2N2LA

Nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles calculated with implicit membrane solvation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Membrane protein
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2n2lA00
1MM5A 3QRAA 1THQA 1G90A 2M07A 1Q9FA 4RLCA 2N2LA 4PUXA 3GP6A 2N2MA 2LHFA 2K0LA 2F1VA 1ORMA 1BXWA 1P4TA 3QRCA 2ERVA 1Q9GA 2MNHA 1QJ8A 2X27X 2F1TA 2MHLA 1MM4A 2M06A 3G7GA 2GE4A 3C5OA 2JMMA 1QJPA 1QJ9A
chains in the Genus database with same CATH superfamily
3HWBA 2Y7SA 3PGUA 4O3YA 5D5DA 3VZUX 1HXUA 3VY8X 4E1SA 3T0SA 4AKRA 3PRNA 4FQEA 4AKMA 4PUXA 5KAIO 2J4UP 2QTKA 1MPFA 2W80C 2LHFA 1S5LO 3PGSA 3AA1B 4O3WA 4O4XA 3DA3A 4FT6A 1BXWA 2KXPA 2XE1A 4GHBA 1YS5A 3AAAB 4K3CA 3QRCA 2Y2XA 4KR4A 3SY9A 3PQUA 4GCQA 5GTIO 2PRNA 2ERVA 1Q9GA 2XG6A 4O49A 1PRNA 5E79O 3RBHA 3T24A 3DWOX 4C4VB 3PQSA 2F1TA 6PRNA 2MHLA 1MM4A 5ADXK 4RJWA 2Y0LA 4FSPA 4LSEA 3JTYA 4AYDC 2X9KA 3V8UA 3A0BO 3POQA 4O4UA 2LFUA 4C00A 3C5OA 3KVDD 3SY7A 4AYNA 5PRNA 2KZ7B 3VZTX 2PORA 1PHOA 3PORA 4FZNA 2R4OA 4O3ZA 1MM5A 3AAEA 1BH3A 2ZFGA 1T1LA 3POXA 1GFPA 2XE5A 4RJXA 4RLCA 2R4LA 3SYBA 4AYID 3WI5A 2AXTO 2WVPA 3WU2O 3GP6A 3AA0A 2N2MA 3BRZA 1HXTA 3HW9A 3NJTA 4AUIA 1ZHYA 5DL5A 1IZNB 1ZHWA 3AA7B 5GV0A 4FZLA 2F1VA 2XMXA 4UB6O 3SYSA 2YPVA 4D64A 2ODJA 3DA4A 4N74A 2MNHA 5TISO 3PGRA 3LK41 3AA6A 3LK3A 1H6S1 1GFQA 2XE3A 4K3BA 4N59A 1ZHZA 4XNKA 4CTDA 3LK2A 4G76A 1T16A 5FVNA 4IL6O 3AAEB 4KR8A 4QQ1A 2J1NA 1GFOA 1E54A 4GCPA 5EE2A 5G26A 5G3AA 4AKRB 2JMMA 5KAFO 3AA0B 3POUA 4FRXA 4AZLA 5AFUL 5B66O 1OPFA 3QRAA 3FYXA 1ZHXA 1G90A 3PF1A 2M07A 4AFKA 2R4PA 2FGRA 5DL6A 2KXPB 2IWWA 3WI4A 5DL8A 3VE2A 4KRAA 3LK42 3O0EA 3VE1A 1BT9A 4FESA 3AA6B 2K0LA 4G75A 4BUMX 2R8AA 3JCUO 2KDYA 2W81C 2XTRA 1P4TA 1OSMA 3A0HO 3A2SX 3UPGA 5G39A 4O3XB 1QJ8A 2R89A 4E1TA 3BRYA 3HOLA 4RL9A 2R4NA 5T5FA 3UU2A 4AYEC 3BS0A 3KZIO 2R88A 2M06A 4UB8O 2GE4A 1GFMA 1HXXA 3T20A 4GF4A 4FSOA 3DZMA 4N58A 4D5UA 3K19A 