HT3C 4MXVE 3GFUA 1BBDL 3RGHA 2XUWA 1SRDA 1MWOA 3GHBH 2NY2C 1C5BH 1QLRA 1TLKA 1GGIH 4D9QE 3HLAA 3I6LD 3PP4H 3BSZA 1IC4H 2WYTA 2FO4A 4JB9H 3TZGA 2D7TH 2DV6A 4OGYL 4WNQA 3U7WL 3Q8BA 3GBNL 4XN7A 3KJ4B 4I1RA 5CWSB 4LDCA 4PLKC 4BYHA 4GKNA 4DVRL 2L7UA 1KPUA 2VN7A 1P6WA 1QZNA 4I4WA 1FLTX 3RTQA 4DO4A 4YWGH 4K15A 4G59C 2Y1AA 2PCPA 2YARA 5BMFL 1GCYA 4OGAD 1FQ9C 3L2NA 4JY5L 5CMAB 4O02B 4AT6B 1CLVA 5HPMB 3N1MC 4PI2A 3ZDYE 5J13B 5TFSL 3SDAD 3QXDB 2YNKA 2B3IA 1QFWI 3CJJA 3B5TA 3WJJC 1T7VA 5IUCA 4XB3A 1JJUA 3H9SB 5DT1L 1PZUB 2EE3A 3WKQA 4AYID 1YUHB 3DARA 3QISA 4FSPA 1U91B 1T7XA 3BP6A 4XMLL 4ZQTA 4XHJD 3UJJL 5L7XH 4CN6A 1ZY9A 2RFXA 2YGQA 5I1EL 3NJNA 1RH8A 2A6IB 2BWQA 3NEEA 1YNLH 4MXWH 2WVSA 4PCTA 4ZUTB 1OT2A 4N8CL 4DQAA 2X88A 3QDMA 3W0WB 1ZLDA 3ZMRA 4GO9A 1PEZA 1C08A 2XDHA 3HMXA 3R0NA 5EULV 4R5VA 4ZBJA 3D12B 1BZ8A 3SDCD 2XV0A 4NQCE 3ZSSA 2OSLA 3B7RL 1T22B 3D0VB 2MEJB 2NY0C 4YX2L 3WBDA 4HK0A 1SJHA 3FPXA 4DKEH 3MJ9A 4ECNA 4Z7UF 3EO9L 3QEGH 3S3PA 3MNVB 3RL2B 3VG9B 2CO6B 4JZOA 3OC8A 3RBGA 4HDIB 3TO4B 1BGXH 1SDYA 4R4NC 3OR6B 2NX5E 3S4SA 3NH7H 2L7JA 3MV9E 2CJUH 3KYKH 3ZDYF 2PYEA 4U6HB 3KBEA 4G72B 3O3BA 3R19A 5EOTB 2VE6A 1MNNA 4GF4A 4JFQB 1YMMD 5HHME 1E27A 3UYRH 1SXZA 3DI2B 3RDTD 4NUPA 1VB9A 3K6FA 1RFDH 4AEIL 5BQDA 3IRCA 3N91A 3EJSA 4PRAA 5BOPA 2ODJA 2DJUA 3QH3B 1J48A