2KC0A

Solution structure of the factor h binding protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
242
structure length
242
Chain Sequence
b'AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lipoprotein
publication title Solution Structure of the Factor H-binding Protein, a Survival Factor and Protective Antigen of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 43
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kc0A02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kc0A01
2LFUA 2YPVA 4AYNA 3PQSA 3VE1A 2W81C 4O49A 2KDYA 4AYEC 4O3YA 1YS5A 3HOLA 4AYDC 4AYID 3HOEA 3KVDD 2W80C 5T5FA 4AYMC 3UAQA 4Z3TA 3V8UA 4U9CA 2KC0A 3PQUA 5EE2A 4QQ1A 4O3ZA 3VE2A 4O4UA 4O4XA 2Y7SA 4O3WA 4O3XB
chains in the Genus database with same CATH superfamily
1AR1B 5I82A 2GJJA 2L8AA 4YHZH 5BV7C 5KTEL 3CFEA 3W82A 1T16A 1IQWH 1Z3GL 4M62H 4N8VA 3FONA 1V7ML 2YSSA 2NY2D 4KI5D 2AZAA 1PW3A 1OGPA 3VX1A 5D5DA 4FFWC 1Y07A 1IJ9A 2QV4A 2HVBA 2ID5A 3RVWD 4CJ0A 4PJEA 1F2XK 1QKZL 2BOCA 3TZVC 5G26A 2Y1VA 3FHQA 3EFFB 5D5MA 1II4E 3CCHA 4Y4FD 1CLYL 2A9BA 2BSDA 3CBJB 3BKYL 3F6LA 1YECL 3F01A 1BJ8A 1O6SA 2F19L 2XMXA 2YD9A 3D0VB 5GGUA 3RGVC 3UTQA 2VMJA 3UOAB 2J55A 1C5CH 2DF3A 4Z7WA 3FQUA 5C0GB 1QR4A 4YHLL 4HP5A 5DC2A 4A2HA 2HN7A 2Z0UA 5K9JL 3HG3A 2OMVA 5DHVB 2J6EL 4XMKL 4KI5F 4PTTB 5DXWA 3WKML 3L5XL 5I6LA 2XN2A 2PPFA 2XPGB 2QPEB 4DO5A 3HUJF 3GSUB 5DJAB 5I1CH 4P05A 1I1FA 3V2AR 4WEBL 3M1CA 1CGVA 4LVHB 4EDXB 1A1OB 4GG6A 1AQKH 2J72A 1QUNB 2RJMA 3VY9X 3A4DA 4GW4B 3FO0L 3MRHA 3UAEA 1KTRL 2MTAA 3UZQB 3G5VA 2VDMH 1MOEA 1O6VA 2X88A 3SBPA 1TQTA 2Y9RT 1VZIA 2X9WA 4JKPH 2XQBH 1W6LA 2A0LC 3BMWA 4PJGE 4W4OA 2VZVA 4TTDC 4XCEB 5KSAC 4FZEL 5FUZL 5KVEL 1PVHA 3ZE1F 2Y2XA 3T8XA 3MLSH 4N5ED 5E94B 1J9RA 2DQEH 2NY1B 4YXHL 1ZXKA 3L7EA 2F53E 5F71A 4RA0C 3GI8L 1Y0LA 4MJIE 2DJMA 2ZP8A 1TVDA 2DWYA 4C55A 3LXUX 1X7TA 3NDYE 4XO4A 4EVNA 3OKOB 4WU7B 3EBHA 1NANH 1CVSC 2QL1A 1ET5A 2BVPB 2X4NA 3NEXA 2K6YA 2LW3A 4PMEA 3FRPG 1EH9A 4X5WB 1GTNA 1GGIL 2VR9A 4L8BA 3ESMA 1C16A 5EULV 1YUHA 1I7RB 1BJ1J 2OL3H 2CDGA 5EUOA 4NUJB 3G3LA 3SPVB 5FO8B 3EJYC 3I02A 3DX2A 5CIPB 1ZS8A 2BSEA 4R8WL 5AOIA 4BKTC 5KYWA 2WOBA 3H2QA 1AGCA 2EC9U 2FHCA 3TO4B 2B59A 3QEHB 5DLLA 4AKPA 5LHDA 5JPNA 5DEGB 2IH9A 3I74A 1M71A 4KUZH 5EU3B 3LD8B 4HKBA 4XP6H 2ZONA 3LXCA 4L4TA 3MXVH 5LN8A 2FJFB 2RAMA 1D2PA 1FIEA 2WJRA 4LL4A 4FNTA 5KYYB 1HHHB 4LB8A 4WFHD 3L3HA 1QJ9A 2V9TA 3LEVH 2QMKA 4ANWA 4LLMA 4A2MA 5C97A 1ZA3A 2DQGL 1JK9A 3DV4A 4B50A 3IDUA 1FSKC 2Q3AA 4BQ6A 2Z7YA 3CFKB 2Y7NA 