2N2LA

Nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles calculated with implicit membrane solvation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
b'EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2n2lA00
1THQA 2F1VA 2N2MA 3GP6A 1Q9GA 2K0LA 3QRCA 1MM4A 1BXWA 4RLCA 1Q9FA 3C5OA 3G7GA 2N2LA 1P4TA 4PUXA 2MNHA 2LHFA 2JMMA 1MM5A 2MHLA 2X27X 2M07A 1QJ9A 1QJPA 1QJ8A 2ERVA 3QRAA 1ORMA 1G90A 2M06A 2GE4A 2F1TA
chains in the Genus database with same CATH superfamily
5DL8A 4FUVA 5G26A 1ZHXA 4QQ1A 4GHBA 2Y2XA 3SZDA 2KXPA 4AYDC 1BT9A 4LSFA 4UB8O 5PRNA 7PRNA 3BRZA 3PQSA 3AAAB 2FGQX 1IZNB 1Q9FA 1PHOA 3DA3A 3FYXA 2KDYA 3A2SX 3JTYA 3LK41 3VZUX 2MNHA 4N59A 3VE1A 3VZTX 3AA6B 4RLBA 4AYID 2LHFA 1T1LA 3PRNA 5GTIO 4FZMA 2X9KA 5DL7A 2JMMA 1MM5A 4AKMA 2KZ7B 2IWWA 2KC0A 2X27X 1OSMA 4AYNA 4JCHA 3VZWX 4G75A 3V8UA 1QJ9A 1QJPA 3AA6A 4AYEC 2ERVA 3JCUO 3SY7A 3SY9A 3WU2O 1T16A 2QTKA 4N75A 2XE2A 3BRYA 3EMNX 2W81C 4FRXA 4AYMC 4D64A 3UPGA 5ADXK 3POUA 2F1VA 3O0EA 2JQYA 2Y0LA 2N2MA 4FQEA 4JFBA 4N58A 5T5FA 3SYBA 1Q9GA 2Y7SA 3DWOX 4LSEA 3AA1A 3PGSA 4AKRB 3PORA 3PQUA 4FSOA 3POQA 4PR7A 2J4UP 5KAIO 3VY9X 2YNKA 2N2LA 2ZFGA 5E79O 4C69X 2R89A 5B5EO 4FT6A 2ZLDA 5ADXL 2R8AA 1MPFA 3WI4A 3KZIO 2XTQA 3PGUA 3SYSA 3UU2A 4AKRA 3NJTA 1ZHWA 4C00A 3AAAA 1GFMA 1IZNA 2XE5A 4GCQA 4GF4A 3AAEB 5FVNA 3VY8X 3DZMA 4AUIA 2WJRA 5GTHO 1QJ8A 4BUMX 2LFUA 2FGRA 2Y0HA 3QRAA 4UB6O 5B66O 2XMXA 4F4BA 2M06A 3HW9A 4GCPA 4Z3TA 8PRNA 2GE4A 3T20A 4N74A 2F1TA 5KAFO 2KZ7A 2ODJA 3AAEA 4RJXA 2XTRA 2YPVA 5GV0A 1GFPA 3LK2B 3PGRA 5H2FO 3GP6A 2PORA 3DWNA 4K3CA 4KR8A 5G39A 1H6S1 4O3YA 4O4UA 3AA0B 3G7GA 3BS0A 1P4TA 4FOZA 4O3XB 4PJ0O 2PRNA 4D5UA 3NSGA 4XNLA 4C4VB 1BH3A 3LK2A 3LK3B 4KR4A 3T24A 3A0BO 1HXXA 4O3WA 1ZHTA 4FZLA 3TZGA 4G76A 5EE2A 5AFUL 5JDPA 4AFKA 3POXA 2IWVA 4B61A 2AXTO 2J1NA 2W80C 4LSHA 5G38A 3HWBA 4FESA 4K3BA 3VE2A 2OMFA 4LSIA 4C4VA 4RJWA 2XE3A 2F1CX 1G90A 2R88A 2WJQA 2XG6A 4IL6O 