3UU2A

Salmonella typhi osmoporin(ompc):an outer membrane protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
357
structure length
298
Chain Sequence
AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKGDGYGGSLTYAIGEGFSVGGAITTSKATVYTGGLKYDANNIYLAAQYSQTYAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein C
publication title Crystal Structure of Outer membrane protein OmpC from Salmonella typhi.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 65
structure length 298
sequence length 357
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3uu2A00
5PRNA 2XG6A 3T24A 1OPFA 3SY9A 3POUA 3T20A 3POXA 4BUMX 3UU2A 2J1NA 4D5UA 1HXXA 2XE5A 3HWBA 2PRNA 1GFMA 8PRNA 1E54A 3SZVA 5DL7A 2K4TA 3UPGA 2Y0KA 2FGRA 3PRNA 3WI4A 3HW9A 2FGQX 2XE1A 3VY9X 1GFPA 5DL6A 1GFNA 2OMFA 4LSFA 4AUIA 1PHOA 1HXTA 3SZDA 1PRNA 5DL8A 1OSMA 3EMNX 4LSEA 4LSHA 2PORA 2Y0HA 3VZWX 3SYSA 3NSGA 1H6S1 4GCQA 4RJWA 3K19A 2J4UP 2O4VA 4D64A 4FRXA 3VZUX 4FRTA 3SYBA 4RJXA 1GFQA 3JTYA 2Y0LA 4GCSA 3POQA 4LSIA 6PRNA 3PORA 3VZTX 4KR4A 3WI5A 3A2SX 1MPFA 1GFOA 3VY8X 3FYXA 2Y2XA 1BT9A 4D65A 2ZLDA 4FMSA 1HXUA 7PRNA 4FT6A 2XE2A 2XE3A 2QTKA 3T0SA 3O0EA 4KR8A 1BH3A 4GCPA 5DL5A 2ZFGA 4JFBA 3SY7A 4FOZA 4C69X 4FSOA 4FSPA 2ODJA 4KRAA 5JDPA 5FVNA
chains in the Genus database with same CATH superfamily
5PRNA 2X9KA 4AYID 2XG6A 3LK2A 1G90A 3T24A 1OPFA 2R4OA 2R89A 3SY9A 3POUA 3AAEA 3AA7B 5G3AA 3AA6B 2F1CX 3T20A 2X27X 3POXA 5T5FA 3WU2O 4BUMX 3UU2A 1BXWA 2J1NA 3HOEA 4O3ZA 4AYNA 2LHFA 4D5UA 5GTHO 1MM4A 4O4UA 2MHLA 1HXXA 3AA7A 2XE5A 3A0BO 3HWBA 2PRNA 2YPVA 3AA6A 1GFMA 3A0HO 3C5OA 3VE2A 4E1SA 1QJ9A 8PRNA 1E54A 5H2FO 3GP6A 1ZHWA 5D5DA 4K3CA 4FZLA 4AZLA 2KC0A 2JMMA 4UB8O 3QRAA 3SZVA 5DL7A 4PJ0O 2K4TA 3V8UA 1Q9GA 3UPGA 2Y0KA 2FGRA 5IYUA 3PRNA 3DZMA 4U9CA 3WI4A 3HW9A 5ADXL 2FGQX 3AAAB 3LK41 5AFUL 4PUXA 2XE1A 3VY9X 2KZ7B 3UAQA 1GFPA 3LK42 2R88A 1YS5A 3HOLA 5DL6A 1GFNA 2XTQA 3PGRA 2OMFA 4K3BA 4LSFA 4O3XB 4AUIA 3AA0B 4B61A 1PHOA 1HXTA 2KZ7A 3PQSA 3BS0A 3KVDD 5KAFO 3BRZA 1ZHXA 4AKMA 4N58A 4XNKA 2N2LA 3SZDA 4FQEA 2IWVA 1PRNA 2GE4A 4RLCA 1P4TA 1T1LA 1S5LO 3PGUA 3AA0A 4O49A 4FZMA 5DL8A 3DWOX 5ADXK 1OSMA 2R4LA 3EMNX 2N2MA 2XTRA 4LSEA 4FUVA 5AFUK 4LSHA 4AYMC 1QJ8A 2PORA 5B66O 2Y0HA 