3JCUO

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
243
structure length
243
Chain Sequence
RLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 41
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3jcuO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3jcuO02
5KAIO 3JCUO 2AXTO 4IL6O 3KZIO 4UB8O 5GTIO 5TISO 1S5LO 3A0BO 3WU2O 3A0HO 5G3AA 4PJ0O 5KAFO 5G39A 4UB6O 5B66O 5G38A 5B5EO 5H2FO 5E79O 5GTHO
chains in the Genus database with same CATH superfamily
3RBHA 2FGRA 1G90A 4LSHA 2KDYA 2Y2XA 3PORA 4K3BA 4C4VA 2J1NA 3JCUO 3PGSA 4IL6O 4KRAA 4RLCA 1PHOA 1T1LA 4JFBA 4UB8O 2Y7SA 3AA6B 5GTIO 3SZDA 4AYID 2ERVA 2K4TA 3HW9A 4FESA 4FMSA 4RJWA 5DL5A 3UAQA 1QJ9A 3BRZA 5GV0A 5JDPA 1IZNB 3HWBA 4GCQA 4O4XA 2R89A 1PRNA 2XTQA 2IWVA 4RL9A 3K19A 3QRCA 3SZVA 7PRNA 4D65A 3AA0A 3BRYA 4AYEC 3DZMA 1BH3A 4LSFA 4AUIA 3LK2B 4G75A 4AKRB 3UPGA 3VY9X 3NSGA 4PR7A 4UB6O 1MM4A 1GFOA 1QJPA 4FSOA 2KXPA 2F1TA 2WVPA 3T0SA 4U9CA 4AFKA 4CTDA 1ZHTA 1E54A 3G7GA 4N74A 5PRNA 4AZLA 1ZHZA 4FQEA 4PUXA 2M06A 2XE2A 3GP6A 3UU2A 2XMXA 4O3ZA 4O3WA 4BUMX 3AA1B 3DA3A 3SYBA 2WJQA 1IZNA 1ZHXA 2R4NA 1GFQA 4O49A 2Y0LA 2OMFA 4RJXA 2MHLA 3T20A 5G26A 1ZHYA 5DL8A 3DWNA 2F1CX 3PGUA 2LFUA 3AA7B 3WU2O 2KC0A 8PRNA 4FOZA 1THQA 3EMNX 3LK2A 3SY7A 4AKRA 2YNKA 4N58A 3VE1A 2N2LA 1GFPA 3BS0A 4G76A 2GE4A 2ZLDA 3AAAB 3PRNA 3PQSA 2QTKA 2LHFA 3PF1A 4GCPA 1T16A 3LK41 3JTYA 4GCSA 4B61A 5H2FO 5IYUA 2YPVA 2O4VA 4O4UA 4FZLA 1HXUA 3AAEB 1MPFA 1Q9GA 4QQ1A 4C00A 4GHBA 4KR8A 4N75A 4E1TA 2K0LA 4AKMA 3AA1A 5KAIO 5D5DA 4E1SA 3FYXA 3HOEA 3KVDD 5DL7A 3C5OA 3AA6A 3QRAA 1S5LO 2XE1A 4LSIA 3WI4A 2J4UP 1OSMA 2IWWA 3A0BO 3LK3B 1H6S1 4GF4A 3AA7A 1HXTA 4D5UA 3WI5A 5ADXK 3PQUA 3A0HO 2KZ7B 3VY8X 2R4PA 5G3AA 2XG6A 4AYNA 3AAAA 4O3YA 4N59A 3V8UA 4AYDC 4LSEA 2ODJA 4C69X 3A2SX 4FRXA 4XNKA 5T5FA 3POQA 3AAEA 3O0EA 4KR4A 2W80C 2X9KA 4FRTA 3PGRA 5FVNA 1ORMA 3DWOX 3NJTA 4FZNA 3TZGA 2N2MA 3VZUX 3VZTX 1GFNA 6PRNA 2FGQX 2R4LA 3POXA 3SYSA 2MNHA 1OPFA 2R4OA 2AXTO 2R88A 3HOLA 1BXWA 3KZIO 2WJRA 2Y0KA 4FSPA 2Y0HA 4C4VB 1GFMA 