1OPFA 2WVPA 3SZVA 5TISO 2R4LA 1PRNA 5DL6A 3AA7B 1THQA 2Y0KA 3LK42 2O4VA 3RBHA 3T0SA 4CTDA 3KVDD 1S5LO 4RL9A 2K0LA 3QRCA 1GFNA 3UAQA 1MM4A 1BXWA 1ZHZA 3PF1A 5AFUK 5G3AA 4RLCA 4U9CA 3C5OA 4O49A 4E1SA 6PRNA 1HXTA 4PUXA 1HXUA 2R4NA 2R4PA 3AA7A 5D5DA 3DA4A 3WI5A 3HOEA 1GFQA 4D65A 4FSPA 5DL5A 5IYUA 2MHLA 3A0HO 4FZNA 2M07A 3AA0A 3HOLA 4XNKA 1E54A 2K4TA 1ZHYA 4AZLA 1ORMA 2KXPB 2XE1A 3AA1B 3LK3A 4O3ZA 4E1TA 2R4OA 4GCSA 1GFOA 4FMSA 4FRTA 4KRAA 4O4XA 3K19A 1YS5A
chains in the Genus database with same CATH topology
5DL8A 4FUVA 5G26A 1ZHXA 4QQ1A 4GHBA 2Y2XA 3SZDA 2KXPA 4AYDC 1BT9A 4LSFA 5PRNA 7PRNA 3PQSA 6PRNA 3AAAB 2FGQX 1IZNB 1Q9FA 1PHOA 3DA3A 3FYXA 2KDYA 3A2SX 3JTYA 3LK41 3VZUX 2MNHA 4N59A 3VE1A 3VZTX 3AA6B 4RLBA 4AYID 2LHFA 3PRNA 4FZMA 5DL7A 2JMMA 1MM5A 4AKMA 2KZ7B 2KC0A 2X27X 1OSMA 4AYNA 4JCHA 3VZWX 4G75A 3V8UA 1QJ9A 1QJPA 3AA6A 4AYEC 2ERVA 3SY7A 3SY9A 2QTKA 2XE2A 3EMNX 2W81C 4FRXA 4AYMC 4D64A 3UPGA 5ADXK 3POUA 2F1VA 3O0EA 2Y0LA 4JFBA 2N2MA 4N58A 3SYBA 5T5FA 1Q9GA 2Y7SA 4LSEA 3AA1A 4AKRB 3PORA 3PQUA 4FSOA 3POQA 2J4UP 3VY9X 2YNKA 2N2LA 2ZFGA 4C69X 4FT6A 2ZLDA 5ADXL 1MPFA 3WI4A 3SYSA 2XTQA 4AKRA 3UU2A 1ZHWA 3AAAA 1GFMA 1IZNA 2XE5A 4GCQA 4GF4A 3AAEB 5FVNA 3VY8X 4AUIA 1QJ8A 4BUMX 2LFUA 2FGRA 2Y0HA 3QRAA 2XMXA 4F4BA 2M06A 3HW9A 4GCPA 4Z3TA 8PRNA 2GE4A 3T20A 2F1TA 2KZ7A 2ODJA 3AAEA 4RJXA 2XTRA 2YPVA 5GV0A 1GFPA 3LK2B 3GP6A 2PORA 4KR8A 1H6S1 4O3YA 4O4UA 3AA0B 3G7GA 4O3XB 1P4TA 4FOZA 2PRNA 4D5UA 3NSGA 4XNLA 1BH3A 3LK2A 3LK3B 4KR4A 3T24A 4O3WA 1HXXA 1ZHTA 4FZLA 3TZGA 4G76A 5EE2A 5AFUL 5JDPA 4AFKA 3POXA 4B61A 2W80C 2J1NA 4LSHA 3VE2A 3HWBA 4FESA 2OMFA 4LSIA 4RJWA 2XE3A 1G90A 2XG6A 1OPFA 3SZVA 1PRNA 5DL6A 3AA7B 1THQA 2Y0KA 3LK42 2O4VA 3RBHA 3T0SA 3KVDD 4RL9A 2K0LA 3QRCA 1GFNA 3UAQA 1MM4A 1BXWA 1ZHZA 5AFUK 4RLCA 4U9CA 3C5OA 4O49A 4E1SA 1HXTA 4PUXA 1HXUA 5D5DA 3AA7A 3WI5A 3DA4A 3HOEA 1GFQA 4D65A 4FSPA 5DL5A 5IYUA 2MHLA 4FZNA 2M07A 3AA0A 3HOLA 