3UU2A

Salmonella typhi osmoporin(ompc):an outer membrane protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
357
structure length
298
Chain Sequence
AEIYNKDGNKLDLFGKVDGLHYFSDDKGSDGDQTYMRIGFKGETQVNDQLTGYGQWEYQIQGNQTEGSNDSWTRVAFAGLKFADAGSFDYGRNYGVTYDVTSWTDVLPEFGGDTYGADNFMQQRGNGYATYRNTDFFGLVDGLDFALQYQGKGDGYGGSLTYAIGEGFSVGGAITTSKATVYTGGLKYDANNIYLAAQYSQTYAQNFEVVAQYQFDFGLRPSVAYLQSKGKDISNGYGASYGDQDIVKYVDVGATYYFNKNMSTYVDYKINLLDKNDFTRDAGINTDDIVALGLVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein C
publication title Crystal Structure of Outer membrane protein OmpC from Salmonella typhi.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 65
structure length 298
sequence length 357
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3uu2A00
4LSFA 2XE3A 8PRNA 2Y0HA 1GFOA 1GFNA 4GCQA 4GCSA 2XE5A 4AUIA 4FRXA 4D5UA 1OPFA 5PRNA 4C69X 4D65A 1BT9A 3SZVA 3WI4A 1MPFA 3SZDA 5FVNA 3POQA 4LSHA 7PRNA 3SYSA 2XE1A 3T20A 4KR8A 1E54A 3A2SX 2PORA 3SY9A 2ODJA 5DL6A 3O0EA 3VY8X 4D64A 2QTKA 1OSMA 2OMFA 1GFMA 2K4TA 3JTYA 3UPGA 4FOZA 3K19A 2J4UP 2ZLDA 1HXXA 1GFPA 3WI5A 3NSGA 3SYBA 2ZFGA 1HXUA 2XE2A 1PHOA 3POUA 3VZUX 3HWBA 3T24A 6PRNA 3FYXA 4BUMX 2FGQX 3POXA 4LSEA 3VZWX 5JDPA 2O4VA 1BH3A 4JFBA 2J1NA 3PRNA 4KR4A 4FSPA 4KRAA 3UU2A 1HXTA 1H6S1 2PRNA 5DL7A 4FMSA 2Y0KA 3EMNX 2XG6A 4FRTA 3PORA 4GCPA 3T0SA 4FT6A 3SY7A 4FSOA 2Y0LA 4RJWA 3VZTX 5DL5A 2Y2XA 3HW9A 1GFQA 3VY9X 5DL8A 1PRNA 4LSIA 2FGRA 4RJXA
chains in the Genus database with same CATH superfamily
5KAIO 4LSFA 2XE3A 4PJ0O 8PRNA 1ZHXA 2N2MA 2Y0HA 3PF1A 1GFOA 1GFNA 4GCQA 4GCSA 5D5DA 4U9CA 5G39A 4N74A 1S5LO 3AAAB 2XE5A 4RLCA 4AUIA 4FRXA 4D5UA 5AFUK 3A0HO 2JQYA 3DWNA 3V8UA 5ADXK 1OPFA 5KAFO 3POUA 1MM5A 5IYUA 3DA4A 2KDYA 3NJTA 2M06A 2M07A 5PRNA 3AAEA 4C69X 2KXPA 4D65A 4AKRA 2R89A 4O4UA 4G76A 5B66O 1BT9A 3SZVA 4C4VA 3WI4A 4O4XA 1T1LA 4GHBA 4B61A 3BS0A 5H2FO 1MPFA 3SZDA 2F1CX 4AYMC 5FVNA 3DWOX 2W80C 4AYDC 3POQA 4AYNA 4LSHA 1YS5A 2X27X 3AA0B 3LK41 3AA7B 3GP6A 3PQSA 4FUVA 4RJXA 2XE1A 3SYSA 3T20A 4KR8A 4AYEC 4E1TA 4AKRB 1E54A 3A2SX 2PORA 3PQUA 3G7GA 2ODJA 4N58A 5DL6A 3SY9A 3TZGA 2WJQA 3O0EA 2AXTO 3PGSA 4FZMA 3VY8X 4C00A 4C4VB 4D64A 2QTKA 3LK3B 4O3XB 1OSMA 1G90A 5EE2A 4Z3TA 5GTHO 3DZMA 2OMFA 2R88A 5AFUL 3AA1A 3AA6A 4GF4A 