2N2LA

Nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles calculated with implicit membrane solvation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
156
structure length
156
Chain Sequence
EGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein X
publication title Backbone structure of Yersinia pestis Ail determined in micelles by NMR-restrained simulated annealing with implicit membrane solvation.
pubmed doi rcsb
source organism Yersinia pestis
total genus 30
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2015-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2n2lA00
4RLCA 1BXWA 1Q9FA 3G7GA 1G90A 2LHFA 2F1VA 1MM5A 1QJ9A 1ORMA 2M07A 3GP6A 2JMMA 2ERVA 3C5OA 2M06A 2MNHA 2N2MA 2F1TA 1QJ8A 1MM4A 1THQA 4PUXA 1Q9GA 3QRAA 2N2LA 1P4TA 2GE4A 2MHLA 1QJPA 2K0LA 3QRCA 2X27X
chains in the Genus database with same CATH superfamily
1BT9A 3AAAA 3UAQA 2W80C 3LK42 2XG6A 2KZ7A 4GF4A 4N59A 4LSHA 5G39A 3KVDD 4FT6A 7PRNA 2R4NA 5D5DA 3G7GA 4FZNA 4RJXA 3PGRA 2F1VA 1IZNA 4O3XB 1T16A 1ORMA 4AYMC 4C69X 1E54A 3PGSA 3PRNA 3BRYA 3C5OA 2K4TA 5GTHO 2M06A 3HWBA 3A0HO 1ZHTA 2F1TA 4XNLA 1MM4A 4N58A 1PRNA 3AAEB 3DA4A 5IYUA 3LK2B 4G75A 2R89A 3LK3A 3K19A 1P4TA 3JTYA 4GCPA 4KRAA 2Y7SA 3AAAB 3BS0A 2QTKA 2K0LA 3LK2A 1GFMA 4KR8A 2KZ7B 5AFUK 4AKRA 3EMNX 1MPFA 5G26A 4AYEC 2X27X 4AYID 8PRNA 3UPGA 3DA3A 3POXA 4RLBA 2KDYA 4AKMA 2XE1A 4AZLA 1GFQA 2FGRA 4PJ0O 3V8UA 4AUIA 4D65A 1GFNA 3SYSA 5ADXL 1IZNB 4FRTA 2Y0KA 1S5LO 2W81C 2R4PA 1MM5A 2XE5A 3O0EA 4QQ1A 2XE2A 3NJTA 3DWOX 4K3CA 4LSEA 3SY9A 2F1CX 4E1TA 3VE2A 3GP6A 2JMMA 2ERVA 4FQEA 2XTQA 4B61A 3VZWX 4KR4A 2N2MA 2XTRA 1QJ8A 3AA0A 3LK3B 2R8AA 4IL6O 4C00A 4FZMA 4N74A 1GFPA 4FSPA 5PRNA 4O49A 4BUMX 2X9KA 4FRXA 3AA7A 3PORA 2KXPA 4AKRB 4N75A 5DL8A 5T5FA 3VY8X 1QJPA 5KAIO 4GHBA 3QRCA 5JDPA 4GCSA 3WU2O 4O3YA 3PF1A 4RLCA 1BXWA 1ZHXA 2R4LA 2IWVA 2IWWA 1Q9FA 3VZUX 2J4UP 2Y0LA 1HXUA 2XMXA 3AA1A 4LSFA 2LFUA 2LHFA 2ZFGA 3SY7A 5B66O 1G90A 3T20A 2R88A 4FOZA 3TZGA 3VE1A 5KAFO 3PGUA 5TISO 