5ADXL 2PORA 3POUA 5TISO 1ZHWA 3LK3A 4FUVA 3T24A 2X27X 5AFUL 2ZFGA 2M07A 2XTRA 1YS5A 4Z3TA 2JMMA 2KZ7A 3LK42 4JCHA 4D64A 1P4TA 2W81C 4FT6A 2XE3A 1Q9FA 5DL6A 3VE2A 4K3CA 4PJ0O 5KAFO 5G39A 3DA4A 4RLBA 3VZWX 3AA0B 2PRNA 4F4BA 1HXXA 5AFUK 1QJ8A 4AYMC 2F1VA 1BT9A 2JQYA 5B66O 2XE5A 5G38A 4FZMA 4XNLA 5B5EO 1MM5A 2R8AA 4O3XB 5EE2A 5E79O 2KXPB 5GTHO 3SY9A
chains in the Genus database with same CATH topology
5KAIO 3JCUO 2AXTO 4IL6O 3KZIO 4UB8O 5GTIO 5TISO 1S5LO 3A0BO 3WU2O 3A0HO 5G3AA 4PJ0O 5KAFO 5G39A 4UB6O 5B66O 5G38A 5B5EO 5H2FO 5E79O 5GTHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI O;  3JCU O;  2AXT O;  4IL6 O;  3KZI O;  4UB8 O;  5GTI O;  5TIS O;  1S5L O;  3A0B O;  3WU2 O;  3A0H O;  5G3A A;  4PJ0 O;  5KAF O;  5G39 A;  4UB6 O;  5B66 O;  5G38 A;  5B5E O;  5H2F O;  5E79 O;  5GTH O; 
#chains in the Genus database with same CATH topology
 3RBH A;  2FGR A;  1G90 A;  4LSH A;  2KDY A;  2Y2X A;  3POR A;  4K3B A;  4C4V A;  2J1N A;  3JCU O;  3PGS A;  4IL6 O;  4KRA A;  4RLC A;  1PHO A;  1T1L A;  4JFB A;  4UB8 O;  2Y7S A;  3AA6 B;  5GTI O;  3SZD A;  4AYI D;  2ERV A;  2K4T A;  3HW9 A;  4FES A;  4FMS A;  4RJW A;  5DL5 A;  3UAQ A;  1QJ9 A;  3BRZ A;  5GV0 A;  5JDP A;  1IZN B;  3HWB A;  4GCQ A;  4O4X A;  2R89 A;  1PRN A;  2XTQ A;  2IWV A;  4RL9 A;  3K19 A;  3QRC A;  3SZV A;  7PRN A;  4D65 A;  3AA0 A;  3BRY A;  4AYE C;  3DZM A;  1BH3 A;  4LSF A;  4AUI A;  3LK2 B;  4G75 A;  4AKR B;  3UPG A;  3VY9 X;  3NSG A;  4PR7 A;  4UB6 O;  1MM4 A;  1GFO A;  1QJP A;  4FSO A;  2KXP A;  2F1T A;  2WVP A;  3T0S A;  4U9C A;  4AFK A;  4CTD A;  1ZHT A;  1E54 A;  3G7G A;  4N74 A;  5PRN A;  4AZL A;  1ZHZ A;  4FQE A;  4PUX A;  2M06 A;  2XE2 A;  3GP6 A;  3UU2 A;  2XMX A;  4O3Z A;  4O3W A;  4BUM X;  3AA1 B;  3DA3 A;  3SYB A;  2WJQ A;  1IZN A;  1ZHX A;  2R4N A;  1GFQ A;  4O49 A;  2Y0L A;  2OMF A;  4RJX A;  2MHL A;  3T20 A;  5G26 A;  1ZHY A;  5DL8 A;  3DWN A;  2F1C X;  3PGU A;  2LFU A;  3AA7 B;  3WU2 O;  2KC0 A;  8PRN A;  4FOZ A;  1THQ A;  3EMN X;  3LK2 A;  3SY7 