4AYID

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 wild type
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
LADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTFKAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHSAVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayiD02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayiD01
2Y7SA 2KDYA 3KVDD 4O3ZA 5T5FA 3VE1A 4O3XB 4AYDC 2KC0A 2W81C 3HOEA 3VE2A 3PQUA 4AYMC 4O3YA 4AYID 1YS5A 2LFUA 4QQ1A 4O4UA 4Z3TA 3PQSA 4O3WA 4AYEC 2YPVA 3V8UA 3HOLA 4U9CA 3UAQA 2W80C 4O49A 4AYNA 5EE2A 4O4XA
chains in the Genus database with same CATH superfamily
1XTMA 2ERJB 2HKAA 3GRBA 2AAVA 2CXKA 4KNSA 3SSGA 2A74C 3GXIA 4KV5F 2WVVA 5IWLC 1GGIH 2ZXQA 3NIDF 2F54E 2L7QA 1F4YH 2C9VA 3G08B 3LB6D 2GIMA 4LAJH 4AFKA 2MWCA 3PCYA 4I8DA 5CCKH 4FMVA 4I77L 5FDWA 1MQ8A 1Q9WA 2OW6A 5BUPA 4JFTA 2CSPA 5AOJA 2H2PC 1A8ZA 5IVZB 3ARUA 3FU9A 2W0KA 1T1YA 4M5SA 3IE9A 1FJ1A 1VPOH 3ARGB 1YQVH 4XTRD 4KUZL 3APCA 2XOTA 1PX4A 3NZHH 5TPWH 3ULUD 3EGSB 4CN1A 1O9WA 2AXFB 1LO2H 2FCBA 3CLFH 2ZF9A 3Q8FA 5F7AA 3L3KA 3FQYA 5B38B 4AYMC 4J6RH 2Y5TB 3V52H 4R5TA 1SNRA 5KYWB 3IWUA 2XWJB 5DDHB 1U8QB 3BRYA 3GSNA 3O6FD 4AKPA 2Z6FA 4G2AA 4YMPA 2BCKB 2ZWNA 3ZL1A 3AG4B 5M95B 4XBGB 3MX0A 4UT6L 3B9VA 3UP1A 1PW3A 5C8JB 1ZGLP 5JHAA 3WAJA 2O6DA 5DHEA 4A2GA 1S5HB 3D5OF 2H45A 4ZW3A 3MDJA 1BPVA 4RWHA 3CHXA 1JGLH 2HFEA 4QXTB 3ZTJH 4HKZB 3QDME 2NXZB 4UB0H 5DWPA 4WSJA 3HOEA 2YAHA 2VQTA 2F1AA 4AQ1A 3DHUA 5BV7L 1CGUA 1CICC 3U9PL 3EJTA 4RMRA 3SKJL 3F7YA 3QIBB 1WDAA 4OCSL 4LDLB 3ARWA 1MSPA 3UTSE 3MXWL 1HQ4B 3UYRL 5FPIA 1N6VA 4QOKB 2EIZA 3Q3GB 2WMPA 3WNMA 3KG5A 4PR5A 1IC4L 5FW7A 5FUOH 3I3EA 1CDBA 1S2EA 3FQ2A 1JNHA 4KPHL 1ZVNA 5EE2A 3G04B 5BZZA 4DUWA 4P2RD 1OWWA 1AMXA 3MRNB 1T16A 1ZXKA 3ZKSD 3Q0HA 2A6JB 2OM5A 4G8EB 3MV11 3QS2A 1U8PA 4GRLD 1JAEA 4Y16C 5I6MA 2AFNA 4YBHA 1ZHWA 1DVFB 1W8OA 1ZK9A 2AKRA 4X7TA 4DN3L 1UGNA 3CSPA 3K74B 1ZAGA 2MHAB 4JFXA 4P49A 2QSCL 1H3TA 1NKOA 3WHXA 3HAEG 3G7GA 1IV8A 1QP1A 3I6LE 3II3A 4P9HC 2R56L 3JWNE 4D9RE 1R3HB 2VLMD 2VCOA 4TL4A 4F5CE 2DQDH 3PQSA 2D9QB 1D9KB 3A47A 4BGDA 1X7TA 1BFSA 3M1OA 1T6WA 1UASA 3PJNA 4V1DB 1NCCH 2CMRL 3QI9B 5TH2A 3RWGB 1ZIBA 1CTOA 2X27X 3BWUC 3GRGA 1O9ZA 1XH3B 1D7BA 3LN5A 1OAJA 3L16A 4U6VL 2J55A 2J2ZB 3JWDL 4KK8C 1RLBA 3APFA 1PDKB 1Q0XL 4ABWA 5E1AB 4G7SB 3QJHB 1OIOA 5IKCA 2J8HA 5JDSA 3V0FA 1RK0B 4LT7A 3IDYB 3K2KA 3U36B 4R90L 2M83A 1JZGA 3JV4B 1FYTB 1ES0A 4G8GE 3ZRSA 1I9JH 3MA7A 4OZHE 4X5QA 5FYLL 1YPZA 4XMKL 5CF3A 1DJHA 3HWBA 2LQRA 1BZQK 2JWYA 2EIDA 4K73A 4ZXBA 4M62H 4PI2A 3TL5A 4HS8L 3QCTH 4TLKA 3UXFA 4ZPVB 5D7HA 5FLUA 2W5PA 4HGMA 3FFCD 4KVPA 4IU3A 4ZFQA 2B7DT 3BIAX 2FBJH 1OGTB 1YQ2A 5C2BL 1YUHA 5JMRA 4XN1A 4FXTA 3W5NA 1SLVA 3FMGL 3NJMA 4WSGA 4GINA 1OE3A 1IAIM 3BHBA 2PO6A 1W72B 3KJ4C 1I3GL 3RIAF 2YPVA 2H41A 2O72A 5CEZD 25C8L 1KGCD 2R2HB 5DD6B 4H0LC 3OV6A 3IMVA 1UADC 4H5SB 1FG2B 4KNUA 4WCYH 4EZLA 5E5RB 1E5CA 1ANUA 2PXYA 1PBYA 4N2OA 1JMZA 5EZOH 2NY5H 1GYUA 3ABLB 3HG2A 1V55B 4AKMA 5EZPA 3Q43A 4OF7A 4N0FA 4GQ9L 4Y5YC 5B21A 2JIXB 3LOWA 4UB8O 2WVSA 4NUGH 2Y07H 4WGVB 4Y19E 1BBJB 4PJFE 1LK2B 1NUGA 4LLVA 1O6SB 3OR6B 43C9B 5JXAH 1QFPA 2N7BA 2OP4H 2FJHA 2FJGA 3GZKA 3EYQC 1F56A 1MFUA 5KS9A 1F6AB 3AWGA 3EJSA 4XCFL 4EN3B 2LAGB 1ZT7B 3NVQA 5SV3A 4FRTA 2BOLA 2Y1ZA 4GOSA 3ZY7A 1S7TB 1Q8MA 5D7IF 5DZLA 4O2EA 4NQDE 3MBEC 1MVYA 3ARZA 3RVTC 2JKWA 4G6JH 5CIPA 5IFJB 4XI5C 2DIBA 4AUIA 3OF6D 5E8OA 1SOXA 3UEQA 1UXSA 1V3LA 4OCYH 4IKJA 2WZAA 5TGBB 3H0TA 4HWBA 4X2UA 5F70A 1GFPA 4FNSA 4ODXA 3K80A 4A66A 1ZLUH 4WNJA 3V4PL 1H6S1 3OM3B 4AYSA 3VXSB 3MLRH 4PJ5D 2H1PH 3VRLE 5I17B 2GAZB 2ICWA 3RGVA 3OZKA 3RFRA 3VE2A 1LD9B 2UZIL 3QORD 5EBWA 1IMHC 3GIVB 3X3FL 4P23A 1KC5L 3PXLA 3MA9H 4FXKC 3UJJH 3ZL4H 5BS0E 1E9PA 4WHTA 1UOWA 5FKAB 3CD4A 1FL3A 5TJWK 3QIWD 2X6BA 4MJJA 4RAVB 4L8BB 1U3HD 4M61B 3GZPA 3LQZB 2LGNA 3V5KB 2BSTB 3RE0A 2QADC 3OZ9H 3B2UC 2VN3A 1A5FL 2GSMB 3RPBA 4Y4FC 5CU5A 3EKCA 1JWMB 1FYHB 3FTYA 1EGJH 4ELMA 3EF7A 1T1ZA 2BC4A 3Q1SH 4XP9L 43CAA 5EO0B 1MHCB 2ZYIA 5IB3B 1NGWB 1MXDA 4DTGL 1WTGT 1K72A 5GJTL 1Q90A 1KCBA 3BEWB 1HYSD 1L9SA 3D2UB 3L5IA 5BW7C 4E9SA 2DQHH 4LSSL 1DEEA 2V2WA 1ZLWH 1XD0A 3WKML 5E8DL 2XV6B 1IC0A 2Y6SC 2Q0ZX 3QWRA 5C07E 1PLCA 2D4FA 4DGIH 4EKXA 3IVKB 3GI9H 4MCYB 2F74A 4N9OB 2MNJB 2JCCA 3P9LA 3EFOA 1Q1JL 4CBPA 4QGTA 1FFPB 2PN5A 2XXCB 1E5YA 3C5ZD 3NACL 4J8RA 2YA0A 3LIZA 4B9JA 4LLWA 2B14A 1EUTA 1XSIA 4ETQB 4FL4C 2NY4B 5FCUH 4R83A 4K5LA 3VB9A 1FPTH 1YEEL 1MCIA 2D8KA 5FA3A 2ZPKL 5C6TH 3QRBA 1P5VA 5F7FA 5AKSA 1IGTB 1G94A 2VW6A 3LS4L 4YHIB 1HQRA 1VFBB 3NZUA 3VFSB 4AYEC 4L8SA 5JUEH 4FQXA 1GMIA 2BRQA 5CBAA 1G7IA 1WEJL 4HOXA 1QFWM 4KXZH 1U6AL 1XF5A 1MRCH 1F6LL 1UM4L 2D9CA 3NPZB 1C5CL 3TX4A 4BM7A 4RMUA 1NDMB 4DP5X 1FI8C 2K6ZA 3GSRA 2NYKA 4NB7A 3LN4A 1WC7A 3ARDA 3BUIA 3SDDD 2G9KA 3VD4A 4E1SA 5HBBA 4XOEA 4YOKA 1GFMA 4L9LB 4MWFB 4F8PA 1WRFA 2JKIS 5GTIO 5AW0B 2IFFL 1P5UC 1XF3B 3W11C 2R23B 2GHWB 3IFOA 2HWZH 3QYCA 3OJMB 2HRPH 4G6FB 1OAZL 5EC2A 3ELQA 2YQGA 2D0FA 3OKNB 4N8VA 2WTRB 1INEH 2C9UA 2NY5C 4TQPA 5CINL 