4AYMC 2Y0KA 4GCSA 3VZWX 2ZLDA 3DWNA 1THQA 5G38A 5ADXL 2OMFA 2KC0A 1Q9FA 3SZVA 2KZ7A 2N2LA 4PJ0O 3VY9X 4B61A 7PRNA 3NSGA 3TZGA 4FRTA 4F4BA 8PRNA 2F1CX 4FOZA 4C69X 2FGQX 3SZDA 2WJQA 1ORMA 4JCHA 3LK3B 2JQYA 4JFBA 4FMSA 2WJRA 2XE2A 4LSFA 2Y0HA 4Z3TA 4RLBA 3LK2B 1IZNA 4U9CA 3AA7A 4PR7A 2O4VA 2X27X 4LSIA 5JDPA 2IWVA 3AA1A 4D65A 5AFUK 5GTHO 4FUVA 4FZMA 3AAAA 3UAQA 1ZHTA 3EMNX 5B5EO 2K4TA 3G7GA 3HOEA 4C4VA 1GFNA 4N75A 2YNKA 4XNLA 5IYUA 1QJPA 2XTQA 4LSHA 1QJ9A 5DL7A 5H2FO
chains in the Genus database with same CATH topology
3HWBA 2Y7SA 4O3YA 5D5DA 3VZUX 1HXUA 3VY8X 4E1SA 3T0SA 4AKRA 3PRNA 4AKMA 4PUXA 2J4UP 2QTKA 1MPFA 2W80C 2LHFA 3AA1B 4O3WA 4O4XA 3DA3A 4FT6A 1BXWA 2KXPA 2XE1A 4GHBA 1YS5A 3AAAB 4KR4A 3QRCA 2Y2XA 3SY9A 3PQUA 4GCQA 5PRNA 2PRNA 2ERVA 1Q9GA 2XG6A 4O49A 1PRNA 3RBHA 3T24A 3PQSA 2F1TA 6PRNA 2MHLA 1MM4A 5ADXK 4RJWA 2Y0LA 4FSPA 4LSEA 3JTYA 4AYDC 3V8UA 4O4UA 3POQA 2LFUA 3C5OA 3KVDD 3SY7A 4AYNA 2KZ7B 3VZTX 2PORA 1PHOA 3PORA 4FZNA 4O3ZA 1MM5A 3AAEA 1BH3A 2ZFGA 3POXA 1GFPA 2XE5A 4RJXA 4RLCA 3SYBA 4AYID 3WI5A 3UPGA 3GP6A 3AA0A 2N2MA 1HXTA 3HW9A 4AUIA 5GV0A 1ZHYA 5DL5A 1IZNB 1ZHWA 3AA7B 4FZLA 2F1VA 2XMXA 3SYSA 2YPVA 4D64A 2ODJA 3DA4A 2MNHA 3LK41 3AA6A 3LK3A 1H6S1 1GFQA 2XE3A 4N59A 1ZHZA 4XNKA 3LK2A 4G76A 5FVNA 3AAEB 4KR8A 4QQ1A 2J1NA 1GFOA 1E54A 4GCPA 5EE2A 5G26A 4AKRB 2JMMA 3AA0B 3POUA 4FRXA 4AZLA 5AFUL 1OPFA 3QRAA 3FYXA 1ZHXA 1G90A 4AFKA 2M07A 2FGRA 5DL6A 2KXPB 3WI4A 5DL8A 3VE2A 4KRAA 3LK42 3O0EA 3VE1A 1BT9A 4FESA 3AA6B 2K0LA 4G75A 4BUMX 2KDYA 2W81C 2XTRA 1P4TA 1OSMA 3A2SX 4O3XB 1QJ8A 4E1TA 4RL9A 3HOLA 5T5FA 3UU2A 4AYEC 2M06A 2GE4A 1GFMA 1HXXA 3T20A 4GF4A 4FSOA 4N58A 4D5UA 3K19A 4AYMC 2Y0KA 4GCSA 3VZWX 2ZLDA 5ADXL 1THQA 2OMFA 2KC0A 1Q9FA 3SZVA 2KZ7A 2N2LA 4B61A 3VY9X 7PRNA 3NSGA 3TZGA 4FRTA 4F4BA 8PRNA 4FOZA 4C69X 2FGQX 3SZDA 1ORMA 4JCHA 3LK3B 4JFBA 4FMSA 4LSFA 2XE2A 4Z3TA 2Y0HA 4RLBA 3LK2B 1IZNA 4U9CA 3AA7A 2O4VA 2X27X 4LSIA 5JDPA 