5ADXK 4GCQA 2J1NA 2M07A 2Y2XA 3AA6A 3POQA 3SYBA 3SZVA 4O4UA 4FUVA 4O3WA 3AA0B 3JCUO 2MNHA 2WJRA 2OMFA 4O3ZA 3PQUA 5FVNA 3VZTX 1THQA 5GTIO 3AA7B 5DL6A 1ZHYA 2KXPB 5E79O 1OSMA 2PORA 4PUXA 1Q9GA 4FMSA 3QRAA 3HOEA 1OPFA 2N2LA 2YNKA 3POUA 4FESA 2GE4A 2Y0HA 4AYDC 2MHLA 4C4VA 2R4OA 3WI5A 4E1SA 5B5EO 1GFOA 3A2SX 4Z3TA 4K3BA 1H6S1 4RL9A 2AXTO 2FGQX 2KC0A 2WVPA 3DZMA 4UB6O 5G38A 2O4VA 3HOLA 3AA1B 4FZLA 3T0SA 3KZIO 3UU2A 4CTDA 3FYXA 1ZHZA 4O4XA 1YS5A 3LK41 3AA6B 3HW9A 4G76A 2ODJA 4PR7A 1QJ9A 5DL7A 4UB8O 4FSOA 4JFBA 2PRNA 3BRZA 2XE3A 2YPVA 1HXTA 3VY9X 2ZLDA 3WI4A 4D64A 5H2FO 4U9CA 3DWNA 3T24A 4XNKA 3RBHA 3SZDA 6PRNA 3A0BO 2JQYA 2WJQA 1PHOA 1HXXA 4LSIA 5EE2A 4C4VB 5G3AA 1ZHWA 3AAEA 5AFUL 4D5UA 3PQSA 4AFKA 4AYNA 4JCHA 4RJWA 1T1LA 4F4BA 1BH3A 3NSGA 5DL5A 5GV0A
chains in the Genus database with same CATH topology
1BT9A 3AAAA 3UAQA 2W80C 3LK42 2XG6A 2KZ7A 4GF4A 4N59A 4LSHA 3KVDD 4FT6A 7PRNA 5D5DA 3G7GA 4FZNA 4RJXA 2F1VA 1IZNA 4O3XB 4AYMC 1ORMA 4C69X 1E54A 3PRNA 3C5OA 2K4TA 2M06A 3HWBA 1ZHTA 2F1TA 4XNLA 1MM4A 4N58A 1PRNA 3AAEB 3DA4A 5IYUA 3LK2B 4G75A 3LK3A 3K19A 1P4TA 3JTYA 4GCPA 4KRAA 2Y7SA 3AAAB 3LK2A 2QTKA 2K0LA 4KR8A 1GFMA 5AFUK 2KZ7B 4AKRA 3EMNX 1MPFA 5G26A 4AYEC 2X27X 4AYID 8PRNA 3UPGA 3DA3A 3POXA 4RLBA 2KDYA 4AKMA 2XE1A 4AZLA 1GFQA 2FGRA 3V8UA 4AUIA 4D65A 1GFNA 3SYSA 5ADXL 1IZNB 4FRTA 2Y0KA 2W81C 4QQ1A 1MM5A 2XE5A 3O0EA 3SY9A 2XE2A 4LSEA 4E1TA 3VE2A 3GP6A 2JMMA 2ERVA 2XTQA 4B61A 3VZWX 4KR4A 2N2MA 2XTRA 1QJ8A 3AA0A 3LK3B 4FZMA 1GFPA 4FSPA 5PRNA 4O49A 4BUMX 4FRXA 3AA7A 3PORA 2KXPA 4AKRB 5DL8A 5T5FA 3VY8X 1QJPA 4GHBA 3QRCA 5JDPA 4GCSA 4O3YA 4RLCA 1BXWA 1ZHXA 1Q9FA 3VZUX 2Y0LA 1HXUA 2XMXA 3AA1A 4LSFA 2LFUA 2LHFA 2ZFGA 3SY7A 1G90A 3T20A 4FOZA 3TZGA 3VE1A 5ADXK 2J4UP 4GCQA 2J1NA 2M07A 2Y2XA 3AA6A 3POQA 3SYBA 3SZVA 4O4UA 4FUVA 4O3WA 3AA0B 2MNHA 4O3ZA 2OMFA 5FVNA 3PQUA 3VZTX 1THQA 3AA7B 5DL6A 1ZHYA 2KXPB 1OSMA 2PORA 4PUXA 1Q9GA 4FMSA 3QRAA 3HOEA 1OPFA 2N2LA 2YNKA 3POUA 4FESA 2GE4A 2Y0HA 4AYDC 2MHLA 4E1SA 3WI5A 1GFOA 