4XNKA 1E54A 2K4TA 1ZHYA 4AZLA 1ORMA 2KXPB 2XE1A 3AA1B 3LK3A 4O3ZA 4E1TA 4GCSA 1GFOA 4FMSA 4FRTA 4KRAA 4O4XA 3K19A 1YS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THQ A;  2F1V A;  2N2M A;  3GP6 A;  1Q9G A;  2K0L A;  3QRC A;  1MM4 A;  1BXW A;  4RLC A;  1Q9F A;  3C5O A;  3G7G A;  2N2L A;  1P4T A;  4PUX A;  2MNH A;  2LHF A;  2JMM A;  1MM5 A;  2MHL A;  2X27 X;  2M07 A;  1QJ9 A;  1QJP A;  1QJ8 A;  2ERV A;  3QRA A;  1ORM A;  1G90 A;  2M06 A;  2GE4 A;  2F1T A; 
#chains in the Genus database with same CATH topology
 5DL8 A;  4FUV A;  5G26 A;  1ZHX A;  4QQ1 A;  4GHB A;  2Y2X A;  3SZD A;  2KXP A;  4AYD C;  1BT9 A;  4LSF A;  4UB8 O;  5PRN A;  7PRN A;  3BRZ A;  3PQS A;  3AAA B;  2FGQ X;  1IZN B;  1Q9F A;  1PHO A;  3DA3 A;  3FYX A;  2KDY A;  3A2S X;  3JTY A;  3LK4 1;  3VZU X;  2MNH A;  4N59 A;  3VE1 A;  3VZT X;  3AA6 B;  4RLB A;  4AYI D;  2LHF A;  1T1L A;  3PRN A;  5GTI O;  4FZM A;  2X9K A;  5DL7 A;  2JMM A;  1MM5 A;  4AKM A;  2KZ7 B;  2IWW A;  2KC0 A;  2X27 X;  1OSM A;  4AYN A;  4JCH A;  3VZW X;  4G75 A;  3V8U A;  1QJ9 A;  1QJP A;  3AA6 A;  4AYE C;  2ERV A;  3JCU O;  3SY7 A;  3SY9 A;  3WU2 O;  1T16 A;  2QTK A;  4N75 A;  2XE2 A;  3BRY A;  3EMN X;  2W81 C;  4FRX A;  4AYM C;  4D64 A;  3UPG A;  5ADX K;  3POU A;  2F1V A;  3O0E A;  2JQY A;  2Y0L A;  2N2M A;  4FQE A;  4JFB A;  4N58 A;  5T5F A;  3SYB A;  1Q9G A;  2Y7S A;  3DWO X;  4LSE A;  3AA1 A;  3PGS A;  4AKR B;  3POR A;  3PQU A;  4FSO A;  3POQ A;  4PR7 A;  2J4U P;  5KAI O;  3VY9 X;  2YNK A;  2N2L A;  2ZFG A;  5E79 O;  4C69 X;  2R89 A;  5B5E O;  4FT6 A;  2ZLD A;  5ADX L;  2R8A A;  1MPF A;  3WI4 A;  3KZI O;  2XTQ A;  3PGU A;  3SYS A;  3UU2 A;  4AKR A;  3NJT A;  1ZHW A;  4C00 A;  3AAA A;  1GFM A;  1IZN A;  2XE5 A;  4GCQ A;  4GF4 A;  3AAE B;  5FVN A;  3VY8 X;  3DZM A;  4AUI A;  2WJR A;  5GTH O;  1QJ8 A;  4BUM X;  2LFU A;  2FGR A;  2Y0H A;  3QRA A;  4UB6 O;  5B66 O;  2XMX A;  4F4B A;  2M06 