3AA1A 4D65A 5AFUK 4FUVA 4FZMA 3AAAA 3UAQA 1ZHTA 3EMNX 2K4TA 3G7GA 3HOEA 1GFNA 5IYUA 2YNKA 4XNLA 1QJPA 2XTQA 4LSHA 1QJ9A 5DL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM5 A;  3QRA A;  1THQ A;  1G90 A;  2M07 A;  1Q9F A;  4RLC A;  2N2L A;  4PUX A;  3GP6 A;  2N2M A;  2LHF A;  2K0L A;  2F1V A;  1ORM A;  1BXW A;  1P4T A;  3QRC A;  2ERV A;  1Q9G A;  2MNH A;  1QJ8 A;  2X27 X;  2F1T A;  2MHL A;  1MM4 A;  2M06 A;  3G7G A;  2GE4 A;  3C5O A;  2JMM A;  1QJP A;  1QJ9 A; 
#chains in the Genus database with same CATH topology
 3HWB A;  2Y7S A;  3PGU A;  4O3Y A;  5D5D A;  3VZU X;  1HXU A;  3VY8 X;  4E1S A;  3T0S A;  4AKR A;  3PRN A;  4FQE A;  4AKM A;  4PUX A;  5KAI O;  2J4U P;  2QTK A;  1MPF A;  2W80 C;  2LHF A;  1S5L O;  3PGS A;  3AA1 B;  4O3W A;  4O4X A;  3DA3 A;  4FT6 A;  1BXW A;  2KXP A;  2XE1 A;  4GHB A;  1YS5 A;  3AAA B;  4K3C A;  3QRC A;  2Y2X A;  4KR4 A;  3SY9 A;  3PQU A;  4GCQ A;  5GTI O;  2PRN A;  2ERV A;  1Q9G A;  2XG6 A;  4O49 A;  1PRN A;  5E79 O;  3RBH A;  3T24 A;  3DWO X;  4C4V B;  3PQS A;  2F1T A;  6PRN A;  2MHL A;  1MM4 A;  5ADX K;  4RJW A;  2Y0L A;  4FSP A;  4LSE A;  3JTY A;  4AYD C;  2X9K A;  3V8U A;  3A0B O;  3POQ A;  4O4U A;  2LFU A;  4C00 A;  3C5O A;  3KVD D;  3SY7 A;  4AYN A;  5PRN A;  2KZ7 B;  3VZT X;  2POR A;  1PHO A;  3POR A;  4FZN A;  2R4O A;  4O3Z A;  1MM5 A;  3AAE A;  1BH3 A;  2ZFG A;  1T1L A;  3POX A;  1GFP A;  2XE5 A;  4RJX A;  4RLC A;  2R4L A;  3SYB A;  4AYI D;  3WI5 A;  2AXT O;  2WVP A;  3WU2 O;  3GP6 A;  3AA0 A;  2N2M A;  3BRZ A;  1HXT A;  3HW9 A;  3NJT A;  4AUI A;  1ZHY A;  5DL5 A;  1IZN B;  1ZHW A;  3AA7 B;  5GV0 A;  4FZL A;  2F1V A;  2XMX A;  4UB6 O;  3SYS A;  2YPV A;  4D64 A;  2ODJ A;  3DA4 A;  4N74 A;  2MNH A;  5TIS O;  3PGR A;  3LK4 1;  3AA6 A;  3LK3 A;  1H6S 1;  1GFQ A;  2XE3 A;  4K3B A;  4N59 A;  1ZHZ A;  4XNK A;  4CTD A;  3LK2 A;  4G76 A;  1T16 A;  5FVN A;  4IL6 O;  3AAE B;  4KR8 A;  4QQ1 A;  