5ADXL 2IWVA 1GFMA 4FZLA 1ZHZA 2K4TA 4XNLA 3JTYA 2R4OA 4AYID 1BXWA 4O3ZA 3UPGA 3VE2A 4FOZA 3LK2A 5G3AA 3K19A 4N59A 1Q9GA 1QJPA 1IZNA 2J4UP 2ZLDA 2X9KA 2JMMA 4K3CA 1HXXA 1GFPA 2MHLA 3HOLA 3JCUO 3PGRA 3WI5A 5G26A 3NSGA 4AZLA 3SYBA 2ZFGA 1HXUA 2XE2A 1PHOA 1P4TA 1THQA 3AAEB 3HWBA 2KXPB 3PGUA 1ZHYA 4O49A 4O3YA 5T5FA 3T24A 3VZUX 2WJRA 2XMXA 5B5EO 5E79O 2R8AA 2K0LA 6PRNA 3FYXA 4BUMX 3QRCA 4N75A 4O3WA 5GTIO 3KVDD 2FGQX 3POXA 2KZ7A 4LSEA 4RLBA 1ZHWA 2WVPA 2YNKA 3HOEA 2MNHA 3C5OA 2IWWA 3UAQA 2LFUA 2LHFA 4FZNA 3KZIO 4UB8O 3VZWX 3WU2O 4E1SA 5JDPA 5GV0A 2O4VA 1BH3A 4JFBA 1QJ9A 3AAAA 2GE4A 4FESA 2J1NA 3DA3A 4UB6O 4AFKA 4PUXA 3PRNA 4KR4A 4FSPA 4KRAA 3UU2A 1HXTA 2W81C 1H6S1 2PRNA 2R4LA 4FQEA 5DL7A 2Y0KA 4FMSA 2KZ7B 5TISO 3EMNX 2XG6A 3AA1B 4FRTA 2F1VA 3AA6B 4JCHA 3PORA 1T16A 4GCPA 3T0SA 1MM4A 2F1TA 2Y7SA 4G75A 4F4BA 4FT6A 4PR7A 4RL9A 2XTQA 2N2LA 3BRZA 3SY7A 7PRNA 4FSOA 4QQ1A 2R4PA 2Y0LA 3AA0A 1Q9FA 3LK2B 3AA7A 4RJWA 4XNKA 1IZNB 2KC0A 3VZTX 5DL5A 2R4NA 3VE1A 1ORMA 2Y2XA 1ZHTA 3HW9A 4AKMA 5G38A 3LK42 1GFQA 2XTRA 3LK3A 4CTDA 1QJ8A 2YPVA 3VY9X 5DL8A 1PRNA 4K3BA 4LSIA 4IL6O 3QRAA 3RBHA 2FGRA 2ERVA 3A0BO 3BRYA
chains in the Genus database with same CATH topology
4LSFA 2XE3A 8PRNA 1ZHXA 2N2MA 2Y0HA 1GFOA 1GFNA 4GCQA 4GCSA 5D5DA 4U9CA 3AAAB 2XE5A 4RLCA 4AUIA 4FRXA 4D5UA 5AFUK 3V8UA 5ADXK 1OPFA 1MM5A 5IYUA 3DA4A 2KDYA 2M06A 2M07A 5PRNA 3AAEA 4C69X 2KXPA 4D65A 4AKRA 4O4UA 4G76A 1BT9A 3SZVA 3WI4A 4O4XA 4GHBA 4B61A 1MPFA 3SZDA 4AYMC 5FVNA 4AYDC 2W80C 4AYNA 3POQA 4LSHA 1YS5A 2X27X 3AA0B 3LK41 3AA7B 3GP6A 3PQSA 4FUVA 3SYSA 2XE1A 3T20A 4KR8A 4AYEC 4E1TA 4AKRB 1E54A 3A2SX 2PORA 3PQUA 3G7GA 2ODJA 4N58A 5DL6A 3SY9A 3TZGA 3O0EA 3VY8X 4FZMA 4D64A 4F4BA 2QTKA 3LK3B 4O3XB 1OSMA 1G90A 5EE2A 4Z3TA 2OMFA 5AFUL 3AA1A 3AA6A 4GF4A 5ADXL 1GFMA 4FZLA 1ZHZA 2K4TA 4XNLA 3JTYA 4AYID 1BXWA 4O3ZA 3UPGA 3VE2A 4FOZA 3LK2A 3K19A 4N59A 1Q9GA 1QJPA 1IZNA 2J4UP 2ZLDA 2JMMA 1HXXA 1GFPA 2MHLA 3HOLA 3WI5A 5G26A 3NSGA 4AZLA 3SYBA 2ZFGA 1HXUA 2XE2A 1PHOA 1P4TA 1THQA 3AAEB 3HWBA 2KXPB 3POUA 1ZHYA 4O49A 4O3YA 5T5FA 3T24A 3VZUX 2XMXA 6PRNA 2K0LA 3FYXA 4BUMX 3QRCA 4O3WA 3KVDD 2FGQX 3POXA 2KZ7A 4LSEA 4RLBA 1ZHWA 2YNKA 3HOEA 2MNHA 3C5OA 3UAQA 2LFUA 2LHFA 4FZNA 3VZWX 4E1SA 5JDPA 5GV0A 2O4VA 1BH3A 4JFBA 1QJ9A 3AAAA 