A;  3HW9 A;  4GCP A;  4Z3T A;  8PRN A;  2GE4 A;  3T20 A;  4N74 A;  2F1T A;  5KAF O;  2KZ7 A;  2ODJ A;  3AAE A;  4RJX A;  2XTR A;  2YPV A;  5GV0 A;  1GFP A;  3LK2 B;  3PGR A;  5H2F O;  3GP6 A;  2POR A;  3DWN A;  4K3C A;  4KR8 A;  5G39 A;  1H6S 1;  4O3Y A;  4O4U A;  3AA0 B;  3G7G A;  3BS0 A;  1P4T A;  4FOZ A;  4O3X B;  4PJ0 O;  2PRN A;  4D5U A;  3NSG A;  4XNL A;  4C4V B;  1BH3 A;  3LK2 A;  3LK3 B;  4KR4 A;  3T24 A;  3A0B O;  1HXX A;  4O3W A;  1ZHT A;  4FZL A;  3TZG A;  4G76 A;  5EE2 A;  5AFU L;  5JDP A;  4AFK A;  3POX A;  2IWV A;  4B61 A;  2AXT O;  2J1N A;  2W80 C;  4LSH A;  5G38 A;  3HWB A;  4FES A;  4K3B A;  3VE2 A;  2OMF A;  4LSI A;  4C4V A;  4RJW A;  2XE3 A;  2F1C X;  1G90 A;  2R88 A;  2WJQ A;  2XG6 A;  4IL6 O;  1OPF A;  2WVP A;  3SZV A;  5TIS O;  2R4L A;  1PRN A;  5DL6 A;  3AA7 B;  1THQ A;  2Y0K A;  3LK4 2;  2O4V A;  3RBH A;  3T0S A;  4CTD A;  3KVD D;  1S5L O;  4RL9 A;  2K0L A;  3QRC A;  1GFN A;  3UAQ A;  1MM4 A;  1BXW A;  1ZHZ A;  3PF1 A;  5AFU K;  5G3A A;  4RLC A;  4U9C A;  3C5O A;  4O49 A;  4E1S A;  6PRN A;  1HXT A;  4PUX A;  1HXU A;  2R4N A;  2R4P A;  3AA7 A;  5D5D A;  3DA4 A;  3WI5 A;  3HOE A;  1GFQ A;  4D65 A;  4FSP A;  5DL5 A;  5IYU A;  2MHL A;  3A0H O;  4FZN A;  2M07 A;  3AA0 A;  3HOL A;  4XNK A;  1E54 A;  2K4T A;  1ZHY A;  4AZL A;  1ORM A;  2KXP B;  2XE1 A;  3AA1 B;  3LK3 A;  4O3Z A;  4E1T A;  2R4O A;  4GCS A;  1GFO A;  4FMS A;  4FRT A;  4KRA A;  4O4X A;  3K19 A;  1YS5 A; 
#chains in the Genus database with same CATH homology
 5DL8 A;  4FUV A;  5G26 A;  1ZHX A;  4QQ1 A;  4GHB A;  2Y2X A;  3SZD A;  2KXP A;  4AYD C;  1BT9 A;  4LSF A;  5PRN A;  7PRN A;  3PQS A;  6PRN A;  3AAA B;  2FGQ X;  1IZN B;  1Q9F A;  1PHO A;  3DA3 A;  3FYX A;  2KDY A;  3A2S X;  3JTY A;  3LK4 1;  3VZU X;  2MNH A;  4N59 A;  3VE1 A;  3VZT X;  3AA6 B;  4RLB A;  4AYI D;  2LHF A;  3PRN A;  4FZM A;  5DL7 A;  2JMM A;  1MM5 A;  4AKM A;  2KZ7 B;  2KC0 