3JCUO

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
243
structure length
243
Chain Sequence
RLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
total genus 41
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3jcuO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3jcuO02
3A0HO 5B66O 5GTHO 3A0BO 4IL6O 4UB6O 3WU2O 1S5LO 5KAIO 3KZIO 4UB8O 5G39A 5G3AA 5E79O 5B5EO 4PJ0O 5TISO 2AXTO 3JCUO 5GTIO 5KAFO 5G38A 5H2FO
chains in the Genus database with same CATH superfamily
1QJ9A 5IYUA 2XMXA 3PQSA 3PF1A 5GTHO 4FOZA 3AA0A 3FYXA 3AA6A 3V8UA 3LK2A 2XE1A 5D5DA 3SY7A 3POQA 2M06A 4AKRA 1PRNA 1HXXA 4RJXA 4IL6O 2R4OA 2XE5A 3EMNX 3DA3A 4FUVA 8PRNA 4RJWA 2R88A 4KRAA 2KXPA 4O3XB 3SYBA 2ZLDA 4KR4A 3KZIO 4UB8O 1GFNA 4C69X 3LK41 3PRNA 4RLCA 5DL6A 2XG6A 3SZDA 2WVPA 2ZFGA 3LK42 1E54A 1BH3A 4PJ0O 4FSPA 1G90A 5GV0A 1MM4A 3VE2A 2R89A 2R4NA 3AAAA 3PGUA 1ZHZA 4AFKA 3VE1A 3LK3A 4C4VA 2Y2XA 5KAFO 2PORA 5FVNA 1OPFA 1HXTA 4AYID 4AYEC 1THQA 4FT6A 3AAEA 5H2FO 2Y0LA 3C5OA 2IWVA 3HOEA 4RLBA 4AZLA 1ZHTA 3DA4A 5B66O 4FZMA 3A0BO 4CTDA 4LSHA 2LHFA 4GCSA 4D5UA 3AA7B 3T0SA 3DWOX 2XE3A 4GHBA 3VY8X 3WU2O 1YS5A 4D65A 5KAIO 5ADXK 1MPFA 4O4UA 2ODJA 2WJQA 5G39A 4JCHA 2FGQX 2N2MA 3AA6B 4LSEA 2F1VA 3DWNA 3HW9A 3PGRA 2ERVA 5E79O 4O49A 5TISO 3RBHA 3VY9X 2JQYA 2JMMA 4KR8A 4AYMC 1QJ8A 4F4BA 3JCUO 3GP6A 3VZTX 4FESA 2M07A 4FRXA 4K3CA 4O3ZA 2QTKA 3K19A 4XNKA 2X27X 3KVDD 3POUA 1OSMA 1BXWA 3NJTA 2XE2A 1ZHYA 2O4VA 3PORA 4AYNA 5JDPA 3BS0A 3DZMA 1PHOA 4O3WA 5ADXL 2FGRA 3A0HO 3O0EA 1GFMA 3AAAB 4FRTA 3UAQA 1IZNB 3AA1A 1GFPA 3LK3B 5DL7A 5T5FA 2Y0HA 4C4VB 3PQUA 1GFOA 2Y7SA 4GCQA 3AAEB 4JFBA 4N74A 5AFUL 2J1NA 4PUXA 2K0LA 1QJPA 1S5LO 4RL9A 2YNKA 3BRZA 5G26A 1P4TA 4BUMX 3UU2A 4AKMA 2R4PA 3BRYA 3QRAA 2F1CX 4PR7A 2YPVA 2N2LA 3AA0B 3POXA 4U9CA 5G3AA 2KZ7A 3LK2B 3A2SX 4GF4A 3SZVA 2W80C 2OMFA 2AXTO 1GFQA 1ORMA 2LFUA 1T16A 3G7GA 4FZNA 4LSFA 5PRNA 3VZWX 3SYSA 1ZHXA 2GE4A 2PRNA 3WI4A 2W81C 2WJRA 2XTQA 4XNLA 4K3BA 5AFUK 2KXPB 4FMSA 4G75A 2MHLA 4N59A 4AUIA 3JTYA 3SY9A 3HOLA 4AKRB 4FQEA 4G76A 