2GE4A 4FESA 2J1NA 3DA3A 4AFKA 4PUXA 3PRNA 4KR4A 4FSPA 4KRAA 3UU2A 1HXTA 2W81C 1H6S1 2PRNA 5DL7A 2Y0KA 4FMSA 2KZ7B 3EMNX 2XG6A 3AA1B 4FRTA 2F1VA 3AA6B 4JCHA 3PORA 4GCPA 3T0SA 1MM4A 2F1TA 2Y7SA 4G75A 4FT6A 4RL9A 2XTQA 2N2LA 3SY7A 7PRNA 4FSOA 4QQ1A 2Y0LA 3LK2B 3AA0A 1Q9FA 3AA7A 4RJWA 4XNKA 1IZNB 2KC0A 3VZTX 5DL5A 3VE1A 1ORMA 2Y2XA 1ZHTA 3HW9A 4AKMA 3LK42 1GFQA 2XTRA 3LK3A 1QJ8A 2YPVA 3VY9X 5DL8A 1PRNA 4LSIA 3RBHA 3QRAA 2FGRA 2ERVA 4RJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSF A;  2XE3 A;  8PRN A;  2Y0H A;  1GFO A;  1GFN A;  4GCQ A;  4GCS A;  2XE5 A;  4AUI A;  4FRX A;  4D5U A;  1OPF A;  5PRN A;  4C69 X;  4D65 A;  1BT9 A;  3SZV A;  3WI4 A;  1MPF A;  3SZD A;  5FVN A;  3POQ A;  4LSH A;  7PRN A;  3SYS A;  2XE1 A;  3T20 A;  4KR8 A;  1E54 A;  3A2S X;  2POR A;  3SY9 A;  2ODJ A;  5DL6 A;  3O0E A;  3VY8 X;  4D64 A;  2QTK A;  1OSM A;  2OMF A;  1GFM A;  2K4T A;  3JTY A;  3UPG A;  4FOZ A;  3K19 A;  2J4U P;  2ZLD A;  1HXX A;  1GFP A;  3WI5 A;  3NSG A;  3SYB A;  2ZFG A;  1HXU A;  2XE2 A;  1PHO A;  3POU A;  3VZU X;  3HWB A;  3T24 A;  6PRN A;  3FYX A;  4BUM X;  2FGQ X;  3POX A;  4LSE A;  3VZW X;  5JDP A;  2O4V A;  1BH3 A;  4JFB A;  2J1N A;  3PRN A;  4KR4 A;  4FSP A;  4KRA A;  3UU2 A;  1HXT A;  1H6S 1;  2PRN A;  5DL7 A;  4FMS A;  2Y0K A;  3EMN X;  2XG6 A;  4FRT A;  3POR A;  4GCP A;  3T0S A;  4FT6 A;  3SY7 A;  4FSO A;  2Y0L A;  4RJW A;  3VZT X;  5DL5 A;  2Y2X A;  3HW9 A;  1GFQ A;  3VY9 X;  5DL8 A;  1PRN A;  4LSI A;  2FGR A;  4RJX A; 
#chains in the Genus database with same CATH topology
 5KAI O;  4LSF A;  2XE3 A;  4PJ0 O;  8PRN A;  1ZHX A;  2N2M A;  2Y0H A;  3PF1 A;  1GFO A;  1GFN A;  4GCQ A;  4GCS A;  5D5D A;  4U9C A;  5G39 A;  4N74 A;  1S5L O;  3AAA B;  2XE5 A;  4RLC A;  4AUI A;  4FRX A;  4D5U A;  5AFU K;  3A0H O;  2JQY A;  3DWN A;  3V8U A;  5ADX K;  1OPF A;  5KAF O;  3POU A;  1MM5 A;  5IYU A;  3DA4 A;  2KDY A;  3NJT A;  2M06 A;  2M07 A;  5PRN A;  3AAE A;  4C69 X;  2KXP A;  4D65 A;  4AKR A;  2R89 A;  4O4U A;  4G76 A;  5B66 O;  1BT9 A;  3SZV A;  4C4V A;  3WI4 A;  4O4X A;  1T1L A;  4GHB A;  4B61 A;  3BS0 A;  5H2F O;  1MPF A;  3SZD A;  2F1C X;  4AYM C;  5FVN A;  3DWO X;  2W80 C;  4AYD C;  3POQ A;  4AYN A;  4LSH A;  1YS5 A;  2X27 X;  3AA0 B;  3LK4 1;  3AA7 