3VZWX 4N59A 4F4BA 3SYSA 3DA3A 3NSGA 2M06A 5TISO 1H6S1 4GCQA 2R4PA 4FESA 4RJWA 2R8AA 4IL6O 2LFUA 4O4XA 1T16A 1ZHYA 3K19A 4GHBA 2J4UP 2M07A 2Y7SA 4RL9A 3LK3B 2F1VA 3G7GA 5EE2A 4AKRB 2WJQA 3AAAA 2O4VA 4D64A 2W80C 3PQUA 1ZHTA 4FRXA 3VZUX 4AYDC 2KXPB 1IZNB 2XMXA 3QRCA 4FRTA 5G39A 5G26A 3SYBA 3TZGA 4AFKA 3LK3A 4RJXA 3KZIO 4AKRA 1GFQA 2F1TA 4JCHA 4N74A 2IWWA 3LK2B 3JTYA 3PF1A 2Y0LA 3VE1A 4GCSA 3POQA 4Z3TA 4LSIA 2KXPA 3JCUO 4E1TA 6PRNA 1QJPA 4G75A 4GF4A 2JQYA 4C00A 3PORA 3VZTX 4KR4A 3WI5A 3A2SX 4O3YA 1MPFA 2AXTO 4N75A 1GFOA 2ERVA 2WJRA 2W81C 4QQ1A 4XNLA 1THQA 3VY8X 4O3WA 3FYXA 2Y2XA 1BT9A 4D65A 3BRYA 2ZLDA 2YNKA 4FMSA 1HXUA 4UB6O 5KAIO 5B5EO 4FT6A 2XE2A 4PR7A 7PRNA 4G76A 1Q9FA 2XE3A 4CTDA 2QTKA 2MNHA 5GTIO 3T0SA 3O0EA 4C4VB 3AA1B 4KR8A 5E79O 1BH3A 4RLBA 2KDYA 2R4NA 5GV0A 4GCPA 1MM5A 5DL5A 1ZHZA 2ZFGA 4FZNA 2WVPA 4JFBA 4C4VA 3SY7A 1ORMA 4FOZA 3AA1A 3DWNA 4C69X 4FSOA 4FSPA 3AAEB 3RBHA 1IZNA 5G38A 2ODJA 4KRAA 3PGSA 3NJTA 3DA4A 4AYEC 5FVNA 5JDPA 2K0LA
chains in the Genus database with same CATH topology
5PRNA 4AYID 2XG6A 3LK2A 1G90A 3T24A 1OPFA 3SY9A 3POUA 3AAEA 3AA7B 3AA6B 3T20A 2X27X 3POXA 5T5FA 4BUMX 3UU2A 1BXWA 2J1NA 3HOEA 4O3ZA 4AYNA 2LHFA 4D5UA 1MM4A 4O4UA 2MHLA 1HXXA 3AA7A 2XE5A 3HWBA 2PRNA 2YPVA 3AA6A 1GFMA 3C5OA 3VE2A 4E1SA 1QJ9A 8PRNA 1E54A 3GP6A 1ZHWA 5D5DA 4AZLA 4FZLA 2KC0A 2JMMA 3QRAA 3SZVA 5DL7A 2K4TA 3V8UA 1Q9GA 3UPGA 2Y0KA 2FGRA 5IYUA 3PRNA 4U9CA 3WI4A 3HW9A 5ADXL 2FGQX 3AAAB 3LK41 5AFUL 4PUXA 2XE1A 3VY9X 2KZ7B 3UAQA 1GFPA 3LK42 1YS5A 3HOLA 5DL6A 1GFNA 2XTQA 2OMFA 4LSFA 4O3XB 4AUIA 3AA0B 4B61A 1PHOA 1HXTA 2KZ7A 3PQSA 3KVDD 4AKMA 1ZHXA 4N58A 4XNKA 2N2LA 3SZDA 1PRNA 2GE4A 4RLCA 1P4TA 3AA0A 4O49A 4FZMA 5DL8A 5ADXK 1OSMA 3EMNX 2N2MA 2XTRA 4LSEA 4FUVA 5AFUK 4LSHA 4AYMC 1QJ8A 2PORA 2Y0HA 3VZWX 4N59A 4F4BA 3SYSA 3DA3A 3NSGA 2M06A 1H6S1 4GCQA 4RJWA 4FESA 2LFUA 4O4XA 1ZHYA 3K19A 4GHBA 2J4UP 2M07A 2Y7SA 4RL9A 3LK3B 2F1VA 3G7GA 5EE2A 4AKRB 3AAAA 2O4VA 4D64A 2W80C 3PQUA 1ZHTA 4FRXA 3VZUX 4AYDC 2KXPB 1IZNB 2XMXA 3QRCA 4FRTA 3SYBA 5G26A 3TZGA 4AFKA 3LK3A 4RJXA 4AKRA 1GFQA 2F1TA 4JCHA 3LK2B 3JTYA 3VE1A 2Y0LA 4GCSA 3POQA 4Z3TA 4LSIA 2KXPA 4E1TA 6PRNA 1QJPA 4G75A 4GF4A 3PORA 3VZTX 4KR4A 3WI5A 3A2SX 4O3YA 1MPFA 1GFOA 2ERVA 