1DUZB 1E4KC 5KW9H 4PBVC 2NUTA 2P5WE 1S3RA 3TIDB 4PLJD 3QNZA 4QTIL 2MCPH 4JG0H 4ODHH 2NY0D 1HCYA 2BERA 3DSFL 3L3GA 4QTHA 3UDWA 4OLEA 5J6HA 1MCLA 2JLLA 2Z93B 1H3PL 3LJ3A 4QRRA 3W1ZA 2XN2A 4MAYC 1KCUH 2HA1A 4CBZA 4E2OA 2VAJA 2XFXA 1TMQA 4LESA 4PJEB 4XHJD 2Z8WC 4ONHA 4WHDA 3SY0B 3UTSA 3OAYH 4E9VA 3HZKA 4LCVA 3IAQA 4LNRA 5JW5A 3BWSA 2QR0B 2DS4A 4M93C 3REWB 4NO0B 4M48L 2DJ4A 5ESVB 1ICTA 3VG9C 3I6KA 1EJOH 4NCDA 3MRKB 3LS5L 3ZLQC 4LVNB 3IGUA 3SO5A 1IM9A 2I27N 2QQQA 4AVKA 4NC2B 1NMBH 2FDBP 4QY8A 2DLFH 2IXQB 4ZUWA 2ZOWA 1SDDA 3U9WA 1ZHYA 1UURA 4LO9A 2DDQL 1KLFB 1DQQB 2R1YA 3DV4B 5CCGE 1SDAB 2H26B 3ATBA 3KL3A 1YO4A 3AY4C 2RTTA 1HSAB 3LH9A 4XNQB 2F5BH 1IZKA 4XX1E 3GXNA 2CJUL 2R0WL 4RGOL 3QXAA 2I7OA 4AKQA 1MF2H 2WUBH 2YQ3A 1QO3B 1UQSA 3VTMA 4RGND 3GBML 5HVGB 2VR9A 1R6VA 4MD0A 3DETC 4IBVA 1PSKH 2Z3FA 4W93A 5F7YC 2Q3XA 1CDHA 4GXUN 5C7ZA 4UQDA 4QXUH 3OWEA 1F00I 2OXGB 3B43A 3TTYA 2ZUXA 3CBRA 4KY1H 2TAAA 5DMYA 5EZJA 4OY9A 5E6ID 2WWMD 4R5XA 5DK0A 1AMYA 1F8TL 2F6AA 3QQDB 3TZGA 2X42A 4Q9RL 1BFOB 1VDGA 1SN0A 3D25A 2GK0A 4JHBA 5K93A 4Q6IB 2VDOH 4KK9C 1JDAA 4I2XE 3FU3A 4P0DA 3CC5A 5AAMC 2Q2LA 4J3WA 1MHPH 4K5NA 3ARBD 2ZOLB 2J5LC 4HMEA 4PW3A 4X42A 4Y1TA 5KVDL 1JFQL 2FYYA 3HAEB 5K5YA 5G4NA 3RKDD 1L5GB 1EPFA 1OZUA 4Z3TA 1GS8A 4DT2A 3CVHL 4GIOA 4UTBH 2C3VA 2CKBB 3BI9X 1A6WL 1M1XB 5DO8A 4ZOEA 1Y07A 5GGRY 5GIRB 5I75C 1RK7A 4O02L 1PMYA 3WGVB 1T80A 2VMJA 4CMMA 3MRQA 1QSEB 5C0GA 2HMID 4HWNA 3O2VL 3TA3A 4KTGA 1GC1L 4MX7A 1F45A 3DWNA 3T8XB 5T1KD 5C0CB 2H3NB 5D1ZC 2OK0L 3FQNA 3ISWA 1KBVA 4POYA 3G6JB 1DLFL 1DJZA 5FA4A 1PEWA 1T4WA 1J9CT 4IBUA 1AKJD 4Y19A 4DP9X 4N2CA 3OAUL 4XNZC 3OKEA 4NQCB 4W68A 4BKLB 4GRWH 1HI6A 4ZOBA 4LSVH 5IGXL 4X4KA 1XCQB 2Q5BA 3WKYA 5KYUA 4P4RB 2WKGA 3IS0X 3SKUD 4LEBA 3DUSA 5CGBA 1I82A 3H8NA 3RZCC 4UDTA 2F7OA 3GJFK 3ZOAA 3CFJA 1ORQA 2Z92A 4ANUA 3KBHE 1ZHBA 1DBJL 4NQDA 1BF2A 5CO1A 2VC2B 1KEGH 4AUJA 1OCRB 3BUBA 3H9HB 4UM8A 2XE1A 4MDJB 2FUQA 2H0PA 2P7TA 2K6WA 3MRLB 3WFCL 1EQWA 2L8AA 1ZT1B 3TVMA 5C71A 3I6SA 1QRNB 4BUMX 1U21A 3M6DA 4LCYB 1G9EA 4FULA 4P5TD 4X6FA 1H3WM 4Q2ZB 3DOSA 1Z5HA 4AI7A 5JZ7C 1BD2E 3IMSA 4XC3L 2EH7H 3ZSTA 5AW5B 2IG2H 3MUJA 4JLRB 3ZKND 5A1AA 1DQMH 3VRJA 3BH4A 3RIFK 3MRIA 2BIIA 4JQIH 2BNRE 4KFMA 4KKQA 2B1AL 3ZKMD 2VDML 4WUUB 2AEOA 3DX7B 2P26A 1PD0A 1BFTA 2VDRL 3MACH 1ZLDA 3PHOB 4YHLH 4ZSOB 2ZX9A 5JYMA 1GGYA 3LQAL 4DESA 1S9XB 1WBZA 1WIOA 2XTJC 2X38A 1T4KA 3KPRE 1KV3A 5EG6C 4Z7NB 5GSRB 2ROYA 3NCFB 4M6ML 4OGQC 3RJQB 3V0VA 2F53B 5JIMA 1IAMA 3VA6A 4TOYH 4PS7A 4P2OB 2Y06H 2H32H 4G1MB 3W0WB 4NPYB 1LWHA 3ARFB 1DFBL 3ISYA 3OB0H 5I1JH 4MKMA 1WICA 3NPSC 4TSAL 2JJSC 1KJ3H 4ANXA 1RAMA 1VJSA 3JTSB 2PNDA 1N6UA 3HB3B 3CCHB 4FS0A 5LGJA 4YDKH 3PIQA 2Z4QB 2MTPA 3FQXA 2GJ6D 3C6LA 5D1XD 5CBEA 4JVWA 1L9MA 5EHFA 3H3PL 1FV1B 3EJJX 3IBOA 4AG4H 2OZ4H 3ZE1F 1HIMH 1DBML 4QHPA 2GCYA 3QEGL 4NDMB 5C07A 4N2HA 1WSST 2FQDA 2AJ3A 3FOLB 2B77A 5SWQA 3SZKC 4LLMB 3BAIA 2VLJD 4YHYB 4ZMWA 4LB8A 4LZKA 1IZNA 1E50A 1SJVA 2WXKA 3APNA 4LVHC 2KMWA 4O4YH 4AW4A 4R7DB 3NZ8B 3RFZC 3DX6A 4MQ7A 2DL9A 2XA8L 4RQQA 1S9YA 5HJ3B 4PSPA 1OM9A 3WO3B 5GISH 3SB3A 1IO4C 1E7UA 1KTCA 4KTEL 1NOAA 3DPBB 2X7LB 3GMQA 2VXTH 4X5XA 3ETBJ 3VWJC 3QO0A 1N70A 4MXWH 5EEUA 5F1OB 1CE1H 5KSBE 3UTQB 4IEFB 1KIPB 2ARJB 3LSOA 2DBJA 4R4BB 4K5MA 5E2VH 2BVOA 5GSVA 2EEBA 4NJ9H 3CK0L 2CNZA 3ZDXB 3VD1A 1RI8A 3CZNA 4CSTA 4H7VA 4OZFG 5CJBA 3BDXA 3SPHA 4HWEL 1JHTA 2O5YL 1U8MA 1N0XH 3O41B 4JY4A 1RUML 2VITB 1OSZB 4FOZA 5DMKA 1HCZA 4MA3B 2Z91A 2OMTB 3ARPA 2FD6H 3US1A 1K4DA 3S5YA 3HG5A 3ARGD 2XZQL 4Y89A 2NY6B 4HJSA 4HKJA 4GUPB 2MCMA 2H4EA 4G76A 4HSQA 4UU9B 3DURB 2YAEA 4OGXL 5DFVD 3VWKA 5GZNC 2NSXA 2RJMA 2P5WA 3VGAB 3CN4A 4NJAL 1UZ6F 3QIUC 3IJ8A 3FYEB 3KPMB 4GRWE 4RWYH 3ME0B 3GO1L 1GCYA 5DD3H 1A6ZB 3QRCA 3LRMA 5JHDB 1QSFB 2NR6A 4RNRB 1LO5A 3BZFA 5IOPA 4KROC 5LVEA 1TPXC 2ADJB 4P46B 1DJYA 3BX7C 5KVEH 3CFNA 2B59A 4G9DA 1SJHA 3KNBB 1MI5E 5I5JA 4PVBA 3G3LA 4XZUA 5I5MA 1GW6A 4JFPB 5GGTA 3Q5OA 5IG7B 5F7BA 5IQOA 5KBMA 1NGXA 4D5UA 2OMNA 3MI6A 4ZUUA 4YAQA 3CVIL 3CMOH 3BOVA 1FL6A 3B4NA 1VFAB 2VSDA 2NXZD 1X5MA 5AYUH 1D5ZB 2R83A 1P7HL 4M7KL 1VF5C 2TSAA 3RY5A 2X0WA 4M7LH 4AL8L 1PL3A 4HUXB 3HHSB 2K0RA 5I26A 1PD1A 1S78D 1BIIA 1S7UB 1EAJA 1MJ8L 1O5DT 1Z0MA 1ZA6A 3LNHA 3QIBD 1KJ2H 1NAMB 1JS4A 1QSVA 4OLWL 1N8ZA 5AVVB 3HC0A 3LH2L 4FQLL 2A4EA 4QOKD 3NJLA 4N90D 2ATPB 1THCA 3GB7B 4OIFA 5I1CL 4WO4B 4G5ZL 3QEHB 4G7RB 5HSFA 1H5BC 4OJFL 3SGKC 3U6RB 4PG9A 3GKWH 1CZ8L 4N22A 5I1IH 4QRQA 4PD4J 5DJ2B 1BFVH 2BM3A 5I0VA 3B7RL 3INUL 3ECUA 3QDGB 2CD0A 1G7JA 4WV1B 4AGNA 4HK0B 3S36L 1K85A 5L8KB 1OT4A 2QVKA 3DVNB 2WM0A 4ZRGA 5GGQH 2VL5B 3UZEC 1TZHA 3PDOB 1BM7A 4XZ4A 3MV7E 4OQTH 3D0VA 3L1GA 4YL4A 1L9OA 2WGNB 5E7FA 3ATDA 4HIIA 1D9KD 1EGJA 2AI0H 2YQBA 4V1DD 3S37L 1Y7VA 4C58B 5KTEL 1N3NA 4L3EA 3QI9D 1LJMA 1QWUA 4ABQA 4C56E 3GMOB 4WJG3 3BEVA 5DJ8A 2BHFA 3FCTA 5D7JA 1OVZA 3UAAA 5L88H 1BVKB 2VLRE 4JBSA 1BVLB 4LCWE 2CUAA 2W60A 1T0MA 2YEQA 3EG9A 1B3JA 3AAZB 3GLEA 3RTQA 5E9NA 3MRHA 3RWJB 3ZRFC 1EVTC 3CXFA 3PS6A 2ZZUT 4NQXA 5IK3A 3O6MH 5J56B 3FTUA 5F44A 