2J1N A;  1GFO A;  1E54 A;  4GCP A;  5EE2 A;  5G26 A;  5G3A A;  4AKR B;  2JMM A;  5KAF O;  3AA0 B;  3POU A;  4FRX A;  4AZL A;  5AFU L;  5B66 O;  1OPF A;  3QRA A;  3FYX A;  1ZHX A;  1G90 A;  3PF1 A;  2M07 A;  4AFK A;  2R4P A;  2FGR A;  5DL6 A;  2KXP B;  2IWW A;  3WI4 A;  5DL8 A;  3VE2 A;  4KRA A;  3LK4 2;  3O0E A;  3VE1 A;  1BT9 A;  4FES A;  3AA6 B;  2K0L A;  4G75 A;  4BUM X;  2R8A A;  3JCU O;  2KDY A;  2W81 C;  2XTR A;  1P4T A;  1OSM A;  3A0H O;  3A2S X;  3UPG A;  5G39 A;  4O3X B;  1QJ8 A;  2R89 A;  4E1T A;  3BRY A;  3HOL A;  4RL9 A;  2R4N A;  5T5F A;  3UU2 A;  4AYE C;  3BS0 A;  3KZI O;  2R88 A;  2M06 A;  4UB8 O;  2GE4 A;  1GFM A;  1HXX A;  3T20 A;  4GF4 A;  4FSO A;  3DZM A;  4N58 A;  4D5U A;  3K19 A;  4AYM C;  2Y0K A;  4GCS A;  3VZW X;  2ZLD A;  3DWN A;  1THQ A;  5G38 A;  5ADX L;  2OMF A;  2KC0 A;  1Q9F A;  3SZV A;  2KZ7 A;  2N2L A;  4PJ0 O;  3VY9 X;  4B61 A;  7PRN A;  3NSG A;  3TZG A;  4FRT A;  4F4B A;  8PRN A;  2F1C X;  4FOZ A;  4C69 X;  2FGQ X;  3SZD A;  2WJQ A;  1ORM A;  4JCH A;  3LK3 B;  2JQY A;  4JFB A;  4FMS A;  2WJR A;  2XE2 A;  4LSF A;  2Y0H A;  4Z3T A;  4RLB A;  3LK2 B;  1IZN A;  4U9C A;  3AA7 A;  4PR7 A;  2O4V A;  2X27 X;  4LSI A;  5JDP A;  2IWV A;  3AA1 A;  4D65 A;  5AFU K;  5GTH O;  4FUV A;  4FZM A;  3AAA A;  3UAQ A;  1ZHT A;  3EMN X;  5B5E O;  2K4T A;  3G7G A;  3HOE A;  4C4V A;  1GFN A;  4N75 A;  2YNK A;  4XNL A;  5IYU A;  1QJP A;  2XTQ A;  4LSH A;  1QJ9 A;  5DL7 A;  5H2F O; 
#chains in the Genus database with same CATH homology
 3HWB A;  2Y7S A;  4O3Y A;  5D5D A;  3VZU X;  1HXU A;  3VY8 X;  4E1S A;  3T0S A;  4AKR A;  3PRN A;  4AKM A;  4PUX A;  2J4U P;  2QTK A;  1MPF A;  2W80 C;  2LHF A;  3AA1 B;  4O3W A;  4O4X A;  3DA3 A;  4FT6 A;  1BXW A;  2KXP A;  2XE1 A;  4GHB A;  1YS5 A;  3AAA B;  4KR4 A;  3QRC A;  2Y2X A;  3SY9 A;  3PQU A;  4GCQ A;  5PRN A;  2PRN A;  2ERV A;  1Q9G A;  2XG6 A;  4O49 A;  1PRN A;  3RBH A;  