4QQ1A 2W81C 4XNLA 3VY8X 1THQA 4O3WA 3FYXA 2Y2XA 1BT9A 4D65A 2ZLDA 2YNKA 4FMSA 1HXUA 7PRNA 4FT6A 2XE2A 4G76A 1Q9FA 2XE3A 2QTKA 2MNHA 3T0SA 3O0EA 3AA1B 4KR8A 1BH3A 4RLBA 2KDYA 5GV0A 4GCPA 1MM5A 5DL5A 1ZHZA 2ZFGA 4FZNA 4JFBA 3SY7A 1ORMA 4FOZA 3AA1A 4C69X 4FSOA 4FSPA 3AAEB 3RBHA 1IZNA 4AYEC 2ODJA 4KRAA 5JDPA 3DA4A 5FVNA 2K0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5PRN A;  2XG6 A;  3T24 A;  1OPF A;  3SY9 A;  3POU A;  3T20 A;  3POX A;  4BUM X;  3UU2 A;  2J1N A;  4D5U A;  1HXX A;  2XE5 A;  3HWB A;  2PRN A;  1GFM A;  8PRN A;  1E54 A;  3SZV A;  5DL7 A;  2K4T A;  3UPG A;  2Y0K A;  2FGR A;  3PRN A;  3WI4 A;  3HW9 A;  2FGQ X;  2XE1 A;  3VY9 X;  1GFP A;  5DL6 A;  1GFN A;  2OMF A;  4LSF A;  4AUI A;  1PHO A;  1HXT A;  3SZD A;  1PRN A;  5DL8 A;  1OSM A;  3EMN X;  4LSE A;  4LSH A;  2POR A;  2Y0H A;  3VZW X;  3SYS A;  3NSG A;  1H6S 1;  4GCQ A;  4RJW A;  3K19 A;  2J4U P;  2O4V A;  4D64 A;  4FRX A;  3VZU X;  4FRT A;  3SYB A;  4RJX A;  1GFQ A;  3JTY A;  2Y0L A;  4GCS A;  3POQ A;  4LSI A;  6PRN A;  3POR A;  3VZT X;  4KR4 A;  3WI5 A;  3A2S X;  1MPF A;  1GFO A;  3VY8 X;  3FYX A;  2Y2X A;  1BT9 A;  4D65 A;  2ZLD A;  4FMS A;  1HXU A;  7PRN A;  4FT6 A;  2XE2 A;  2XE3 A;  2QTK A;  3T0S A;  3O0E A;  4KR8 A;  1BH3 A;  4GCP A;  5DL5 A;  2ZFG A;  4JFB A;  3SY7 A;  4FOZ A;  4C69 X;  4FSO A;  4FSP A;  2ODJ A;  4KRA A;  5JDP A;  5FVN A; 
#chains in the Genus database with same CATH topology
 5PRN A;  2X9K A;  4AYI D;  2XG6 A;  3LK2 A;  1G90 A;  3T24 A;  1OPF A;  2R4O A;  2R89 A;  3SY9 A;  3POU A;  3AAE A;  3AA7 B;  5G3A A;  3AA6 B;  2F1C X;  3T20 A;  2X27 X;  3POX A;  5T5F A;  3WU2 O;  4BUM X;  3UU2 A;  1BXW A;  2J1N A;  3HOE A;  4O3Z A;  4AYN A;  2LHF A;  4D5U A;  5GTH O;  1MM4 A;  4O4U A;  2MHL A;  1HXX A;  3AA7 A;  2XE5 A;  3A0B O;  3HWB A;  2PRN A;  2YPV A;  3AA6 A;  1GFM A;  3A0H O;  3C5O A;  3VE2 A;  4E1S A;  1QJ9 A;  8PRN A;  1E54 A;  5H2F O;  3GP6 A;  1ZHW A;  5D5D A;  4K3C A;  4FZL A;  4AZL A;  2KC0 A;  2JMM A;  4UB8 O;  3QRA A;  3SZV A;  5DL7 A;  4PJ0 O;  2K4T A;  3V8U A;  1Q9G A;  3UPG A;  2Y0K A;  2FGR A;  5IYU A;  3PRN A;  3DZM A;  4U9C A;  3WI4 A;  3HW9 A;  5ADX L;  2FGQ X;  3AAA B;  3LK4 1;  5AFU L;  4PUX A;  2XE1 A;  