4GW1A 4LL4A 4FQ2L 1HXUA 1FYTD 3D18B 4JFEB 3D39B 1A25A 2B1HL 5FDWB 3MJ7B 3QFDA 2OR7A 1EEZB 2JKJA 1PYWB 3O3AB 4KKPA 3HMXH 4KXBA 2B15A 1UA6H 2OMWB 1MOEA 4MJ4A 1RZKL 4PVNA 5ERWA 3TNMA 3IDGA 4W9ZA 1EZLA 2IDTA 3MKGA 4PRPB 1ODUA 4LLQB 5DD5H 2BOCA 3A4AA 4YDNA 1MCPH 5AW8B 5I66A 4OD2B 5DTFA 4GAGH 4GSQA 4W6WB 3MOBL 5CZXD 4F15C 2EACA 5FGBA 3RILA 3TV8A 3W5MA 2QBWA 1D5IH 3PGCB 4U1LA 1UACH 4LSIA 3JWNG 1IEAA 2HT4D 2GSGB 5AW4B 1BXUA 3NQIA 2Z8RA 5HHQA 3C09C 2UZXA 3P0GB 1KFAH 1U33A 2KL6A 4F7TA 1NC4B 3H3KA 1HVXA 1AC0A 1JPST 1NBZB 1U8LA 2WYTA 3QR0A 1JUFB 1WBYA 4PJAE 2WVPA 3KLQA 4L29B 2A73A 2CPUA 2WB7A 3LEVH 3VRIB 2DQEH 2JIXD 2IPTL 5HDRA 4KHXH 1OM3L 1WV7T 3L5JA 3OXSA 4PCTA 5DI8B 4FMSA 3UIZA 2CBMA 1I8MB 4MZIA 1KXVA 4R3SB 5B1KA 3PP4H 4DOHE 1QI3A 3U2IA 2NTSP 1NEUA 5CEYA 2WD0A 2B0SH 1KUMA 1F2XK 2W9DL 4EN3D 4AGLA 3FO2A 1TVHB 4TTGA 1CQYA 2W9EH 2O6EA 2YNKA 5D9SA 1BW8A 1FDLL 3HJEA 3QAZB 5IESH 2BVQB 5EUOB 4RMTA 1BD2A 1J5DA 4TUOA 1BBDH 1FGNH 1P6AB 3GM8A 4CL7A 2CBOA 2X4TA 2ZWKA 2O61B 1MFEL 4X7TB 3TT1H 1MWAB 4WVRA 2BNRA 2VLKD 1RFDH 4Z5RA 4JK0D 2GT9A 1I1FA 3KM2A 3LK41 1AO7B 1IT9L 2OULB 4E9TA 3QC5X 3GMLB 5CKAA 2EYTB 1B6DA 4UINH 3KPRA 1XV8A 4M4RA 4ANKA 4E42A 3FF8A 1E27B 3N43B 4G1EB 2H9GB 1TTBA 1XSJA 5DS1A 1JTOA 3G6AA 4JFDB 2LTQC 2PCPA 3MJ9L 4U1GC 3VXSD 1M53A 4PJHB 1AZCA 1T21B 1HYRC 1AGFB 3F84A 1MVUB 1MLBB 3RBSA 3B8YA 4A38A 4IRSD 2KH2B 4BUQA 4Z8FH 4L05A 4MXQC 5EO1B 3QUXC 3WMPA 4WTZG 1BZEA 4HG4J 3QA3B 2C3HA 1FNLA 2A4ZA 4R0LC 3OMNB 3IMTA 2BDNL 1BEYL 4M43L 1AXTH 5FYKU 1UT9A 2LFUA 4ELDA 1RVFL 4WFGE 3RNKA 1L9NA 5DRNA 1U8NB 1U58A 3QPQC 3RWCB 4ZXBB 3Q9QA 2V5MA 4P2AA 1BP3B 1OHQA 3RDJA 3OMIB 1YCSA 1P7KB 1TZAA 3A5VA 4I0KA 3UTTB 5JPNC 1KIQA 3RX5A 4C4BA 2EVGA 2EXTA 2X2JA 3T3MF 1CGYA 3MLUL 2EDDA 3D2UD 1XL4A 1SBSL 3HZMA 2F08A 2HZHA 4RJXA 2C4XA 1NGPH 3HN8A 2KQNA 4HPOL 3BHBB 5JOEA 3DX8B 4FI7A 1I7RB 4K8RD 1QKZH 4HWZA 1I8LA 2HPTA 2GHZA 1JWUB 5F2FA 5KSBA 2CXGA 5D7EA 5A2KH 1RV6X 2NY4D 1USQA 2JH2A 3ESMA 4Z7VE 4MMYB 2WBJA 4S1SL 3NSYA 3AM8A 5LWYH 1MPFA 1GY1A 3PQYB 1KELL 2HYMA 3ABMB 1CGWA 1IU1A 4EIGB 5LXGH 3DROB 1ID2A 4Q7DA 1KLUA 5A43C 3X13B 4DZ8A 2PPDA 5HHOE 4EI5D 2C3GA 2V6HA 4UT6A 2AEQL 2CALA 3OR7B 2CLVA 3RDTA 4DGUA 1S7WB 1N64H 2AQSA 3MMEB 4LAQH 1HWWA 1AY1L 4NENA 2R39A 4EOWL 3S36X 4XBPB 4JRLA 4WW2A 3T0EE 2HVKA 1IGFL 2BSEA 5B39A 3B9EA 1BQRA 1FO0H 4PJEF 1XFPA 5HPMA 4KRAA 3EOAB 5KN5B 5I82A 4RMVA 1EBPA 4GHBA 2QQKH 1MI5A 4EIBA 2Q86A 1X5LA 2WNKA 3B83A 5FO9B 2W1NA 4LOUD 3S37X 3WHE0 1PIGA 2K45A 5BCAA 3OJDA 4XNYL 2ZX8A 5CZRA 1MDTA 2ZCKL 3NTCH 4XVSH 3HOLA 5D5ME 3C60B 2HAZA 1NGZB 5TF1H 2AJYL 2G2PA 3D3VE 1KJMA 2GI0A 5DS8B 3TBYA 1RCYA 1JF1A 4OZFB 2OX5A 1N6QH 4ERSH 4OB5L 1QJ9A 1UFUA 2AEIT 3AA7A 2KXPA 1DDHA 4PRIE 5F96L 3OHXB 3BH8A 3QRGL 5G39A 1H3GA 2VISB 4QAMB 4N25A 3M1CA 2YD4A 2XKNB 2DLHA 4NO0D 4U0QB 3F7KA 3TESA 5I2IB 1OARL 3ASOB 3UAJD 4G6AD 1HDMA 1SBBA 3U6XS 2GTZA 4N0UE 2VDPB 3HHRB 2JKNA 5EOCJ 5C0BB 1DHKA 2MCG1 3DUUA 4GXVL 2OV0A 4WK4B 3QISA 3BPOC 1G9NC 1QLFB 1LO0L 2BC4B 4NGHL 3IFLL 4NX0A 3MV7A 3EZ8A 3LKOA 5KAFO 3T04D 3QQ4B 1MKFA 3HC2A 4JGJA 1MFNA 3L9YA 3NOIA 4FFYL 2OMYB 4PJ9A 4HSCX 2ZP9A 4LRNH 4NNYA 4C56A 5AL0A 1HFUA 1REIA 2A9ML 4K7PH 4AQ1C 1QBAA 4KKLC 5GRXG 2FLRT 2VLRA 2CRYA 3P9LB 4ADGA 4LCWA 3WU1A 1AGDB 1FZKB 4BGLA 1F86A 4GFXA 4Y2OA 5CGYC 3R7QA 1IKNA 3IDUA 1B0IA 1F4XL 3BLBA 3E6FA 2F54B 5KVDE 4C57C 4WHCA 3QCUL 3AG2B 4PRHE 1OP4A 4RJWA 1RUQH 5G26A 5D6CB 3L95B 3MREB 1R3KB 1T7YA 2IQAA 3FB8A 4EI6B 3J27A 2R4LA 4F9LA 3DIDA 4TN9A 4JM4L 3EFFB 4NERA 5JQ6L 2ZAGA 1NM9A 1WF5A 3BN9D 3TT3H 1QA9B 3FCSA 3O2WL 5HI3C 4XBEH 2N1KA 5A16A 1K5WA 1TCRB 1YEJL 3VNYA 2HLFD 3NK3A 4E41D 5DL5A 1WC7B 4BA8A 3JYBA 4MJIE 4G42B 1JPSL 4N9GA 4IU2A 1LGVA 2HP4A 3EYVA 1CXLA 1INDH 5EUKB 4PI0A 2WINA 1ZK5A 3VGBA 5I30H 1A3LH 1S7RB 2YEZB 4J12A 2G60H 1TENA 4TULL 2R69L 4XX1G 4H2CA 3SOBL 1ONQA 1O6VA 1QSED 5DL8A 1Z9SA 3DO7A 4XAWH 3AXLA 2G2NA 2AXTO 4S1QL 5C08D 3U0PB 3FCBA 2XJKA 1MIMH 1PLAA 4YEEA 1NDTA 1V3JA 2JQMA 1E4XH 5A7EA 5C0CD 1E5AA 3QDMB 5CHNA 3GSWA 4QTHB 5CUSL 3ZMRA 1Z9MA 1CC3A 5GJSL 2C4FT 3BKJH 2WXRA 4JGUA 3INOA 3CDCA 2AABH 3L4XA 2ZD0A 4AQEA 4FDWA 2WZ6A 4GMTH 3DWTA 1G9MH 4NQCD 4Q6YA 4XVJL 3KWVA 3RL2B 3LKSA 4BIKA 5TE7L 3X14A 3FQTB 3DWOX 2MPAL 3M17A 4Y16B 5AUMB 3K6SB 1FBIL 1BQLH 1AI1H 2YBRB 2Y5QA 3S5LA 2XETA 1UM6H 4J2XA 1BXAA 2X4OA 3BRZA 3QQ3A 2KLTA 3GSVB 1QBLH 1QWHA 3KWXA 5ILTL 3L3HA 3BH9B 3HE6A 2VO5A 3ROLA 1WFUA 4IQHA 1SDDB 4PGDB 3SYCA 2YAFA 1QRND 2XN9E 4ZO6A 2R1YB 1NPNA 2QLVB 1Z6JT 4JCHA 3ILQD 3C5JB 1AQMA 3T3PF 5HHNB 5DQ9A 1OF0A 1ADQH 4A2EA 3TEXA 5BQ7B 1JGDA 3O4LA 4MB3A 4PRDB 5D1ZI 4GG6A 1GAFL 1FWXA 5HYSA 2IANB 5DQDH 1JCVA 5KANI 3U9UB 3S4SA 2B5IB 4MD0B 1SJMA 3II2A 3HMWL 4WUUD 1X5GA 1YEIL 4TVUA 3IDIB 5CFHA 4QKXB 2WIMA 4PY7A 5ISZE 2F53D 1H6TA 3V0EA 3IETB 4W9JC 4P2OD 3IGKA 4G8GB 2APBA 1B0GB 4OZHB 1UJ3C 3W0WD 2GITA 4P4KA 1B4JH 1PAZA 5C0FA 3ARFD 1LE9B 4UBDD 4ZW7A 4F9PC 4GB9A 2HX7A 5SWZE 2GK0B 3KLHD 5E6UB 4J4PA 4M8QA 1SRDA 1PLBA 1CG9A 3SBWA 3HI6L 1ACYH 3GRWL 2NDFA 4FQHA 4YJZL 5K9KB 3LRSB 5JXEA 2ITCB 4PTTB 5EU6B 1JXGA 4PJIF 