A;  4AKR A;  2YNK A;  4N58 A;  3VE1 A;  2N2L A;  1GFP A;  3BS0 A;  4G76 A;  2GE4 A;  2ZLD A;  3AAA B;  3PRN A;  3PQS A;  2QTK A;  2LHF A;  3PF1 A;  4GCP A;  1T16 A;  3LK4 1;  3JTY A;  4GCS A;  4B61 A;  5H2F O;  5IYU A;  2YPV A;  2O4V A;  4O4U A;  4FZL A;  1HXU A;  3AAE B;  1MPF A;  1Q9G A;  4QQ1 A;  4C00 A;  4GHB A;  4KR8 A;  4N75 A;  4E1T A;  2K0L A;  4AKM A;  3AA1 A;  5KAI O;  5D5D A;  4E1S A;  3FYX A;  3HOE A;  3KVD D;  5DL7 A;  3C5O A;  3AA6 A;  3QRA A;  1S5L O;  2XE1 A;  4LSI A;  3WI4 A;  2J4U P;  1OSM A;  2IWW A;  3A0B O;  3LK3 B;  1H6S 1;  4GF4 A;  3AA7 A;  1HXT A;  4D5U A;  3WI5 A;  5ADX K;  3PQU A;  3A0H O;  2KZ7 B;  3VY8 X;  2R4P A;  5G3A A;  2XG6 A;  4AYN A;  3AAA A;  4O3Y A;  4N59 A;  3V8U A;  4AYD C;  4LSE A;  2ODJ A;  4C69 X;  3A2S X;  4FRX A;  4XNK A;  5T5F A;  3POQ A;  3AAE A;  3O0E A;  4KR4 A;  2W80 C;  2X9K A;  4FRT A;  3PGR A;  5FVN A;  1ORM A;  3DWO X;  3NJT A;  4FZN A;  3TZG A;  2N2M A;  3VZU X;  3VZT X;  1GFN A;  6PRN A;  2FGQ X;  2R4L A;  3POX A;  3SYS A;  2MNH A;  1OPF A;  2R4O A;  2AXT O;  2R88 A;  3HOL A;  1BXW A;  3KZI O;  2WJR A;  2Y0K A;  4FSP A;  2Y0H A;  4C4V B;  1GFM A;  5ADX L;  2POR A;  3POU A;  5TIS O;  1ZHW A;  3LK3 A;  4FUV A;  3T24 A;  2X27 X;  5AFU L;  2ZFG A;  2M07 A;  2XTR A;  1YS5 A;  4Z3T A;  2JMM A;  2KZ7 A;  3LK4 2;  4JCH A;  4D64 A;  1P4T A;  2W81 C;  4FT6 A;  2XE3 A;  1Q9F A;  5DL6 A;  3VE2 A;  4K3C A;  4PJ0 O;  5KAF O;  5G39 A;  3DA4 A;  4RLB A;  3VZW X;  3AA0 B;  2PRN A;  4F4B A;  1HXX A;  5AFU K;  1QJ8 A;  4AYM C;  2F1V A;  1BT9 A;  2JQY A;  5B66 O;  2XE5 A;  5G38 A;  4FZM A;  4XNL A;  5B5E O;  1MM5 A;  2R8A A;  4O3X B;  5EE2 A;  5E79 O;  2KXP B;  5GTH O;  3SY9 A; 
#chains in the Genus database with same CATH homology
 5KAI O;  3JCU O;  2AXT O;  4IL6 O;  3KZI O;  4UB8 O;  5GTI O;  5TIS O;  1S5L O;  3A0B O;  3WU2 O;  3A0H O;  5G3A A;  4PJ0 O;  5KAF O;  5G39 A;  4UB6 O;  5B66 O;  5G38 A;  5B5E O;  5H2F O;  5E79 O;  5GTH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...