3VY9 X;  2KZ7 B;  3UAQ A;  1GFP A;  3LK4 2;  2R88 A;  1YS5 A;  3HOL A;  5DL6 A;  1GFN A;  2XTQ A;  3PGR A;  2OMF A;  4K3B A;  4LSF A;  4O3X B;  4AUI A;  3AA0 B;  4B61 A;  1PHO A;  1HXT A;  2KZ7 A;  3PQS A;  3BS0 A;  3KVD D;  5KAF O;  3BRZ A;  1ZHX A;  4AKM A;  4N58 A;  4XNK A;  2N2L A;  3SZD A;  4FQE A;  2IWV A;  1PRN A;  2GE4 A;  4RLC A;  1P4T A;  1T1L A;  1S5L O;  3PGU A;  3AA0 A;  4O49 A;  4FZM A;  5DL8 A;  3DWO X;  5ADX K;  1OSM A;  2R4L A;  3EMN X;  2N2M A;  2XTR A;  4LSE A;  4FUV A;  5AFU K;  4LSH A;  4AYM C;  1QJ8 A;  2POR A;  5B66 O;  2Y0H A;  3VZW X;  4N59 A;  4F4B A;  3SYS A;  3DA3 A;  3NSG A;  2M06 A;  5TIS O;  1H6S 1;  4GCQ A;  2R4P A;  4FES A;  4RJW A;  2R8A A;  4IL6 O;  2LFU A;  4O4X A;  1T16 A;  1ZHY A;  3K19 A;  4GHB A;  2J4U P;  2M07 A;  2Y7S A;  4RL9 A;  3LK3 B;  2F1V A;  3G7G A;  5EE2 A;  4AKR B;  2WJQ A;  3AAA A;  2O4V A;  4D64 A;  2W80 C;  3PQU A;  1ZHT A;  4FRX A;  3VZU X;  4AYD C;  2KXP B;  1IZN B;  2XMX A;  3QRC A;  4FRT A;  5G39 A;  5G26 A;  3SYB A;  3TZG A;  4AFK A;  3LK3 A;  4RJX A;  3KZI O;  4AKR A;  1GFQ A;  2F1T A;  4JCH A;  4N74 A;  2IWW A;  3LK2 B;  3JTY A;  3PF1 A;  2Y0L A;  3VE1 A;  4GCS A;  3POQ A;  4Z3T A;  4LSI A;  2KXP A;  3JCU O;  4E1T A;  6PRN A;  1QJP A;  4G75 A;  4GF4 A;  2JQY A;  4C00 A;  3POR A;  3VZT X;  4KR4 A;  3WI5 A;  3A2S X;  4O3Y A;  1MPF A;  2AXT O;  4N75 A;  1GFO A;  2ERV A;  2WJR A;  2W81 C;  4QQ1 A;  4XNL A;  1THQ A;  3VY8 X;  4O3W A;  3FYX A;  2Y2X A;  1BT9 A;  4D65 A;  3BRY A;  2ZLD A;  2YNK A;  4FMS A;  1HXU A;  4UB6 O;  5KAI O;  5B5E O;  4FT6 A;  2XE2 A;  4PR7 A;  7PRN A;  4G76 A;  1Q9F A;  2XE3 A;  4CTD A;  2QTK A;  2MNH A;  5GTI O;  3T0S A;  3O0E A;  4C4V B;  3AA1 B;  4KR8 A;  5E79 O;  1BH3 A;  4RLB A;  2KDY A;  2R4N A;  5GV0 A;  4GCP A;  1MM5 A;  5DL5 A;  1ZHZ A;  2ZFG A;  4FZN A;  2WVP A;  4JFB A;  4C4V A;  3SY7 A;  1ORM A;  4FOZ A;  3AA1 A;  3DWN A;  4C69 X;  4FSO A;  4FSP A;  3AAE B;  3RBH A;  1IZN A;  5G38 A;  2ODJ A;  4KRA A;  3PGS A;  3NJT A;  3DA4 A;  4AYE C;  5FVN A;  5JDP A;  2K0L A; 
#chains in the Genus database with same CATH homology