4ZW5A 4AW7A 5L0QC 2WLHA 3KJ4B 3AVEA 2FYYB 1VSCA 3O3EB 4G3YL 4CAGA 4MA8H 5EU4B 2Y69B 1JRHI 4MA1C 3HKFA 4DERA 1EK3A 2FIKA 3F5WB 3GJEB 3BKCH 3GSOA 4HHWA 3CN0A 4KXCA 3ZDXF 1H9DA 5IVXB 3AT0A 2V5RA 3VU2A 1ZANL 3HMXA 1ZSDB 1G7LB 4P23C 1A02N 4Z7VA 3VB8A 1GS7A 3KGRA 4WNQA 2E9IA 4Y5YB 4PGEA 4WI6A 3DECA 4M6OH 4NO5B 2CO6A 5EOTB 3POHA 4LHUA 1DUYA 3CHOA 2IV8A 3AAEA 2H0JA 4NQSA 3HC4H 3MFFA 3HTLX 1JGUL 1XB8A 4NWTL 2RA1A 2NY1B 2MIZA 5HHOA 5T1DH 2EEDA 4PJFB 2I9TB 2EDXA 5L8LB 4J3TA 4NIKB 1MHEA 1N9PA 5KBNC 1NCIA 4NN6B 1FQ9C 3NCYS 1RUAH 1HWGB 4U1IA 4FKHA 5KYUB 4QO1A 3D9AL 3SE4A 4PRAA 1FAIH 4FNLH 3ESPA 1CTMA 4BFIB 3T0EA 2NYYC 4I7ZC 1W0WB 1T20A 2FEJA 3BT0A 4XE0A 2X1QA 4YSDA 1ZHBB 5I76A 1YYLH 4Y9CA 2P5EE 5BZDA 3DV6B 4HEPA 3MODL 3PGSA 1E8WA 2W94A 4FG0A 2CE6A 4JCLA 4UOW0 5C9JB 2PP9A 1UENA 1WIPA 3LEXA 2BP8A 1TZIA 2CDEB 4HUNB 3WNNA 2O93L 2XA3A 2OMVB 5D5MA 1R3LA 1FVEA 2J73A 5JHDD 3D3VA 1ZWIA 1U8JB 2BINA 5E4AA 1G0DA 3IU3A 1XDTT 3GI8L 4U0RC 2J56A 4P46D 2WN3A 5JA8B 2EE2A 1EXUA 1KNOA 2A3TA 3BLKA 4PRIA 1N68A 1XH1A 1H19A 3C8HA 4BCYA 4JPVL 4BUHA 4AEIH 4K3JH 4KI5E 4N5EC 4Z7QF 3ZRCC 3Q1EA 4PTUA 5BS0B 2ZXDA 3QEQE 1WTLA 3KEHA 4OFYA 2QADB 1R5IB 4R4NC 2E7MA 3MLXL 3Q5YA 3V4LA 3ARDC 1TSHA 2ZUWA 3AZUA 3Q6FB 1U91B 2BVPA 2HTLC 1AD9B 5BZWA 1T5XB 3SZDA 3V0WH 5GGSY 4M6AA 4MJ5A 4ORZC 1WD8A 3MLZL 2Q6WB 5HDBF 2ITFA 2A83A 2W65B 4TNFA 3FYIB 2Z31D 1X9UA 2EO7A 5E94A 4A2HA 4RA3A 2ATKB 1IC7H 2Y7OA 3V4VL 1OAYH 4XWGH 4JRYE 3FHQA 3W39B 1QEWA 5MENA 3PIQB 3KZ8A 4TQIA 1DBAH 1AYOA 4WO4D 2HJLA 4HIEB 2HRGA 3WJJA 2A9BA 2ADFL 4XNBA 1DJGA 1T1XA 3LEYL 1TTFA 5IB1A 3ZW3A 3UDWC 5ADOH 3OXRB 3QDGD 4XGZA 2BVTA 3M8OH 3AA0B 3TPUB 2ICWJ 2R0LL 1NEZA 4IKLA 4GUQA 1RPKA 3HZVB 3QZWB 3DX6B 2BNQE 4TKWA 4QEGA 4HUMB 5B39G 3BVNB 3QHTC 4UUJB 1YEKH 4PRHA 4RQQB 4N0YL 2XIIA 4RAUA 1N5YL 2G5BA 2YPLB 4AYGA 3CVHA 2ERVA 4A2FA 3GMQB 4MD4B 2R0ZL 5IQ9A 2UY6B 5KVFH 4O02A 1CF1A 1THAA 4WU7A 3IKCA 1ZHKB 2R2CA 2BOBB 3BP6B 5DK3A 2PTVA 3EADA 2OMUA 2X5PA 1QJPA 2DQIL 3LSOB 1JGEA 2WXPA 4L1SA 5KYXB 3L3IA 5CJQH 2CKNA 4CVUA 2FLMA 2AK4A 5LCVH 4K0OA 4CU8A 4J2QA 4CNIA 4MJIA 3UTPE 4YX2H 2GE4A 4JFED 3D39D 4X8GA 3U4BH 5M94B 4LP5A 2CHXA 3NIGE 5J4MA 1P4BL 5AVRB 4FKKA 1TYJA 4C4VA 1ED3A 1IQWL 3ZE2E 4AK2A 1EHLL 4ONFH 2E7LA 2WUCH 3VSVA 3Q2CA 3PJSB 4FLQA 4N3UA 4PRPD 4PV9A 5LNGA 2ID5A 1R24B 2EC9T 2NQ3A 4NHUA 3ARSA 3TJEL 5T3ZH 3VWKB 1Y0LB 2C9AA 2P5WB 2VN4A 3DJRA 3E2HB 4CKVX 3QUML 1E4JA 1PG7H 2AW2A 4DQOL 2ZG2A 1J9RA 4ZG1A 4MAYB 2EDKA 1PS3A 3MRJA 4XN7A 4ALAL 1CR9H 4O3XB 2L7JA 3DIVA 4XXDA 5KSVB 1OCWH 4G9DB 4OF0A 4UDUB 2A6KA 2DKMA 3CDFA 3QFGA 3RUGE 4Y9BA 4B9ZA 4BINA 5ACMA 4I5BB 2BS71 2WJ7A 1NC4D 1KBGL 2ZIDA 4OD1L 5EUOF 4ZUUB 4I4WA 3GPSA 3WDIA 2IO5A 3GEWB 4NWUL 5ADPH 1RUKL 3QUYA 1BQSA 2O5XH 3UMNA 1XWVA 3MV9E 4TSCH 4GMSH 4LPYA 2DB8A 4LSRL 3I02A 3Q8AA 1FIGL 1MHHA 4JFYB 1KENL 3KS0H 5IM7B 5TK2A 3T2OA 5MHSD 3CUPA 1PF3A 3O6LL 2EH8H 4F1ZA 2P8PA 1T2QL 2VB5A 2XN9A 3HC0B 1E6JH 4X5RA 2XPGB 4HJGA 2P8MA 2J8UB 3TA3C 5EEYA 1NAKH 3P3UA 4IRJC 1LP9E 1J5HA 1BXXA 2WO2B 2QDWA 1NBYB 4IIQB 3RHWF 3M45A 5ID0A 2Z1KA 2RB8A 4DP0X 2LHFA 1DE4B 2EDFA 1GFOA 2DD8H 3U25A 3BS0A 4KDTC 4ZS6D 1AO7D 2EKJA 1TCMA 1I4FA 4TLTA 2PMZA 4HFUL 4ZYKB 4D64A 3DX1A 4WI3A 4YO0A 4DN4H 1TZHB 1CYWA 4YZFE 1OTSC 3ARRA 5DD0H 1HHIA 3TBSA 1M6OB 3KWTA 4PJXF 4U6YB 1CWVA 1UXWA 3L2NA 2ZKHL 1F18A 2X6CA 4JFDD 3VD0A 3KPSE 5B1JA 5EIIG 3DYMA 3BEVB 4YEFA 1FGVH 5CP3H 2QL1A 5ESQA 4PWHA 2WOYA 1QSZA 5SWZA 4A6YL 2VMCA 3LZPA 4X6CE 2J5LB 1G7QA 2PW1A 1GTNA 4I2XB 1CFQA 1K4CB 3RTQB 3TZVA 4Q58C 2WNWA 3TVMC 1CLCA 1PLGL 3EJUA 4YE4L 5KSAA 4OLUH 3PL6C 1YC7A 3I9GL 2W81C 1YYCA 4GKLA 3S96A 3QFDB 1J5OL 4U3SB 2VMDA 4TVPL 2FNBA 2HRHA 3ZK0A 5BVJA 3P9MB 4YXHH 4PB9H 2JTYA 2Q1EA 1JI2A 4KHTL 3FFDA 1QPXA 4RBPK 5CR8A 2GUOB 3GUFA 3UTTD 3FUEA 4ODSH 1JYNA 4YPGA 3MNZA 2M07A 5D1ZB 3O6KH 4C4KO 5FFLA 2BOCB 2FQEA 5DRWB 4Z77B 3MC0A 1HEZB 1WIUA 3F6IA 3QNYA 4RX4A 2AXHA 5LG1A 1OW0A 3IDNA 3THML 4GAJL 4WFEE 3NMEA 4ODVH 1NGYA 4MS8D 1BG9A 2J6EH 2X70B 5EU5B 2HN7A 5FOBB 3GMRB 4F57L 4XPTH 1DQLH 3VD9A 4OZGF 3IXAA 4H20L 1TLMA 2ORBH 3BFOA 1IEAB 3ZR5A 3DTXB 2I07B 4OTXL 1F41A 5IP4A 3TGXA 4O51A 3FULA 1LYQA 4W4OA 5DD1H 5GZOA 2UZXB 3RZCB 2NOYA 1XEDA 5HYSG 4UV7L 4JRWA 1EXHA 3DJZA 3S4SG 2APVA 3PQYD 5IMMA 3P30H 3R18A 3SYSA 4Q9CA 5IIEA 3S34L 1D6EA 4HKBB 1YEDB 5F9AC 4BSVA 4Z78A 1A6VH 3QJUB 2OYKA 3QG6B 1MN4A 4CSSA 1PTZA 3FN3A 5AWNL 4I48B 3AT8A 1FORL 2EYRA 3EJPA 5IMOB 1A1OA 3ULUE 2QQNH 3AY2A 4CVZA 1RZIA 1E8YA 4KV5E 4OLXL 3PWLB 4MQXD 3ZT6A 7PAZA 2UY7B 2QVMA 1CLYL 1GGBH 4QXWA 4HP5A 5B3NA 2IC2A 3ABGA 5JDJA 1VEPA 2XY2A 1M7IB 2IH3B 3S8FB 4DVRL 4MAUL 2HVBA 3IAGC 1XIWB 2ZE0A 3EH1A 2BNRB 1VB9A 4Z5RB 2GT9B 2XTJB 4HHAB 4DZBB 3BFQG 3QVAA 3IJYA 4GAAA 3EH3B 5L9DL 3QEQA 4H0HB 4X7FC 1RUPH 2DJMA 3C60D 3KYMA 3VFRA 3MRFB 2NNAA 1XH2A 1ET7A 1EDHA 1DN2A 4AZLA 5D2LE 1JNLL 1WFIA 4AKRB 3IJHB 4O9HL 4JRYA 2IWFA 3FNKA 3MFGB 2H2SC 4K9EC 4LHUG 5F88A 3RVWD 1RHHA 4NC1C 3I74A 3TJHC 3TYGH 2JB6A 4PWJA 1NJ9B 4AJ0A 5FV2A 4CC4A 1Z3GL 2HX8A 2MQCA 4LMQI 3O3DA 4P2RE 5E8EB 3CFKA 2P46B 2VR4A 2C3XA 2OKMA 2J88L 