3A2SX 4Z3TA 1H6S1 4RL9A 2FGQX 3WI4A 2KC0A 2O4VA 3HOLA 3AA1B 4FZLA 3T0SA 3UU2A 3FYXA 1ZHZA 4O4XA 1YS5A 3LK41 3AA6B 3HW9A 4G76A 2ODJA 1QJ9A 5DL7A 4FSOA 4JFBA 2PRNA 2XE3A 2YPVA 1HXTA 3VY9X 2ZLDA 4D64A 4U9CA 3T24A 4XNKA 3RBHA 3SZDA 6PRNA 1PHOA 1HXXA 4LSIA 5EE2A 5AFUL 1ZHWA 3AAEA 4D5UA 3PQSA 4AFKA 4AYNA 4JCHA 4RJWA 4F4BA 1BH3A 3NSGA 5DL5A 5GV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RLC A;  1BXW A;  1Q9F A;  3G7G A;  1G90 A;  2LHF A;  2F1V A;  1MM5 A;  1QJ9 A;  1ORM A;  2M07 A;  3GP6 A;  2JMM A;  2ERV A;  3C5O A;  2M06 A;  2MNH A;  2N2M A;  2F1T A;  1QJ8 A;  1MM4 A;  1THQ A;  4PUX A;  1Q9G A;  3QRA A;  2N2L A;  1P4T A;  2GE4 A;  2MHL A;  1QJP A;  2K0L A;  3QRC A;  2X27 X; 
#chains in the Genus database with same CATH topology
 1BT9 A;  3AAA A;  3UAQ A;  2W80 C;  3LK4 2;  2XG6 A;  2KZ7 A;  4GF4 A;  4N59 A;  4LSH A;  5G39 A;  3KVD D;  4FT6 A;  7PRN A;  2R4N A;  5D5D A;  3G7G A;  4FZN A;  4RJX A;  3PGR A;  2F1V A;  1IZN A;  4O3X B;  1T16 A;  1ORM A;  4AYM C;  4C69 X;  1E54 A;  3PGS A;  3PRN A;  3BRY A;  3C5O A;  2K4T A;  5GTH O;  2M06 A;  3HWB A;  3A0H O;  1ZHT A;  2F1T A;  4XNL A;  1MM4 A;  4N58 A;  1PRN A;  3AAE B;  3DA4 A;  5IYU A;  3LK2 B;  4G75 A;  2R89 A;  3LK3 A;  3K19 A;  1P4T A;  3JTY A;  4GCP A;  4KRA A;  2Y7S A;  3AAA B;  3BS0 A;  2QTK A;  2K0L A;  3LK2 A;  1GFM A;  4KR8 A;  2KZ7 B;  5AFU K;  4AKR A;  3EMN X;  1MPF A;  5G26 A;  4AYE C;  2X27 X;  4AYI D;  8PRN A;  3UPG A;  3DA3 A;  3POX A;  4RLB A;  2KDY A;  4AKM A;  2XE1 A;  4AZL A;  1GFQ A;  2FGR A;  4PJ0 O;  3V8U A;  4AUI A;  4D65 A;  1GFN A;  3SYS A;  5ADX L;  1IZN B;  4FRT A;  2Y0K A;  1S5L O;  2W81 C;  2R4P A;  1MM5 A;  2XE5 A;  3O0E A;  4QQ1 A;  2XE2 A;  3NJT A;  3DWO X;  4K3C A;  4LSE A;  3SY9 A;  2F1C X;  4E1T A;  3VE2 A;  3GP6 A;  2JMM A;  2ERV A;  4FQE A;  2XTQ A;  4B61 A;  3VZW X;  4KR4 A;  2N2M A;  2XTR A;  1QJ8 A;  3AA0 A;  3LK3 B;  2R8A A;  4IL6 O;  4C00 A;  4FZM A;  4N74 A;  1GFP A;  4FSP A;  5PRN A;  4O49 A;  4BUM X;  