3T24 A;  3PQS A;  2F1T A;  6PRN A;  2MHL A;  1MM4 A;  5ADX K;  4RJW A;  2Y0L A;  4FSP A;  4LSE A;  3JTY A;  4AYD C;  3V8U A;  4O4U A;  3POQ A;  2LFU A;  3C5O A;  3KVD D;  3SY7 A;  4AYN A;  2KZ7 B;  3VZT X;  2POR A;  1PHO A;  3POR A;  4FZN A;  4O3Z A;  1MM5 A;  3AAE A;  1BH3 A;  2ZFG A;  3POX A;  1GFP A;  2XE5 A;  4RJX A;  4RLC A;  3SYB A;  4AYI D;  3WI5 A;  3UPG A;  3GP6 A;  3AA0 A;  2N2M A;  1HXT A;  3HW9 A;  4AUI A;  5GV0 A;  1ZHY A;  5DL5 A;  1IZN B;  1ZHW A;  3AA7 B;  4FZL A;  2F1V A;  2XMX A;  3SYS A;  2YPV A;  4D64 A;  2ODJ A;  3DA4 A;  2MNH A;  3LK4 1;  3AA6 A;  3LK3 A;  1H6S 1;  1GFQ A;  2XE3 A;  4N59 A;  1ZHZ A;  4XNK A;  3LK2 A;  4G76 A;  5FVN A;  3AAE B;  4KR8 A;  4QQ1 A;  2J1N A;  1GFO A;  1E54 A;  4GCP A;  5EE2 A;  5G26 A;  4AKR B;  2JMM A;  3AA0 B;  3POU A;  4FRX A;  4AZL A;  5AFU L;  1OPF A;  3QRA A;  3FYX A;  1ZHX A;  1G90 A;  4AFK A;  2M07 A;  2FGR A;  5DL6 A;  2KXP B;  3WI4 A;  5DL8 A;  3VE2 A;  4KRA A;  3LK4 2;  3O0E A;  3VE1 A;  1BT9 A;  4FES A;  3AA6 B;  2K0L A;  4G75 A;  4BUM X;  2KDY A;  2W81 C;  2XTR A;  1P4T A;  1OSM A;  3A2S X;  4O3X B;  1QJ8 A;  4E1T A;  4RL9 A;  3HOL A;  5T5F A;  3UU2 A;  4AYE C;  2M06 A;  2GE4 A;  1GFM A;  1HXX A;  3T20 A;  4GF4 A;  4FSO A;  4N58 A;  4D5U A;  3K19 A;  4AYM C;  2Y0K A;  4GCS A;  3VZW X;  2ZLD A;  5ADX L;  1THQ A;  2OMF A;  2KC0 A;  1Q9F A;  3SZV A;  2KZ7 A;  2N2L A;  4B61 A;  3VY9 X;  7PRN A;  3NSG A;  3TZG A;  4FRT A;  4F4B A;  8PRN A;  4FOZ A;  4C69 X;  2FGQ X;  3SZD A;  1ORM A;  4JCH A;  3LK3 B;  4JFB A;  4FMS A;  4LSF A;  2XE2 A;  4Z3T A;  2Y0H A;  4RLB A;  3LK2 B;  1IZN A;  4U9C A;  3AA7 A;  2O4V A;  2X27 X;  4LSI A;  5JDP A;  3AA1 A;  4D65 A;  5AFU K;  4FUV A;  4FZM A;  3AAA A;  3UAQ A;  1ZHT A;  3EMN X;  2K4T A;  3G7G A;  3HOE A;  1GFN A;  5IYU A;  2YNK A;  4XNL A;  1QJP A;  2XTQ A;  4LSH A;  1QJ9 A;  5DL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...