B;  3GP6 A;  3PQS A;  4FUV A;  4RJX A;  2XE1 A;  3SYS A;  3T20 A;  4KR8 A;  4AYE C;  4E1T A;  4AKR B;  1E54 A;  3A2S X;  2POR A;  3PQU A;  3G7G A;  2ODJ A;  4N58 A;  5DL6 A;  3SY9 A;  3TZG A;  2WJQ A;  3O0E A;  2AXT O;  3PGS A;  4FZM A;  3VY8 X;  4C00 A;  4C4V B;  4D64 A;  2QTK A;  3LK3 B;  4O3X B;  1OSM A;  1G90 A;  5EE2 A;  4Z3T A;  5GTH O;  3DZM A;  2OMF A;  2R88 A;  5AFU L;  3AA1 A;  3AA6 A;  4GF4 A;  5ADX L;  2IWV A;  1GFM A;  4FZL A;  1ZHZ A;  2K4T A;  4XNL A;  3JTY A;  2R4O A;  4AYI D;  1BXW A;  4O3Z A;  3UPG A;  3VE2 A;  4FOZ A;  3LK2 A;  5G3A A;  3K19 A;  4N59 A;  1Q9G A;  1QJP A;  1IZN A;  2J4U P;  2ZLD A;  2X9K A;  2JMM A;  4K3C A;  1HXX A;  1GFP A;  2MHL A;  3HOL A;  3JCU O;  3PGR A;  3WI5 A;  5G26 A;  3NSG A;  4AZL A;  3SYB A;  2ZFG A;  1HXU A;  2XE2 A;  1PHO A;  1P4T A;  1THQ A;  3AAE B;  3HWB A;  2KXP B;  3PGU A;  1ZHY A;  4O49 A;  4O3Y A;  5T5F A;  3T24 A;  3VZU X;  2WJR A;  2XMX A;  5B5E O;  5E79 O;  2R8A A;  2K0L A;  6PRN A;  3FYX A;  4BUM X;  3QRC A;  4N75 A;  4O3W A;  5GTI O;  3KVD D;  2FGQ X;  3POX A;  2KZ7 A;  4LSE A;  4RLB A;  1ZHW A;  2WVP A;  2YNK A;  3HOE A;  2MNH A;  3C5O A;  2IWW A;  3UAQ A;  2LFU A;  2LHF A;  4FZN A;  3KZI O;  4UB8 O;  3VZW X;  3WU2 O;  4E1S A;  5JDP A;  5GV0 A;  2O4V A;  1BH3 A;  4JFB A;  1QJ9 A;  3AAA A;  2GE4 A;  4FES A;  2J1N A;  3DA3 A;  4UB6 O;  4AFK A;  4PUX A;  3PRN A;  4KR4 A;  4FSP A;  4KRA A;  3UU2 A;  1HXT A;  2W81 C;  1H6S 1;  2PRN A;  2R4L A;  4FQE A;  5DL7 A;  2Y0K A;  4FMS A;  2KZ7 B;  5TIS O;  3EMN X;  2XG6 A;  3AA1 B;  4FRT A;  2F1V A;  3AA6 B;  4JCH A;  3POR A;  1T16 A;  4GCP A;  3T0S A;  1MM4 A;  2F1T A;  2Y7S A;  4G75 A;  4F4B A;  4FT6 A;  4PR7 A;  4RL9 A;  2XTQ A;  2N2L A;  3BRZ A;  3SY7 A;  7PRN A;  4FSO A;  4QQ1 A;  2R4P A;  2Y0L A;  3AA0 A;  1Q9F A;  3LK2 B;  3AA7 A;  4RJW A;  4XNK A;  1IZN B;  2KC0 A;  3VZT X;  5DL5 A;  2R4N A;  3VE1 A;  1ORM A;  2Y2X A;  1ZHT A;  3HW9 A;  4AKM A;  5G38 A;  3LK4 2;  1GFQ A;  2XTR A;  3LK3 A;  4CTD A;  1QJ8 A;  2YPV A;  3VY9 X;  5DL8 A;  1PRN A;  4K3B A;  4LSI A;  4IL6 O;  3QRA A;  3RBH A;  2FGR A;  2ERV A;  3A0B O;  3BRY A; 
#chains in the Genus database with same CATH homology