2X9K A;  4FRX A;  3AA7 A;  3POR A;  2KXP A;  4AKR B;  4N75 A;  5DL8 A;  5T5F A;  3VY8 X;  1QJP A;  5KAI O;  4GHB A;  3QRC A;  5JDP A;  4GCS A;  3WU2 O;  4O3Y A;  3PF1 A;  4RLC A;  1BXW A;  1ZHX A;  2R4L A;  2IWV A;  2IWW A;  1Q9F A;  3VZU X;  2J4U P;  2Y0L A;  1HXU A;  2XMX A;  3AA1 A;  4LSF A;  2LFU A;  2LHF A;  2ZFG A;  3SY7 A;  5B66 O;  1G90 A;  3T20 A;  2R88 A;  4FOZ A;  3TZG A;  3VE1 A;  5KAF O;  3PGU A;  5TIS O;  5ADX K;  4GCQ A;  2J1N A;  2M07 A;  2Y2X A;  3AA6 A;  3POQ A;  3SYB A;  3SZV A;  4O4U A;  4FUV A;  4O3W A;  3AA0 B;  3JCU O;  2MNH A;  2WJR A;  2OMF A;  4O3Z A;  3PQU A;  5FVN A;  3VZT X;  1THQ A;  5GTI O;  3AA7 B;  5DL6 A;  1ZHY A;  2KXP B;  5E79 O;  1OSM A;  2POR A;  4PUX A;  1Q9G A;  4FMS A;  3QRA A;  3HOE A;  1OPF A;  2N2L A;  2YNK A;  3POU A;  4FES A;  2GE4 A;  2Y0H A;  4AYD C;  2MHL A;  4C4V A;  2R4O A;  3WI5 A;  4E1S A;  5B5E O;  1GFO A;  3A2S X;  4Z3T A;  4K3B A;  1H6S 1;  4RL9 A;  2AXT O;  2FGQ X;  2KC0 A;  2WVP A;  3DZM A;  4UB6 O;  5G38 A;  2O4V A;  3HOL A;  3AA1 B;  4FZL A;  3T0S A;  3KZI O;  3UU2 A;  4CTD A;  3FYX A;  1ZHZ A;  4O4X A;  1YS5 A;  3LK4 1;  3AA6 B;  3HW9 A;  4G76 A;  2ODJ A;  4PR7 A;  1QJ9 A;  5DL7 A;  4UB8 O;  4FSO A;  4JFB A;  2PRN A;  3BRZ A;  2XE3 A;  2YPV A;  1HXT A;  3VY9 X;  2ZLD A;  3WI4 A;  4D64 A;  5H2F O;  4U9C A;  3DWN A;  3T24 A;  4XNK A;  3RBH A;  3SZD A;  6PRN A;  3A0B O;  2JQY A;  2WJQ A;  1PHO A;  1HXX A;  4LSI A;  5EE2 A;  4C4V B;  5G3A A;  1ZHW A;  3AAE A;  5AFU L;  4D5U A;  3PQS A;  4AFK A;  4AYN A;  4JCH A;  4RJW A;  1T1L A;  4F4B A;  1BH3 A;  3NSG A;  5DL5 A;  5GV0 A; 
#chains in the Genus database with same CATH homology
 1BT9 A;  3AAA A;  3UAQ A;  2W80 C;  3LK4 2;  2XG6 A;  2KZ7 A;  4GF4 A;  4N59 A;  4LSH A;  3KVD D;  4FT6 A;  7PRN A;  5D5D A;  3G7G A;  4FZN A;  4RJX A;  2F1V A;  1IZN A;  4O3X B;  4AYM C;  1ORM A;  4C69 X;  1E54 A;  3PRN A;  3C5O A;  2K4T A;  2M06 A;  3HWB A;  1ZHT A;  2F1T A;  4XNL A;  1MM4 A;  4N58 A;  1PRN A;  