4LVHB 3RNKB 5IFHL 4UQEA 3LVTA 1BXWA 1ZPLA 2M26A 3BZEB 4YHNB 3RFZB 4JFOB 4Z76A 1QACA 5BO0D 2Q76A 3EO9H 3RWDB 2R1WA 1D2OA 1HKLH 2I9LB 1EAQA 2Y2XA 1FFNA 2Q3ZA 4HK3N 3LK2A 2MHLA 4KZDL 1QZ1A 2CHDA 2V37A 4OFIA 2YMOA 4FA7B 2BNQA 1KIQB 2VLME 2MTAA 1ZA3A 2ZSWA 3CFCH 2VDOB 5HI5C 2QV4A 3HBPA 4KU1A 3VWJB 1UZ8A 1PZBA 1FLRH 3HZMB 3V5DA 4B9PA 5I24A 1A64A 1CFBA 2K7PA 2QQLH 3WYRA 1GMEA 5D2NA 5JHLH 1KF9B 5B8CC 2CHZA 2R29A 4ZMXA 2FT7A 2JJVA 4PWGA 3GMMB 2BS9A 3OAZK 2Y6TE 3WS3A 1CE6A 1YRKA 4DFHA 1HOEA 1IBGH 3ZTEA 4HUVA 2QVIA 1JVKA 4FXLA 4JHAL 2A77H 4ZAKB 1JGVH 2IOIA 5SX4H 2F8IA 3B7UX 1QX1A 1ZXQA 3NG5A 3DTUB 3LZOA 5A2LH 4BFNA 2H2PD 4XNXL 1L0XA 4NM8H 4OT1H 3QFJB 1UZGA 2UYLB 5BRZD 1NUDA 4WK0B 4N58A 2YQ2A 4BQBA 4GKNB 1E4WH 4OFQA 4J1UB 5JW4R 5A2FA 3F6JA 4YHZH 3OZLA 5ELIA 4MTMA 2OXHB 2D03L 4LARL 3NUKA 3QIUB 5ENWB 3UJTH 3I84A 5FF6B 4JDZA 3FFCE 5IV2B 1KYOJ 3OG6B 3NESA 3DPDA 3QW9A 4FYRA 3UO8B 4NP9A 1L0QA 4ADJA 4KROB 4GRWB 5F6IC 4QRTA 2K9FB 3SO3B 4IM8A 5FYJH 3TBTA 4E0RA 4N59A 4ZI8A 2VRAA 1I53A 5CEZE 1JXFA 4YVNA 4RAHA 1KGCE 5T3XH 2G2RA 1VZHA 2ZKXA 4UMGA 4MQTB 5EFIB 2LW3A 5AKRA 5DHVH 2XN1A 3VI3B 2H3XC 4H26A 1XGUB 1FN4A 4KUZH 5E7BA 3KYKH 3E6HB 2YO3A 4JFFB 3CZUB 1CICD 3CZLA 3MV9A 4RLCA 5DZNA 1Z32X 2BH0A 4D9LL 3FTWA 1CFNB 3KS0J 4ZK8A 4XN5A 2EVJA 3FH7A 1U4EA 5A7BA 5ADXL 2OX5B 1W72L 3BUQA 4UNVA 4IGBA 5FUZH 1I8AA 1MNUL 4ADIA 3MUGB 4M8VA 2MH4A 3CIAA 3QRFM 4I9WD 1H5BB 1SMAA 3IJSB 1XZWA 4PJBF 1N7ML 3N40P 4PP1C 4Y16D 3OSKA 3MJ9A 2YKKA 3VGGA 3IU4H 1NCAL 1MY5A 3SPVA 1LP9A 1CI5A 3L4UA 4R96A 4XN8A 2R4OA 1DQJB 2OTWA 4M1DL 4O58H 5ICYB 2BNUA 5I1LA 3RJDA 4YSCA 2G4EA 3O2DH 5ES4B 1NINA 5BV7H 1T5KA 3I6LD 2KZ1B 2BRRL 2CWRA 1MPAH 5K1NA 1I3RA 5C0EA 1G7MA 3RZWA 2DQTL 4U1MB 4OCSH 4JQXA 1KN2L 2DWYA 2GC7C 1EFXB 1RJLB 3MXWH 5F1IA 1KBBA 4ACPA 1CFSA 4NRYB 2M1KA 4KK8D 2IAND 3OHMB 2RCSL 1YS5A 4Y4HA 4PJ5E 5JOPD 3KWWB 3SGDH 5D7IE 1ZEAH 3DGGA 4O3WA 4HFWB 4HHGA 5KUMA 1HXTA 3VFOA 4QGYA 3STZA 3PAYA 5J11C 5E9DA 5HYQB 8FABA 3O81A 4LCUB 5FGCE 3SKOA 3J7HA 4J28A 2YWZA 4OJYA 2R56H 4LCCA 5GRWA 4ODTL 1OP9A 3QT2A 4KI1A 3ULSA 4BFFA 1FZJA 3RAJL 2KLRA 2PR4L 1IAKA 3RWEA 1OCZB 3HS9A 5E99H 5FYKH 1L9TA 5D1QA 2R2BB 4X6DF 4QHMB 1EVUA 5IJKA 2DH2A 3SYBA 2ZYSA 4Q0XH 4F15B 1NFAA 4ICWA 2OYLA 3JZ7A 1F11B 1EEUA 1RIHL 3OPZH 3CH1B 5F8RC 5LG6A 5EU6D 3BAWA 1Q0XH 1MLCA 5CILL 3M07A 5BUGA 2WO4A 5J7CC 1CF8H 1PX8A 2BWDA 4BZ2H 1IAIH 1EV2E 2HH0L 1WBXA 3UO1H 4Y2DC 1H0DB 2HVJB 3C09B 4F8TA 1RMFL 3HRZB 2QDVA 5FYLH 1KTRL 3ENEA 4OIAA 1B0WA 1UWGL 3NIFF 4NSKB 3EDJA 4NRXA 1S5IL 5EIIB 1B4TA 5IR1B 1YMHB 2WQRA 4Q89A 2YWYA 4X98B 3T6QC 3RI5F 3DO7B 2VDKH 1GYVA 3JWOC 3U82B 1TSRA 4PJAB 4D0BB 2DQFB 4YXKL 4ODWA 2JXMA 2V7NA 3B6SA 4I87A 4IOFC 1BX2B 5C2BH 1R5VA 1S7SA 1R46A 4XWOD 2NY1D 1L7TL 3EYQD 3UGXA 3FMGH 4ZUVA 3WFDL 4ZTPL 1EZVX 3SKMA 4B9YA 4K8RL 4XP1L 4F1SA 2NW2B 3BKYH 3EH5B 4AQEB 1KTDB 3GJFH 1MRDL 4H2AA 2IADA 5LQBL 5GRVL 1YVLA 1RSFA 1M4KA 4H88L 4EBQH 3V79C 3IDXH 1KYAA 1ASPA 4HC1H 3FBQA 3BJLA 4LSUH 2ZXAA 3RVTD 4JM2A 4YDJA 1RKRA 4XI5D 4GXFA 4AIZB 2FEEI 1M57B 3QRLA 3PGFH 5EF0A 4CGUB 4PP2A 3QO1A 2ICWI 3EHBB 3D05A 3WL9A 1XXFC 1KTLA 1I8LC 1PZCA 2B4CL 1IGMH 5D71L 4FABH 1YJDL 2VYRE 3R1GL 3TYFA 2LTQB 5FHBL 4U1GB 3IJEA 5HGHB 4HJTA 3CHQA 5ACLA 4OCLC 4QRUB 2HPOA 1KJ2B 2WBJC 4G8FA 2DY2A 4HQQL 4QYAA 1ZHLA 1OLLA 4XPAH 5DZAA 1JGDB 5DSCA 5GHWL 1SHWA 2NX5D 1R5WB 2P9RA 5HYSB 1GOHA 4GO8A 2H0EA 5D2LA 5EF2A 3MRBB 4NN7B 3S4SB 3QUXB 3U83A 1NDGA 1BH3A 4F7MA 1OF2B 2ICEA 3ZZ1A 3RDTC 4RFEA 2J12B 3L3OA 3LZLA 1B0RA 2QADD 1YN7A 2WZPD 4PY7B 1U8HA 4P2RA 4YR6A 1ZTXH 3SEPA 3QPXL 4Y4FD 1NBQA 4JFZL 1FVDB 4BZ1A 4GRLA 2H6PB 4NPKA 5BZXA 5BV7C 4HUCA 4A55A 3V4PH 1D5XB 3V55A 1DBBL 5JPNB 3D4CA 4WFFD 4D3CL 1JBJA 4PR7A 5AW9B 4E36A 3VMNA 4BA0A 4QIRA 3QUKA 2X53A 3Q8BA 4DEPB 2Y6SD 5FKPB 1M71A 1WZ1L 3Q2VA 4X9IA 1A9EA 3X3FH 5DYOB 4KJPC 3HNTL 5E1QA 2DM3A 4DO6A 2EIKB 3CJJA 4UM9B 4KVNL 1OD9A 5DHMC 4LOEA 4NOBA 2P3YA 4Z18A 1C1EL 1F4AA 3QR1A 4RGNE 2AK1H 5F21B 2OAAA 4MZRA 3WN5A 4XN4A 4PSRA 5IJCC 4JGNA 3S97C 2FR4A 2Z7WA 1Y18A 4HH8A 5EZLB 2GFBA 4E9XA 3VGHA 2OI9B 1P6FA 1PFOA 2N2MA 3ETSA 5MEOA 2YPLD 2CO6B 1NGQH 1YEFH 4J3VA 1QASA 2ZCHL 4LHUB 5GJTH 1H6FA 3AAEB 1YUKB 4JL1A 5CSBA 5ICXA 2GIYA 3NYKA 3L45A 3MFFB 5CN3A 3B9AA 4LSSH 5L6YL 5HHOB 3A6OA 5E8DH 2R69A 3JWDC 4NHCL 3GF8A 2PCXA 1QFWH 2YA1A 2XRAL 2EDHA 1QFUL 4CN6A 4TF4A 3FFCA 1Q1JH 4YHPB 1MXGA 2Y1VA 3AUVA 3POXA 2DBLH 3GGWA 3NACH 1L4IA 3P40A 4BK5C 2RR3A 3W11D 2PLTA 3GIZH 3F64A 3T0EB 3VA2C 3ARQA 4IMLA 1G6RA 2P44B 1KGWA 4P5KB 4G43B 5I19L 4IHOA 5DT1L 2PR9A 5BZDB 2E75C 3CAFA 3D6GA 2BP8B 1HS6A 5BJTB 4ZQKB 5F7EL 4FESA 3E0GA 1IKNC 4Q4EA 1U6AH 3WJMA 1IKFL 4KJWD 3VYPA 4MAYD 4JGMA 3WSQL 2XBDA 1S7XB 4RCAA 3AS2A 2NY2B 4UQ2A 3VI4F 3VMPA 3MJ8A 4PJGB 4F9LC 4W9CC 4XCYA 4OW6A 3ZKXC 1AC6A 3PXJA 1KNOB 2OSXA 4I3RH 1J1OL 5H37A 3WE1A 3HN3A 2J8UF 4PWEA 4AZUA 2DIEA 3NSCA 1OV8A 2Q8BL 4RRPA 1A6PA 1JNNH 2Z9TA 3PFUA 1G1OA 3LMJL 3DLQR 5HGDB 2MCAA 4FT6A 2V17H 4N0UB 5BZWB 4DW2L 4UAHA 2BSSB 4KAQL 3BPOB 3ZKQD 1GTFA 1HL5A 2ITDB 3UBXI 5E94B 5EBGA 3MLVH 4HW6A 2GPZA 3FUFA 3OF6A 