 4LSF A;  2XE3 A;  8PRN A;  1ZHX A;  2N2M A;  2Y0H A;  1GFO A;  1GFN A;  4GCQ A;  4GCS A;  5D5D A;  4U9C A;  3AAA B;  2XE5 A;  4RLC A;  4AUI A;  4FRX A;  4D5U A;  5AFU K;  3V8U A;  5ADX K;  1OPF A;  1MM5 A;  5IYU A;  3DA4 A;  2KDY A;  2M06 A;  2M07 A;  5PRN A;  3AAE A;  4C69 X;  2KXP A;  4D65 A;  4AKR A;  4O4U A;  4G76 A;  1BT9 A;  3SZV A;  3WI4 A;  4O4X A;  4GHB A;  4B61 A;  1MPF A;  3SZD A;  4AYM C;  5FVN A;  4AYD C;  2W80 C;  4AYN A;  3POQ A;  4LSH A;  1YS5 A;  2X27 X;  3AA0 B;  3LK4 1;  3AA7 B;  3GP6 A;  3PQS A;  4FUV A;  3SYS A;  2XE1 A;  3T20 A;  4KR8 A;  4AYE C;  4E1T A;  4AKR B;  1E54 A;  3A2S X;  2POR A;  3PQU A;  3G7G A;  2ODJ A;  4N58 A;  5DL6 A;  3SY9 A;  3TZG A;  3O0E A;  3VY8 X;  4FZM A;  4D64 A;  4F4B A;  2QTK A;  3LK3 B;  4O3X B;  1OSM A;  1G90 A;  5EE2 A;  4Z3T A;  2OMF A;  5AFU L;  3AA1 A;  3AA6 A;  4GF4 A;  5ADX L;  1GFM A;  4FZL A;  1ZHZ A;  2K4T A;  4XNL A;  3JTY A;  4AYI D;  1BXW A;  4O3Z A;  3UPG A;  3VE2 A;  4FOZ A;  3LK2 A;  3K19 A;  4N59 A;  1Q9G A;  1QJP A;  1IZN A;  2J4U P;  2ZLD A;  2JMM A;  1HXX A;  1GFP A;  2MHL A;  3HOL A;  3WI5 A;  5G26 A;  3NSG A;  4AZL A;  3SYB A;  2ZFG A;  1HXU A;  2XE2 A;  1PHO A;  1P4T A;  1THQ A;  3AAE B;  3HWB A;  2KXP B;  3POU A;  1ZHY A;  4O49 A;  4O3Y A;  5T5F A;  3T24 A;  3VZU X;  2XMX A;  6PRN A;  2K0L A;  3FYX A;  4BUM X;  3QRC A;  4O3W A;  3KVD D;  2FGQ X;  3POX A;  2KZ7 A;  4LSE A;  4RLB A;  1ZHW A;  2YNK A;  3HOE A;  2MNH A;  3C5O A;  3UAQ A;  2LFU A;  2LHF A;  4FZN A;  3VZW X;  4E1S A;  5JDP A;  5GV0 A;  2O4V A;  1BH3 A;  4JFB A;  1QJ9 A;  3AAA A;  2GE4 A;  4FES A;  2J1N A;  3DA3 A;  4AFK A;  4PUX A;  3PRN A;  4KR4 A;  4FSP A;  4KRA A;  3UU2 A;  1HXT A;  2W81 C;  1H6S 1;  2PRN A;  5DL7 A;  2Y0K A;  4FMS A;  2KZ7 B;  3EMN X;  2XG6 A;  3AA1 B;  4FRT A;  2F1V A;  3AA6 B;  4JCH A;  3POR A;  4GCP A;  3T0S A;  1MM4 A;  2F1T A;  2Y7S A;  4G75 A;  4FT6 A;  4RL9 A;  2XTQ A;  2N2L A;  3SY7 A;  7PRN A;  4FSO A;  4QQ1 A;  2Y0L A;  3LK2 B;  3AA0 A;  1Q9F A;  3AA7 A;  4RJW A;  4XNK A;  1IZN B;  2KC0 A;  3VZT X;  5DL5 A;  3VE1 A;  1ORM A;  2Y2X A;  1ZHT A;  3HW9 A;  4AKM A;  3LK4 2;  1GFQ A;  2XTR A;  3LK3 A;  1QJ8 A;  2YPV A;  3VY9 X;  5DL8 A;  1PRN A;  4LSI A;  3RBH A;  3QRA A;  2FGR A;  2ERV A;  4RJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...