4GCPA 1MM5A 2KC0A 3UPGA 4LSIA 3T24A 2MNHA 3QRCA 5DL8A 3T20A 4O4XA 4QQ1A 1HXUA 5DL5A 5EE2A 4UB6O 4O3YA 4C00A 2IWWA 3NSGA 4N75A 2XTRA 1Q9FA 3PGSA 5B5EO 4FZLA 1Q9GA 2Y0KA 3AA1B 3TZGA 4AYDC 1H6S1 2R8AA 6PRNA 1ZHWA 3VZUX 2F1TA 1IZNA 3HWBA 4N58A 4B61A 4D64A 4FSOA 5GTIO 3WI5A 7PRNA 2K4TA 2KDYA 2R4LA 3AA7A 5G38A 4E1SA 4E1TA 4Z3TA 1T1LA 2J4UP 2KZ7B 2X9KA 1BT9A
chains in the Genus database with same CATH topology
3A0HO 5B66O 5GTHO 3A0BO 4IL6O 4UB6O 3WU2O 1S5LO 5KAIO 3KZIO 4UB8O 5G39A 5G3AA 5E79O 5B5EO 4PJ0O 5TISO 2AXTO 3JCUO 5GTIO 5KAFO 5G38A 5H2FO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H O;  5B66 O;  5GTH O;  3A0B O;  4IL6 O;  4UB6 O;  3WU2 O;  1S5L O;  5KAI O;  3KZI O;  4UB8 O;  5G39 A;  5G3A A;  5E79 O;  5B5E O;  4PJ0 O;  5TIS O;  2AXT O;  3JCU O;  5GTI O;  5KAF O;  5G38 A;  5H2F O; 
#chains in the Genus database with same CATH topology
 1QJ9 A;  5IYU A;  2XMX A;  3PQS A;  3PF1 A;  5GTH O;  4FOZ A;  3AA0 A;  3FYX A;  3AA6 A;  3V8U A;  3LK2 A;  2XE1 A;  5D5D A;  3SY7 A;  3POQ A;  2M06 A;  4AKR A;  1PRN A;  1HXX A;  4RJX A;  4IL6 O;  2R4O A;  2XE5 A;  3EMN X;  3DA3 A;  4FUV A;  8PRN A;  4RJW A;  2R88 A;  4KRA A;  2KXP A;  4O3X B;  3SYB A;  2ZLD A;  4KR4 A;  3KZI O;  4UB8 O;  1GFN A;  4C69 X;  3LK4 1;  3PRN A;  4RLC A;  5DL6 A;  2XG6 A;  3SZD A;  2WVP A;  2ZFG A;  3LK4 2;  1E54 A;  1BH3 A;  4PJ0 O;  4FSP A;  1G90 A;  5GV0 A;  1MM4 A;  3VE2 A;  2R89 A;  2R4N A;  3AAA A;  3PGU A;  1ZHZ A;  4AFK A;  3VE1 A;  3LK3 A;  4C4V A;  2Y2X A;  5KAF O;  2POR A;  5FVN A;  1OPF A;  1HXT A;  4AYI D;  4AYE C;  1THQ A;  4FT6 A;  3AAE A;  5H2F O;  2Y0L A;  3C5O A;  2IWV A;  3HOE A;  4RLB A;  4AZL A;  1ZHT A;  3DA4 A;  5B66 O;  4FZM A;  3A0B O;  4CTD A;  4LSH A;  2LHF A;  4GCS A;  4D5U A;  3AA7 B;  3T0S A;  3DWO X;  2XE3 A;  4GHB A;  3VY8 X;  3WU2 O;  1YS5 A;  4D65 A;  5KAI O;  5ADX K;  1MPF A;  4O4U A;  2ODJ A;  2WJQ A;  5G39 A;  4JCH A;  2FGQ X;  2N2M A;  3AA6 B;  4LSE A;  2F1V A;  3DWN A;  3HW9 A;  3PGR A;  2ERV A;  5E79 O;  4O49 A;  5TIS