2CDGB 5AD0A 3BSZL 3BSGA 4X7DC 4XMZA 1QEWB 3B9KC 3EO0B 3OG4B 4ZFFA 1SYVB 4XVTL 2GG1A 2HJLB 2FECL 4ZPTB 5ADXK 5K33A 3CHSA 2AQRA 3LXBA 4M48H 5JR1L 1T5WB 1Y6NR 4OZ4A 1C12A 4IL6O 2VC2L 1OPGH 4AMKH 4OV5B 2BIMA 3QORA 4MD5A 4LDCA 5J1AB 4UB6O 1WAEA 2AERT 5I9QC 5HD8C 5HDOA 2XXMB 5DMGC 4NXSA 3PYCA 2DF3A 3C6EA 1JNJA 1D5RA 5DJYA 1BZ9A 2FX8H 1F90L 1HAUA 2GY7B 3QIWA 2FWOA 3L48A 3QZMA 1YMMA 1JV5B 4GAYB 3O45B 4DHLA 3OKOB 1JIBA 2FWLB 2I69A 1DO5A 4KK9D 4WIQA 5B1CA 3EFDH 1KXHA 4C83B 1R3JA 4FRWA 4WU7B 1P2CB 2YC1A 5ANME 3HE6C 4GQQA 1KT2B 5F7MC 2OMUB 2GJ6E 5D1XE 1A2YB 2YD5A 4Y4KC 4D0CB 3D48R 1T3FB 3VXOB 4JDVA 5E00A 3WO4C 5L2KB 4E68A 2JJWA 1S3KH 4JY5H 1PAMA 3W2DL 1ETB1 1T1WA 2Y2YA 4M1GH 5JPMC 4WKZB 1IUZA 4ZTOL 7PCYA 2VLJE 4C4VB 1T0OA 1SEBA 3HLAB 2Y0HA 1M2VB 4HJJL 4ZS7H 4GO6B 3CZFA 1GR7A 1YN6B 3C5ZA 5DEGB 4ORGA 4XCCH 5JOFB 4PV9B 4YIQB 5DJAA 2Z0UA 5D1ZD 1DQIA 2Y24A 2OBGA 5EU7C 3X12B 4LDOB 1BM3H 3VXMD 3KPNB 3X1EA 2AJSL 2R59A 1JFQH 1UUNA 2NUPB 3ZE1E 3C75A 2KZWA 2YPKA 2XC8A 5DEZA 3RGHA 4DKEH 1XZ0B 2C4FU 4HVBA 4PGBA 3HNSH 5IT2L 3D69A 1FO0B 4CC0A 1K8IB 3B2VH 4GY4A 3KMDA 3RZCD 1EEYA 3C12A 5EPMA 1SHMA 3IXTA 5AVYB 2CR3A 3H9YA 3SDDA 3MLTB 4AVIA 4Z3HA 1UA3A 1E28B 5IBTH 2AP2A 2OQJA 1XR8B 1T1LA 1UD2A 4NBZB 2PETA 4P3DB 3MGOA 4AE0A 4W9IC 2WWOA 1JWSA 2VERN 1P4TA 2OL3H 2NLJA 4U1JA 1JDDA 4FHKA 3DHMA 3MGTB 3AAAA 3LHAA 3OAUH 3PAUA 5C0DA 3STBA 3VFNB 3ZHLA 4A7UA 2H8PB 3T20A 3TASA 1UOLA 4JZJA 1FNGA 2CGZA 1I7ZA 2QGEA 4JRXB 5IGXH 1ZRUA 4OGYH 1RZJH 3VXPA 1DBKL 4KQ4H 1Z1WA 4ZFGL 3WS6A 3N55A 4XO9A 2X4SA 1WWBX 1RP9A 4UQIM 2E86A 1B2WL 2SEBA 2EDWA 1XIWD 3OGCA 5GRVK 1OQOA 1MFAL 1VFMA 2A9CA 2XTJD 4Y9FA 5H4ZA 4YC2B 5DCCA 4NUJB 2LFGA 5B5EO 2XV3A 2WO3B 3ZMEA 4YDLC 1IBZA 1RQ5A 1B4LA 1UJ3B 4LP4A 3WFCH 2C9RA 4ZD3L 2KZKA 3NEEA 4EDXA 4KXDA 2E59A 5ISZB 4R5VA 3V0GA 3QHFL 5CWSA 3DI2B 3KPQA 4U6HB 3T2NH 1LK3L 1UZ6E 4HDIA 3ASWA 4NAQA 3TH2T 2PPCA 4URTB 3RY6C 4OFKA 2FJUB 4XC3H 5ESQB 2VZUA 3O9WA 2DQCL 3BDYL 1VGKA 3K19A 3V8UA 4JJ5A 1A7NL 1JZ6A 5L0QB 4QOKE 5FHAH 1ECZA 4N90E 1UWEL 3CFEA 5EWIL 2B1AH 4FQIL 2VDMH 5GTHO 2LU3A 1JI1A 3FSOA 3C5SA 2Y1AA 3ILDA 4MXVF 4MA1B 3LQAH 2CDFA 2F1BA 1H6UA 4YZWA 5LAXA 5IMLA 1QR1A 1JK8B 1MJJB 1HSBA 4YHOL 2D2OA 1AZZC 1YY8B 2YD8A 3MCKB 1MUJB 3QPKA 1QATA 3L6FA 1LEKB 5SX5K 3JQOB 1NAML 2ZOOA 1PKOA 3MNZB 3NEXA 5D70L 3X11A 4LVOB 1NLBL 2A99A 2G4GA 4MNGA 3VWJD 2YAMA 4JO3L 5E2UL 5E08L 1L9QA 2IBZX 3AB0C 3KDMA 1DBMH 3B7TA 2VN6A 3IXAB 2N1TE 2C1OA 3QEGH 1J05B 5BQDA 2A6IA 2WQ8A 2NRDA 3L9RA 3EYFA 3MKKA 1CDGA 2PCFB 1F1AA 4ZAKD 3HUJF 2FX9H 1K5NA 3EBHA 5DJXB 3L4VA 5DR5L 3ARBA 2VABA 2WJQA 4NO2A 3QFJD 4G8IB 3GXDA 4NQVA 3WLBA 4F8NA 2VXUL 4JPIB 3KR3L 1T03H 1NFDF 1FYTE 4X7SH 5LLIC 1TMCB 3TO4B 3F7VB 1MH5B 1TJXA 4QYOB 3WJJC 4GSDH 3NGBC 1PCSA 3QBTB 1FFRA 1RJYA 1G84A 2IAMA 1LEIA 2P5EB 5GZND 1KXTB 2VWEE 2DWXA 4KQ3H 1INQA 1KPRA 3QIUD 3EOTL 1S9WA 5TDOA 5F1NA 1AQKL 5DU7A 3IFNL 1A4JA 2BSDA 2NY7H 2JELL 4U6XA 4KROD 4PJ6A 1FNHA 3GLZA 4KOCA 4U0RB 4LLUA 2P47B 4PGCA 2A5UA 3UZQB 2DMKA 2YEVB 5AZ2H 4F2MB 3GSQA 4NZTH 5KSUA 1J18A 5EBLB 3Q05A 1WISA 2O5YH 1AKJA 2HCZX 1RJCA 1XSOA 4OCXL 1O7DE 4JO1H 4PJDA 2OSWA 4Z7WB 1JPGB 1S8DA 1FRGL 1VKXA 4EAEA 3PP3K 4NLAA 1JD9A 7FABH 4K3EH 3EYUH 3I50H 1XGQB 3PNWA 4APQC 1GC1C 1KBPA 2Y72A 1GZPA 3I6GA 3U2SB 4JFFD 2WLYA 5LBSL 1OP3H 2ZKMX 1SDYA 2PW2B 3HC3L 2G75A 3QNFA 4U31A 3TFKC 3H2QA 4J3SA 3GSNL 5IEKB 4RFOL 5JIQA 3I85A 4MZ2A 5EZIL 3ZMNA 2IDCA 2WLIB 4WJ5A 2E7LC 1CN4A 3KYOA 2E7DA 3IDMB 3GMPA 4KZEL 3FO9A 3T77A 4HF5H 5F7DA 1KXQE 1T6BX 3ULVL 4MHHI 1E2ZA 3WIHL 3CFKB 1IKOP 3SODB 2A4CA 4W9LC 2VXVH 5GGVL 2PYEA 4XOBA 2Q3AA 2YJLA 2RHEA 4A6YA 4AYFB 2X89D 4Z76B 3FQWA 4HLZH 2VLKE 1D5BA 3PWJB 2R1WB 3TCXA 4AL8H 4LL9A 3P0YL 3UC0L 3SBPA 2A6DB 4K5OA 4D0DB 1BDYA 2ALAA 1EFXD 3HPJA 1I1RA 4UNUA 3LH2H 3WLWC 4FQLH 4NRZB 3DK2A 1AHWA 1SM3H 3WIFA 3ZO0A 4FZ8H 3QUYC 4V11A 5ID1A 4N8UA 1MRFL 3VXSE 5I1CH 3CZGA 3NFPB 5F6HI 4RH4A 1G7PA 3BW9B 2R1XB 2OCCB 1P4LB 2Z8SA 3AFLA 4J7RA 5IF0B 2QFPA 1MWAL 1J88A 4FFVD 2P80D 3VSTA 2OJZL 4MRBA 3LQAC 2GJ6A 3CSFA 2WB1A 4QHLB 3CQQA 3QJRB 3HJ0A 2K3HA 1V7MH 4KUCD 3VFUB 2RGSA 5AALA 2HSIA 4KBPA 3KLAB 1QUNA 5KTEH 4HIXL 2VLJA 1VAHA 3S37H 3ZE2B 2CJ3A 1XCTB 1W0VA 3HCVB 2J1WA 1I9IH 5JNYA 3P73A 1UOKA 5SWSB 3ERXA 3GTTA 3MPCA 3ZDWA 3PWNB 2WCPA 4XVOA 1ET8A 4MKTA 4YXLL 2FE0A 1GKOA 2CO4A 3SD2A 3V0JA 4H8WL 3HS0A 4WHYH 4ANWA 2BFVH 2HT2C 4NT6B 4Z6AT 1E9OA 1LO4H 2XZAL 2EE6A 4LQFH 2V5YA 4KK5C 1K8DA 4FQ2H 4G72B 3ZU8A 1F3DH 2B1HH 1IGJA 1QTYT 4L0ZA 2H1XA 4XO8A 4FXGB 4ZUTB 3PGRA 2G2RB 1IILE 3RUGB 4Y1AD 4HXAL 2YR3A 1H8SA 3M1BB 2RACA 1E0OB 3G08A 4CC1A 3TZVC 1BZDA 1ADWA 2FLBT 4JCMA 3F58H 4YBLC 1OP5H 5DXWA 1PKQB 1GFQA 4ZMTA 3PREA 1SY6L 5IVZA 1WCBB 5AAPA 4AY0A 1AR2A 3ZDZF 3SZVA 3TBCA 1WK0A 3MOBH 3ARGA 1EAPB 3HFMH 3MBWB 4WEBH 4HT1H 2Y0LA 4FRXA 2YPVL 1G4MA 3EGSA 4GRMB 4Z9KB 3O0EA 2I60L 2IH8A 5TDNA 1SN5A 1D6VH 2AXFA 3PFQA 4L8CB 4IRJB 3U1SH 3ZHKA 1JXJA 2O4EA 4N68A 1I1YB 5B38A 5C3IA 4OZIB 2Y5TA 5KYWA 3IWVA 4XP6L 1IZJA 2XWJA 5DDHA 1U8QA 3FF7A 4RLDA 2OTWB 2YZ1A 4PAZA 2YMXL 2BCKA 4Z7UB 5I1LB 3P1VA 2ZUUA 