 5PRN A;  4AYI D;  2XG6 A;  3LK2 A;  1G90 A;  3T24 A;  1OPF A;  3SY9 A;  3POU A;  3AAE A;  3AA7 B;  3AA6 B;  3T20 A;  2X27 X;  3POX A;  5T5F A;  4BUM X;  3UU2 A;  1BXW A;  2J1N A;  3HOE A;  4O3Z A;  4AYN A;  2LHF A;  4D5U A;  1MM4 A;  4O4U A;  2MHL A;  1HXX A;  3AA7 A;  2XE5 A;  3HWB A;  2PRN A;  2YPV A;  3AA6 A;  1GFM A;  3C5O A;  3VE2 A;  4E1S A;  1QJ9 A;  8PRN A;  1E54 A;  3GP6 A;  1ZHW A;  5D5D A;  4AZL A;  4FZL A;  2KC0 A;  2JMM A;  3QRA A;  3SZV A;  5DL7 A;  2K4T A;  3V8U A;  1Q9G A;  3UPG A;  2Y0K A;  2FGR A;  5IYU A;  3PRN A;  4U9C A;  3WI4 A;  3HW9 A;  5ADX L;  2FGQ X;  3AAA B;  3LK4 1;  5AFU L;  4PUX A;  2XE1 A;  3VY9 X;  2KZ7 B;  3UAQ A;  1GFP A;  3LK4 2;  1YS5 A;  3HOL A;  5DL6 A;  1GFN A;  2XTQ A;  2OMF A;  4LSF A;  4O3X B;  4AUI A;  3AA0 B;  4B61 A;  1PHO A;  1HXT A;  2KZ7 A;  3PQS A;  3KVD D;  4AKM A;  1ZHX A;  4N58 A;  4XNK A;  2N2L A;  3SZD A;  1PRN A;  2GE4 A;  4RLC A;  1P4T A;  3AA0 A;  4O49 A;  4FZM A;  5DL8 A;  5ADX K;  1OSM A;  3EMN X;  2N2M A;  2XTR A;  4LSE A;  4FUV A;  5AFU K;  4LSH A;  4AYM C;  1QJ8 A;  2POR A;  2Y0H A;  3VZW X;  4N59 A;  4F4B A;  3SYS A;  3DA3 A;  3NSG A;  2M06 A;  1H6S 1;  4GCQ A;  4RJW A;  4FES A;  2LFU A;  4O4X A;  1ZHY A;  3K19 A;  4GHB A;  2J4U P;  2M07 A;  2Y7S A;  4RL9 A;  3LK3 B;  2F1V A;  3G7G A;  5EE2 A;  4AKR B;  3AAA A;  2O4V A;  4D64 A;  2W80 C;  3PQU A;  1ZHT A;  4FRX A;  3VZU X;  4AYD C;  2KXP B;  1IZN B;  2XMX A;  3QRC A;  4FRT A;  3SYB A;  5G26 A;  3TZG A;  4AFK A;  3LK3 A;  4RJX A;  4AKR A;  1GFQ A;  2F1T A;  4JCH A;  3LK2 B;  3JTY A;  3VE1 A;  2Y0L A;  4GCS A;  3POQ A;  4Z3T A;  4LSI A;  2KXP A;  4E1T A;  6PRN A;  1QJP A;  4G75 A;  4GF4 A;  3POR A;  3VZT X;  4KR4 A;  3WI5 A;  3A2S X;  4O3Y A;  1MPF A;  1GFO A;  2ERV A;  4QQ1 A;  2W81 C;  4XNL A;  3VY8 X;  1THQ A;  4O3W A;  3FYX A;  2Y2X A;  1BT9 A;  4D65 A;  2ZLD A;  2YNK A;  4FMS A;  1HXU A;  7PRN A;  4FT6 A;  2XE2 A;  4G76 A;  1Q9F A;  2XE3 A;  2QTK A;  2MNH A;  3T0S A;  3O0E A;  3AA1 B;  4KR8 A;  1BH3 A;  4RLB A;  2KDY A;  5GV0 A;  4GCP A;  1MM5 A;  5DL5 A;  1ZHZ A;  2ZFG A;  4FZN A;  4JFB A;  3SY7 A;  1ORM A;  4FOZ A;  3AA1 A;  4C69 X;  4FSO A;  4FSP A;  3AAE B;  3RBH A;  1IZN A;  4AYE C;  2ODJ A;  4KRA A;  5JDP A;  3DA4 A;  5FVN A;  2K0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...