A;  2X27 X;  1OSM A;  4AYN A;  4JCH A;  3VZW X;  4G75 A;  3V8U A;  1QJ9 A;  1QJP A;  3AA6 A;  4AYE C;  2ERV A;  3SY7 A;  3SY9 A;  2QTK A;  2XE2 A;  3EMN X;  2W81 C;  4FRX A;  4AYM C;  4D64 A;  3UPG A;  5ADX K;  3POU A;  2F1V A;  3O0E A;  2Y0L A;  4JFB A;  2N2M A;  4N58 A;  3SYB A;  5T5F A;  1Q9G A;  2Y7S A;  4LSE A;  3AA1 A;  4AKR B;  3POR A;  3PQU A;  4FSO A;  3POQ A;  2J4U P;  3VY9 X;  2YNK A;  2N2L A;  2ZFG A;  4C69 X;  4FT6 A;  2ZLD A;  5ADX L;  1MPF A;  3WI4 A;  3SYS A;  2XTQ A;  4AKR A;  3UU2 A;  1ZHW A;  3AAA A;  1GFM A;  1IZN A;  2XE5 A;  4GCQ A;  4GF4 A;  3AAE B;  5FVN A;  3VY8 X;  4AUI A;  1QJ8 A;  4BUM X;  2LFU A;  2FGR A;  2Y0H A;  3QRA A;  2XMX A;  4F4B A;  2M06 A;  3HW9 A;  4GCP A;  4Z3T A;  8PRN A;  2GE4 A;  3T20 A;  2F1T A;  2KZ7 A;  2ODJ A;  3AAE A;  4RJX A;  2XTR A;  2YPV A;  5GV0 A;  1GFP A;  3LK2 B;  3GP6 A;  2POR A;  4KR8 A;  1H6S 1;  4O3Y A;  4O4U A;  3AA0 B;  3G7G A;  4O3X B;  1P4T A;  4FOZ A;  2PRN A;  4D5U A;  3NSG A;  4XNL A;  1BH3 A;  3LK2 A;  3LK3 B;  4KR4 A;  3T24 A;  4O3W A;  1HXX A;  1ZHT A;  4FZL A;  3TZG A;  4G76 A;  5EE2 A;  5AFU L;  5JDP A;  4AFK A;  3POX A;  4B61 A;  2W80 C;  2J1N A;  4LSH A;  3VE2 A;  3HWB A;  4FES A;  2OMF A;  4LSI A;  4RJW A;  2XE3 A;  1G90 A;  2XG6 A;  1OPF A;  3SZV A;  1PRN A;  5DL6 A;  3AA7 B;  1THQ A;  2Y0K A;  3LK4 2;  2O4V A;  3RBH A;  3T0S A;  3KVD D;  4RL9 A;  2K0L A;  3QRC A;  1GFN A;  3UAQ A;  1MM4 A;  1BXW A;  1ZHZ A;  5AFU K;  4RLC A;  4U9C A;  3C5O A;  4O49 A;  4E1S A;  1HXT A;  4PUX A;  1HXU A;  5D5D A;  3AA7 A;  3WI5 A;  3DA4 A;  3HOE A;  1GFQ A;  4D65 A;  4FSP A;  5DL5 A;  5IYU A;  2MHL A;  4FZN A;  2M07 A;  3AA0 A;  3HOL A;  4XNK A;  1E54 A;  2K4T A;  1ZHY A;  4AZL A;  1ORM A;  2KXP B;  2XE1 A;  3AA1 B;  3LK3 A;  4O3Z A;  4E1T A;  4GCS A;  1GFO A;  4FMS A;  4FRT A;  4KRA A;  4O4X A;  3K19 A;  1YS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...