1M42A 1U3NA 4H13C 2DIJA 4XBGA 5BVPL 3A67L 5E56A 5C8JA 3N85H 2YAQA 3PDGA 3SE8H 3SGEI 2ZKYA 1KWKA 4QDGA 1GY2A 4W4OC 3U46A 4G80B 1GPOH 1S5HA 2Y7MA 3BUYA 4UOZA 1IQDB 4QXTA 1NCHA 4HKZA 3DJSA 5T1MB 2W9DH 3KPSB 5T5FL 3B5GA 2N7SA 2WWKO 5HGGS 5E9AA 1PZSA 1FDLH 3HI1B 3VU1A 4MXQD 4JKPL 2VDLH 3QUXD 2OS7A 3QIBA 2DI9A 4PJEE 4X6CB 1HQ4A 5DZOA 1HESA 3Q9PA 3DBXB 4QOKA 3SDXF 4Z3EA 4KMTL 4CA4A 2K8MA 4FLRA 4YFLI 3G04A 1XGPB 4ES9A 3QPQD 4D8PB 2DWEB 3MRNA 1P7QD 2A6JA 4G8EA 1XR9A 5E2TL 5FC9A 3BUDA 1XF2A 1DVFA 4AL8C 1PJ9A 4G7YL 4X6BA 2EJ1A 4G6KH 4H0IA 2E7BA 2MHAA 4WUKH 5HI4D 2BW4A 3HI5L 2J4WL 2W91A 1JV2B 1B6UA 4KR4A 1R3HA 3QZLA 5TE4L 3DJTA 1CL7L 4BFEA 2WP3O 3ZBMA 2XFGB 4KI5C 1TNNA 1TFHA 2KQMA 1D9KA 4YSOA 2E47A 4UM9D 4V1DA 3QI9A 3RWGA 3L7FB 5I1GH 1IGYB 1P53A 1XH3A 2VDPL 3R8QA 1KBWA 1YLBB 5GS1B 4M43H 5KJ4A 2J2ZA 1DFXA 3TBVB 1RVFH 3VFPB 1PDKA 1BCIA 3QJHA 2A0LC 3VACA 1A7QH 4OSUH 3D0LB 5MEQB 2QVTA 5TTRA 3S35H 2FGRA 3U36A 3IGLA 3JV4A 1FYTA 1HHHB 1UCBL 4CC4C 5JW4M 3U0TB 1TU2B 2ED9A 3DBSA 1TVBB 4NKIL 3CXHJ 3OPUA 4HAKA 2GJRA 4HPOH 1JHLL 3SKMB 5EO9B 2DM2A 5FO2A 4ZPVA 4J5VA 2G0KA 1I1CA 2XWTA 4RSVA 3SDYH 3K7UA 1S5LO 3LRGA 3LIZL 1NANI 1NL0L 3DHJA 3CLEL 3RYMA 4AX3A 1OGTA 4E41E 2MNHA 1C8QA 1DQTA 1BZ8A 1QBML 3MNVB 2FGWL 2V4LA 3WUWG 3NIDB 2F1VA 3B7SA 1MAML 1W72A 1TEFA 1W16A 2WCGA 3CU7A 4MAZA 5C0IB 1AXIB 3G5ZB 4JO2H 1WS7A 3O6FB 5D2NC 3WEMA 1RZKC 2R2HA 5DD6A 4JPKH 1MFDL 4H5SA 1J0YA 1KTLB 1FG2A 3RVXC 1QSEE 3JV5A 3RVUC 2KPNA 5E79O 2X3BA 2HXAA 4Y5VC 4BHUA 1UVQA 3O0RL 3BO8B 5DEFB 5C08E 2XWBB 2X87A 1BF5A 2E76C 2CK2A 2IMNA 4HPYL 5FUCC 3RP1A 2RQEA 1UWXK 1ZHLB 5C0CE 4LBAA 1AY1H 2IAAC 2JIXA 2X6VA 3BESR 3G6JE 1HEJC 1OAXL 2NY2D 2FO1A 2OMBA 1BBJA 1LK2A 1IGFH 1XHHA 4DP2X 1A1MA 2MEJB 3OR6A 43C9A 3CBKB 1R17A 2P8LB 4NQCE 3L5WB 2P52A 3KGTA 1KIUB 1JVOA 2KERA 3OL2A 1F6AA 1KB5H 3NN8B 5DZPA 5FM5O 2A9NH 1AS8A 4EN3A 3Q13A 1IFRA 1ZT7A 2DICA 1N8OE 5C0NC 1YN7B 1ZGLB 1KXQA 3BZ5A 4R2GC 1S7TA 1TR7A 2QZ5A 1GSMA 4K3GA 5DUPL 4OF8A 2AJYH 2VLKA 3CSGA 3QCVL 5IFJA 2CBPA 1BLNB 2D7QA 4BXSV 2J21A 2OCFD 3AREC 1ODAA 1QRNE 5TGBA 5EU3B 1QUPA 2QHRL 5EMYA 2JKTM 2FT6A 5I8OH 3NQKA 5B8CB 2XMXA 1L0YA 3VXSA 3K2IA 5MEPA 5I17A 2GAZA 3B2PA 2XUWA 4LEXL 4YE0A 3WXVH 3CZKA 1LD9A 4JQVA 1RIVL 3GIVA 1MCNA 1JJUA 4WUUE 3S48A 2VRQA 3ZYJA 3TXAA 1UC6A 4GXVH 5DUML 3VG0H 5J1SC 2FR4B 1PZ2A 1KBKA 4W6YB 4WI9A 5FKAA 4Z7NE 1DJWA 3EZJB 3PRZA 4RAVA 1LO0H 4L8BA 3LK42 2F53E 3HPLB 4M61A 1RURH 4NGHH 2XX1A 2XVBA 3LQZA 5TD4A 4U1KB 4FTVB 3V5KA 2BSTA 4EE2A 3W0WE 3W9EB 5HI3D 1RSYA 5F3BB 1CLVA 5D93C 1E7VA 1UUSA 3P4NB 4YSUA 2ZOKB 3GXFA 4QHUB 5CLXA 3RVUD 4POZD 3P2DA 2AQPA 2A9MH 2GC4C 1IBDA 3OKLB 4QF1B 4J3BA 4P3CL 2ZNXA 4C4UA 5EO0A 1YPZF 1MHCA 5F6IB 5IB3A 1IM3B 1NGWA 4X0KB 3Q06A 5L2KD 1COBA 3BEWA 3D2UA 1YYMH 4JQXC 4BH8B 2YAPA 4XH2B 5IV2A 3MR9B 3QCUH 1BQHG 2YKLL 3IVKA 2YD7A 4MCYA 1TZOA 4Y4HC 3RRQA 4KO6A 3MZGB 1OD7A 1FFPA 4R97C 2EIMB 4BSJA 2WQUA 1BVNT 4UZSA 3VY8X 1SZNA 4ETQA 3A0OA 4FP8L 1GYCA 4TNWK 2YD1A 4N26A 5IROC 3C8KB 4JFSA 1IGTA 4L8DB 1YEJH 4N2MA 3DUHA 3H9ZA 4YHIA 5CM1A 1GGIL 3VFSA 1VFBA 5I1HH 1GIGL 4KO7A 1F4YL 4OCWH 4B96A 4QHNB 3P2TA 3LQMA 4Q52A 4EI5A 5CU9A 3BIBX 3SCMC 2G3ZA 2HG5B 5CCKL 1E2WA 2X2UA 4HJUA 5D1QC 3BPLB 2YZ8A 1KY7A 3SE9H 1X5FA 1NDMA 3ZDXE 1BPLB 4YDZA 3MNDA 1J5CA 3HZYB 5AOIA 5C1MB 1YQVL 1EO5A 1PGRB 1QLRB 4PV1C 3ZTNH 1AQ8A 4L9LA 4F91B 5B4MC 5TPWL 4MWFA 4JG5A 1YNTB 3R06B 5KS9F 1A7OH 1XF3A 1LO2L 1SMOA 1M05B 2P42B 4FD0A 3NH7H 5CUSH 2IVFC 2QKSA 4JJHA 3STLB 3OKNA 1N10A 1HL9A 2WTRA 3PU7A 2FHCA 4FEIA 5EN2B 2RMNA 1DUZA 4MDIA 3NFNB 1GGCH 3VM5A 1XMEB 3TIDA 4XVJH 4J3OH 4HJ0C 4ZFFB 4JRXD 2JI3A 3FT2A 1AJ7H 5F0PB 3VXTA 1KCRL 2Z93A 4PJ5B 1P1ZB 2DLIA 3GBNL 2CHWA 1XX9C 4HD5A 5D7IB 3QDJB 4M00A 2FQFA 4PJEA 3QQXA 1JGLL 1NLDH 2X09A 2AANA 3SY0A 2BMKB 5ILTH 4H8VA 3K46A 1UB5A 2QR0A 3REWA 5GGRB 3NCMA 4NO0A 3T5WA 3L1EA 5ESVA 1BZ9B 2IPUG 1AGEB 3UAJA 4LRIA 3MRKA 1U3HB 2HKHL 1IL1B 1UATA 2D7NA 2PP7A 4FX5A 4JM2C 4CVWA 2WLNA 3EJYC 3X1FA 1XGYL 1GAFH 2IXQA 4FQQB 3IYLW 4XNKA 1KLFA 1DQQA 3DV4A 3O0LA 5E4EC 1SJXA 1VEOA 2H26A 4B6ZA 1HSAA 4XNQA 4AQZA 5E00B 3L5HA 3K8MA 1YEIH 4Y2DB 4F4BA 1HXYB 2ZFGA 1V5JA 4WTXA 1UKTA 4X4XB 1LMIA 1QO3A 1DR9A 1QYGH 2B2XH 4NI3A 4ELMF 1BF8A 1BVOA 3WKNA 3RPIB 2DQDL 3QDGE 4GP5B 4PCKA 2WPGA 4P23D 5EC1A 1EJ8A 4LHQB 2OXGA 5HDBE 1NCTA 5B38G 1I9RH 2ICEC 2GABA 3QJXA 2JCCF 1SF3A 3MYZA 3HI6H 3BVVA 3GRWH 3NFSH 4ONGL 5HVHC 4PUBH 3F12B 2FBRA 5DZJA 4JR9H 3MRGB 1BFOA 2YD6A 2DAVA 2VDQH 1MFBL 3MO1B 5MP6L 4G3YH 4Q6IA 4YHKH 3VE0B 1DVYA 3JUYA 1I9JL 4IW4C 3RVVC 3KPLA 2C7FA 2ZOLA 2NYYD 2AQ3A 2JCWA 2GSIB 5DVKA 1XGTB 4KTDH 4M62L 3BAYA 1EHNA 4E41A 4ODUB 3QCTL 3HAEA 4JB9L 4JFEE 1ZT4B 3D39E 5FR3A 3HG3A 5DHVB 4F37F 1VIWA 2JB5H 4D65A 2CKBA 5GIRA 1M1XA 3EDEA 5DF0A 1CFVH 2JQZA 2FBJL 3RNQA 7PRNA 2XXFA 4FSOA 1A4AA 2FNWA 3BGMB 4QRSB 3FL7A 1JGUH 4LGPB 2OA9A 1CXFA 2YGVA 3WN5C 4PRPE 1QSEA 4U1JB 4WI7A 5AG9A 3V4UH 3AW5A 5AOLA 3T8XA 3B2MA 4JZJB 2DQUL 5C0CA 2H3NA 5IOKA 1DCLA 2CRZA 1ZE3H 5F9JB 3D9AH 3VXPB 3G6JA 4F3FB 2AJVH 4WWKC 1KTKE 3MRMB 4IDJL 1ACCA 4F2FA 5FFGA 2HKFL 