3AAE B;  3DA4 A;  5IYU A;  3LK2 B;  4G75 A;  3LK3 A;  3K19 A;  1P4T A;  3JTY A;  4GCP A;  4KRA A;  2Y7S A;  3AAA B;  3LK2 A;  2QTK A;  2K0L A;  4KR8 A;  1GFM A;  5AFU K;  2KZ7 B;  4AKR A;  3EMN X;  1MPF A;  5G26 A;  4AYE C;  2X27 X;  4AYI D;  8PRN A;  3UPG A;  3DA3 A;  3POX A;  4RLB A;  2KDY A;  4AKM A;  2XE1 A;  4AZL A;  1GFQ A;  2FGR A;  3V8U A;  4AUI A;  4D65 A;  1GFN A;  3SYS A;  5ADX L;  1IZN B;  4FRT A;  2Y0K A;  2W81 C;  4QQ1 A;  1MM5 A;  2XE5 A;  3O0E A;  3SY9 A;  2XE2 A;  4LSE A;  4E1T A;  3VE2 A;  3GP6 A;  2JMM A;  2ERV A;  2XTQ A;  4B61 A;  3VZW X;  4KR4 A;  2N2M A;  2XTR A;  1QJ8 A;  3AA0 A;  3LK3 B;  4FZM A;  1GFP A;  4FSP A;  5PRN A;  4O49 A;  4BUM X;  4FRX A;  3AA7 A;  3POR A;  2KXP A;  4AKR B;  5DL8 A;  5T5F A;  3VY8 X;  1QJP A;  4GHB A;  3QRC A;  5JDP A;  4GCS A;  4O3Y A;  4RLC A;  1BXW A;  1ZHX A;  1Q9F A;  3VZU X;  2Y0L A;  1HXU A;  2XMX A;  3AA1 A;  4LSF A;  2LFU A;  2LHF A;  2ZFG A;  3SY7 A;  1G90 A;  3T20 A;  4FOZ A;  3TZG A;  3VE1 A;  5ADX K;  2J4U P;  4GCQ A;  2J1N A;  2M07 A;  2Y2X A;  3AA6 A;  3POQ A;  3SYB A;  3SZV A;  4O4U A;  4FUV A;  4O3W A;  3AA0 B;  2MNH A;  4O3Z A;  2OMF A;  5FVN A;  3PQU A;  3VZT X;  1THQ A;  3AA7 B;  5DL6 A;  1ZHY A;  2KXP B;  1OSM A;  2POR A;  4PUX A;  1Q9G A;  4FMS A;  3QRA A;  3HOE A;  1OPF A;  2N2L A;  2YNK A;  3POU A;  4FES A;  2GE4 A;  2Y0H A;  4AYD C;  2MHL A;  4E1S A;  3WI5 A;  1GFO A;  3A2S X;  4Z3T A;  1H6S 1;  4RL9 A;  2FGQ X;  3WI4 A;  2KC0 A;  2O4V A;  3HOL A;  3AA1 B;  4FZL A;  3T0S A;  3UU2 A;  3FYX A;  1ZHZ A;  4O4X A;  1YS5 A;  3LK4 1;  3AA6 B;  3HW9 A;  4G76 A;  2ODJ A;  1QJ9 A;  5DL7 A;  4FSO A;  4JFB A;  2PRN A;  2XE3 A;  2YPV A;  1HXT A;  3VY9 X;  2ZLD A;  4D64 A;  4U9C A;  3T24 A;  4XNK A;  3RBH A;  3SZD A;  6PRN A;  1PHO A;  1HXX A;  4LSI A;  5EE2 A;  5AFU L;  1ZHW A;  3AAE A;  4D5U A;  3PQS A;  4AFK A;  4AYN A;  4JCH A;  4RJW A;  4F4B A;  1BH3 A;  3NSG A;  5DL5 A;  5GV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...