O;  3RBH A;  3VY9 X;  2JQY A;  2JMM A;  4KR8 A;  4AYM C;  1QJ8 A;  4F4B A;  3JCU O;  3GP6 A;  3VZT X;  4FES A;  2M07 A;  4FRX A;  4K3C A;  4O3Z A;  2QTK A;  3K19 A;  4XNK A;  2X27 X;  3KVD D;  3POU A;  1OSM A;  1BXW A;  3NJT A;  2XE2 A;  1ZHY A;  2O4V A;  3POR A;  4AYN A;  5JDP A;  3BS0 A;  3DZM A;  1PHO A;  4O3W A;  5ADX L;  2FGR A;  3A0H O;  3O0E A;  1GFM A;  3AAA B;  4FRT A;  3UAQ A;  1IZN B;  3AA1 A;  1GFP A;  3LK3 B;  5DL7 A;  5T5F A;  2Y0H A;  4C4V B;  3PQU A;  1GFO A;  2Y7S A;  4GCQ A;  3AAE B;  4JFB A;  4N74 A;  5AFU L;  2J1N A;  4PUX A;  2K0L A;  1QJP A;  1S5L O;  4RL9 A;  2YNK A;  3BRZ A;  5G26 A;  1P4T A;  4BUM X;  3UU2 A;  4AKM A;  2R4P A;  3BRY A;  3QRA A;  2F1C X;  4PR7 A;  2YPV A;  2N2L A;  3AA0 B;  3POX A;  4U9C A;  5G3A A;  2KZ7 A;  3LK2 B;  3A2S X;  4GF4 A;  3SZV A;  2W80 C;  2OMF A;  2AXT O;  1GFQ A;  1ORM A;  2LFU A;  1T16 A;  3G7G A;  4FZN A;  4LSF A;  5PRN A;  3VZW X;  3SYS A;  1ZHX A;  2GE4 A;  2PRN A;  3WI4 A;  2W81 C;  2WJR A;  2XTQ A;  4XNL A;  4K3B A;  5AFU K;  2KXP B;  4FMS A;  4G75 A;  2MHL A;  4N59 A;  4AUI A;  3JTY A;  3SY9 A;  3HOL A;  4AKR B;  4FQE A;  4G76 A;  4GCP A;  1MM5 A;  2KC0 A;  3UPG A;  4LSI A;  3T24 A;  2MNH A;  3QRC A;  5DL8 A;  3T20 A;  4O4X A;  4QQ1 A;  1HXU A;  5DL5 A;  5EE2 A;  4UB6 O;  4O3Y A;  4C00 A;  2IWW A;  3NSG A;  4N75 A;  2XTR A;  1Q9F A;  3PGS A;  5B5E O;  4FZL A;  1Q9G A;  2Y0K A;  3AA1 B;  3TZG A;  4AYD C;  1H6S 1;  2R8A A;  6PRN A;  1ZHW A;  3VZU X;  2F1T A;  1IZN A;  3HWB A;  4N58 A;  4B61 A;  4D64 A;  4FSO A;  5GTI O;  3WI5 A;  7PRN A;  2K4T A;  2KDY A;  2R4L A;  3AA7 A;  5G38 A;  4E1S A;  4E1T A;  4Z3T A;  1T1L A;  2J4U P;  2KZ7 B;  2X9K A;  1BT9 A; 
#chains in the Genus database with same CATH homology
 3A0H O;  5B66 O;  5GTH O;  3A0B O;  4IL6 O;  4UB6 O;  3WU2 O;  1S5L O;  5KAI O;  3KZI O;  4UB8 O;  5G39 A;  5G3A A;  5E79 O;  5B5E O;  4PJ0 O;  5TIS O;  2AXT O;  3JCU O;  5GTI O;  5KAF O;  5G38 A;  5H2F O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...