2SEBB 1JTTA 2X41A 1KLGB 3QXTA 5EZOL 2NY5L 4MVBC 4NQCA 3MRPB 3TEYA 4K55A 3KPPB 4BKLA 4R4ND 1ZLEA 4LU5L 2OLDA 3ARDD 1XCQA 1SLUA 5F3FA 4P4RA 4NUGL 3OWRA 2HTLD 1K9TA 2Y07L 3V7MA 5LNDA 1A1NA 4PRNB 4Z3FA 5BV7B 5JXAL 1PRNA 3MVSA 2OP4L 3DSNB 4ZW6A 3UIYA 4MDRA 3H9HA 3LD8B 4HIHB 4MDJA 1J0HA 2CO7B 3WUWB 3MRLA 5MHSE 4J3OC 5HYFA 2X6MA 2QSQA 1ZT1A 1QRNA 4S0TD 3UTZB 5GGTL 4Y0GA 2IGTA 4D9QD 1HZLA 3CFEB 4LCYA 1A4BA 3K6DA 35C8H 5EUOE 2YOCA 4Q2ZA 3TWYA 4GEJA 4IIZA 4FYSA 1JOIA 4QRRD 1HSBB 4K3BA 1TTUA 4JLRA 5JW4N 4GCQA 3VSQA 5TE6H 2QPDB 4GO9A 1AO7E 4WUUA 5DLMH 3DX7A 4AV5A 4ZSOA 3PHOA 1G43A 2XPZA 4GBXC 3CQFA 4EUPH 3MLRL 1S9XA 2H1PL 5E5LA 4R6UA 3AWFA 3V4VH 1VGEL 4H40A 3VTTA 5E6IB 2F53A 4JFDE 1BG1A 4P2OA 3BD4A 5DVLA 2ZQKA 1I8UA 3W0WA 4G1MA 3UAFA 4NPYA 3MA9L 4GEIA 5T33L 3ARFA 3GHBH 4PW4A 3ZL4L 5G4OA 1QQDB 2EKSB 4UIMB 5H2FO 2EE3A 3JTSA 2E9JA 4CW1B 1JPTL 2A6IB 3CCHA 3ASNB 1K2DB 2Z4QA 2EDQA 1RJZB 3OZ9L 1WUNT 1KEML 2VO8A 3BXNB 1ZHNB 2XN0A 1PU0A 2R0LH 5AVWB 1FV1A 3V6OE 2WXOA 3WFHB 3FT9A 4QAWA 2F7RA 4AMWA 3DHPA 1RERA 1EGJL 2F19L 4NDMA 3PWPE 3PG2A 5JIHA 3Q1SL 1A6UL 2VDKB 15C8H 3FOLA 1TFPA 1BYOA 1U3ZA 4LLMA 4OAWB 1J87A 5DO2C 4WEUD 5BPPA 1N5YH 4LQ1A 2DI8A 4EDWH 3VSUA 3BVXA 2DQHL 3O4OB 5INCB 1INQB 2J3SA 3NZ8A 3BLPX 5SWSD 3UTTE 4YDIH 3MV8B 4DGIL 2R4SL 1A6AB 1QRKA 4GS7C 5HJ3A 4IJ3C 1IFHH 1IBHA 2YBGA 3ALWA 3E1F1 1SLXA 1AS6A 3GJFB 2DQIH 2Q9OA 4UQ9A 1YNKL 2DV6A 3U1QA 5T1KB 5DLLA 3DPBA 1T2XA 2X7LA 5D7LE 2G3MA 3ZKXB 1JF6A 5FCUL 3T0XA 4GCPA 4DAGH 1FVCA 1XGRB 1FPTL 2ZP8A 3LTVA 5K9JH 4BEIA 2XACC 4L3FA 2DYRB 4G59C 4ZT1A 5C6TL 3UTQA 4IEFA 5GQBA 1KIPA 4JY6B 2ARJA 3TC9A 4LPTA 4R4BA 5I6XC 5ABDE 2FL5A 4WJKB 1J0JA 1WUZA 1U8KB 1MCWW 5JUEL 3Q5TA 3VH8G 1NA8A 5DGQA 2G9HB 3OX8B 3TBWB 2H1LM 3CC1A 3DO4A 3PQYE 3O41A 3II1A 1MRCL 2VITA 2F2HA 1OSZA 4DGYH 4MA3A 2OMTA 5B7EA 2WKLA 1E90A 3QUMH 4A7GA 4N6RB 1IX2A 1ND0B 4BH7B 4GUPA 4MA7L 5BOPA 2F5AH 3K2UH 4UU9A 3B9KB 4ALAH 3DURA 4OZGE 1BQHB 1FH2A 3C5ZC 3MRCB 5EN3A 2Y36H 4OLZH 2X1OA 1HJCA 1GZHA 4L4VB 2BZ7A 2I24N 4IRJD 5K39B 5TQ2H 3SE3C 3KPMA 2HWZL 5JHDA 1TQSA 2HFTA 2HRPL 3ME0A 1A6ZA 1JZ4A 4P5TB 3SD5A 5KYYB 1KBGH 4RNRA 5K9QI 2VQ4A 4P46A 2ADJA 4NWUH 5KW9L 5HYIA 5FW8A 5I9QB 1HNFA 4OLYH 5J89A 3QJOA 2APFA 3L4YA 4ODHL 2MCPL 1R0AH 3GHEL 1D5BB 3MGAA 4PJ7B 5IG7A 5FM8A 5DUJA 5F9WC 1KENH 1SVZA 1A4CA 2DMCA 3V4PB 2CUMA 4BBWA 4XBMA 1H9VA 4MRCA 1VHPA 3WXWH 1KCUL 1BLIA 4P9HH 1VFAA 4HJIA 4I0CC 3VXRB 2E6JA 3WEXB 5IZ7A 1D5ZA 3FHAA 1G5AA 1OAUL 3FAXA 5DC0A 4HUXA 2KZBA 3HHSA 3LZFH 3MLSH 3VW3H 1S7UA 4FZLA 4Y4KB 1NCDL 2ADIB 1NAMA 1EJOL 3QULB 4H0GA 5ANMB 2CU9A 3DVIA 1T6VN 3PL6D 1KJVA 1EUUA 5I6PA 3UJIL 2ATPA 2GJ6B 4MFHA 4I18B 3GB7A 5D1XB 3L4TA 4WO4A 5A40E 5JPMB 3QEHA 3RB7A 4WTWA 1CGSH 1NMBL 4HFUH 3FFOA 5DHDA 4YPJA 1CUOA 4KRPB 3U6RA 3X1GA 2NY0C 2EECA 5AVSB 5DJ2A 3QQNA 1QWNA 4F24A 3QDGA 1TTGA 5J06A 4WV1A 3S7GA 4HK0A 6FABL 5A2JH 2F5BL 4M8UA 1J8HB 3DVNA 3GXTA 2VL5A 1MF2L 1MG2C 4M7LT 2WUBL 4GJTB 1HC1A 1P0SE 4AUYA 3PDOA 2LE9A 5DJDB 1XD1A 3SQOH 5K1JA 4GFTB 4F58H 1HE8A 2HRLA 2DN7A 2ZOUA 3RIKA 1PSKL 2EIEA 3RY4A 1OB1B 4QXUL 5EEXA 3J2PA 1PLGH 2PF6A 3GMOA 4HK3J 3EYOA 4AJVA 2V7HB 4KY1L 1BVKA 3BAXA 3ZE1B 1BVLA 4FJ6A 2D3JA 1IGJB 1BV8A 1BSIA 1ZVSB 4JFHD 1TNMA 4TVPH 3AAZA 4IBZA 1CLZL 3O9WC 4XOAA 3RWJA 4N3TA 4NBYB 3L5XH 1NMAL 4UTAA 5I28A 5I73C 1SXCA 4PMFA 3P4LA 4TS6A 2ED7A 3D18A 2WQXA 4JFEA 3D39A 4Q97A 5BRZE 2FO4B 4AYID 2ZONA 3MJ7A 4CUCA 5T3ZD 5TQ0H 1EEZA 1MHPL 5DK2B 1ZHXA 1PYWA 3O3AA 3THMH 4G11A 1IEBA 2N4IA 4NZUH 4GAJH 2OMWA 2ZYRA 5HGAB 5DQJB 3LK3A 2PP8A 2WAQA 4F57H 4K23H 4J23A 4EQ2A 3R0NA 3D2TA 4PRPA 1VADB 4LLQA 5C92A 3V9FA 1AG6A 3CZEA 5TDNB 4UTBL 2TRHA 4JZNB 2EE0A 4OD2A 5LBSA 4ZFZB 1BAWA 3PGCA 2XYCA 1M7DB 3BP7B 5DJ0B 3QXWA 3IF1B 2GSGA 5HYJB 3G5VB 1MNNA 1Y6KR 3G6DH 2QHLA 1A6TB 4YDLB 1MFCH 1NUFA 4WU5A 5ACZA 4IKNA 4JN1H 5ITFB 5D96C 3JT0A 5DYFA 5AWNH 1NC4A 3CFMA 3WI4A 1NFKA 1NBZA 1R47A 3U46B 2FWSA 3Q6GL 1JUFA 3MLYL 5CKGA 1HNGA 3OJVC 3VXUB 3WIHA 2UWEB 3BUYB 4L29A 1XH0A 5F1SA 5G2NA 1V8HA 4MJ6B 3VRIA 1J11A 4LSVL 2Y22A 4OLXH 1KCSH 1X5ZA 4ALAC 5DI8A 1L9RA 1CLYH 3AMLA 1I8MA 2H2SD 4R3SA 1KG0B 2X2YA 5I8EB 2DMGA 2BW5A 2IAMC 3TJHD 5AVUB 5IREA 4MNHB 5DC9B 1KYUA 4DVRH 2V3FA 4MAUH 1TQCB 5LGYA 4I9WE 4YFEA 4HUWB 3ZYZA 1TVHA 1VLXA 4RISL 2HMIC 2VLLB 4WHYG 3POCA 2CRIA 4OLVL 2BVQA 3NSJA 3QHZH 5L9DH 1PNDA 5EUOA 1EERB 1W8NA 5HXMA 5HY9B 3ECQA 4J6IA 1C9SA 5D72H 4B9CA 1XR9B 4Y2NA 2WYHA 1XF2B 2O61A 1JZJA 4X6BB 4B0MM 1MWAA 3WKQA 3CX5J 3QARA 3T2LA 4BQ6A 3O8XC 1AO7A 3MBXH 4HOMA 3WFEH 3GMLA 5HI5D 2EYTA 1NC2B 2B1OA 4H1LH 4HS6B 2FGQX 5KG9B 2EH7L 4MMZC 4YN3A 2IG2L 1JNLH 4ILDA 1DQML 3RWFB 4O9HH 4FEMA 1E27A 2CGRL 2JLPA 2H9GA 12E8L 2XHNA 4G1EA 5B3JF 4JFDA 2WLMA 5ESAB 3UU2A 4PJHA 2IANE 1T21A 5DA4A 5J1TC 1AGFA 1MVUA 4LNVA 5JOPE 1MEXH 4GG8B 1CBVH 1MLBA 4XP4L 1FH5H 3ZQ9A 1OGAB 1UEYA 3SDCB 5IFHH 3EF4A 1HH9B 4FFZA 4P8QA 3WCYA 2Y06L 4LFHD 5EO1A 2WOBA 4EJ1C 3POUA 3L17A 3PQUA 2OJ1A 3QA3A 5CS7A 1L3NA 5I1JL 3V6OA 5DRZB 3ET9F 3NGBB 1KJ3L 3P4OB 5LN8A 2BJML 4FTVD 4UIKH 1S7QB 4TUJB 1DZ0A 4YDKL 4GW5B 3DVGB 3C6SB 1U8NA