3B9DA 1INQB 3CBRA 5DRZB 5I0XA 4FFWD 2VZ1A 2OSWA 3VXSB 1MFVA 1WF5A 2X1OA 3FQ2A 4G7YH 4V33A 4FOMA 2JKWA 1IC1A 2X6VA 5T5FH 2Q3XA 4G59C 4OVVA 3TZVD 1WD9A 3V0EA 4DOHE 5DD1H 3F7YA 3RIFK 4AYBA 3ETTA 4WWKB 2C3GA 3GSVB 2NW3B 4MXWL 2KYIA 5FM5M 3EH2A 4CVZA 1BVKA 4NQDB 4ODUA 2FSDA 3ESNA 1J0IA 3GGWA 5D7HA 1FNSL 3QR1A 1AR2A 5GJSL 4GQ9L 2Q8AH 2FT6A 4IHOA 4X9BA 2QKSA 3LRGA 3S0PA 4F93B 4EKXA 8FABB 3B3IA 5C0BB 2PYEE 3VDAA 2DQCL 3G5YA 2O6EA 2ZXDA 1VGEL 1D7FA 4XNMB 3PRNA 3QUMH 4HWEL 4QTFA 3T0XA 1OY3B 2W07A 4BZ1H 1EJ8A 3MN8A 1AXIB 1UZ8B 2WNXA 4YR6B 2OBGA 2CHWA 5BNXD 1UYWH 2C3XA 2R56H 2P8PB 1TTAA 2R23A 1BAFH 2WSDA 3BGFB 3DO4A 4M29A 2WQRA 3ZPDA 1OEZW 3KH4A 4FABH 1NQBA 3VI3E 1YO4A 3BUQA 3QG6B 5ECGA 4ZFOL 4J1UB 1PYWA 5FOJA 4Y19A 4OLUH 1KTKE 2X0VA 4HDIA 1T20B 2MQ0A 4HWBH 2ICCA 2GYSA 2X40A 4PGJA 5EU6E 3ZTDC 1E2VA 5T5FA 1GAFL 3B3BA 4R0LC 3X1GA 4TTDD 5I23A 5C2BH 5ITBL 1T04B 3QDJE 2P5WD 2Z4QB 4HGKC 1A7RH 5GGRB 1MEXH 5LN4A 5EEWA 3BEWA 1LD9A 2E5EA 2VLKA 2YAHA 3ESVF 1K3ZA 4G6KL 4L1LA 4XVOA 3VWKB 5FK9A 3NSDA 4GG8A 1KB5L 3IAQA 5LVEA 4PLJC 3RP1A 1IBYA 4MMYA 2IAND 3EH3B 4L05A 5AW0B 1R3LB 3BO8A 3QUMA 4BZ1A 4NDMB 3VAEA 3AY4A 4YAQA 1A7OH 1J86A 1T66D 3CH1B 3PF2A 1M42A 2H26B 5HDRA 5EA0L 1YEFL 3UTSA 5K39A 4JZOB 4UYPA 3DRTA 3FB5A 3MV01 2EDJA 3BQUA 1CDGA 2IBBA 4NNPH 3K80A 4E9RA 2FZ3A 3BRYA 2WC7A 3FQTA 4LQFL 4KRLB 4Y7OC 5GGRY 5C09E 3VFOB 1LK2A 5GZOC 1A9BB 2R0LL 5J8OA 3K6OA 4HWBA 3MJ7B 2BSRB 1JTTA 1FRGL 2EKSA 2X7LB 1NBVL 1B0RB 2G75A 4JAMA 4EQ2A 5KAQG 4PY8J 3HVNA 4WLCA 4AGLA 1AOZA 2HLFC 4U0QB 1J05B 4XH2B 3GC3A 1T7ZA 4MGXA 4B0MB 4TRPL 5F89B 3V4PA 2CRIA 5JUEH 4QJ3B 4HUWA 5ISZB 3A47A 1HL4A 4EUPB 3SJVB 4ZPVA 1EHXA 1SDDB 4OM1H 4GOSA 1KIRB 1IKFL 1QPPA 1K4CA 1PY4A 3CZLA 2FQGA 2Y7MA 1MWAL 2KZBA 3CZNA 3MPCA 3QNFA 1E5AA 4WI2A 4HYTB 5ICZA 1IGIL 3IJSA 1V8HA 4WU5A 3QE5A 1BYOA 3PF1A 4H5SB 1MXGA 4IIQA 5GGSA 2XXFA 3SO5A 3X1BA 3TIEA 4A04A 1PLCA 1D6VH 4NXSA 2PRNA 4JFQB 5DO8A 1B4RA 2YSTA 3UBXG 1MFAH 3T6XA 3C6SB 1NAMH 3NCMA 4JQIH 5EO1A 4PRHB 3MLVL 4LCWD 4YEFA 3QIWB 1AJ7H 2Y06H 1KPUA 4S1QL 5HHMB 2ALWA 5TDOA 2BIOA 4E41D 4K3EL 5T1DL 3JVFC 4XC1H 1NLDH 3GLDA 3MRIB 2CO2A 4Q9RL 3OAUH 1M7DB 5D4JA 1I8LA 3AAAA 5TF1H 5E8OB 4WWPA 1UG9A 5D93B 3QHFL 3T4AC 1P2CB 4HJEA 4XPAH 5BO1L 2Y7LA 1DQQA 4Y4FA 3BKMH 3MV8D 4OLZH 2E7MA 5I73C 5DQ9A 1NH6A 1JZ5A 4KRPC 35C8L 1S5LO 2IPTL 3ILQC 4X4YA 3HZMA 1E27B 1YEEL 1X5KA 3RU8H 5DJ6B 2X3CA 4F2ME 2VXTH 4TULH 4JM2A 5FF6A 1F8TH 2HRGA 3GSRB 3HI6L 2JLLA 3FB7A 3UIYA 2HKFH 5AZEH 2E75C 4G8GE 3V5DB 4Z7NB 3TBCA 4H1LB 5MP6H 2YKKA 1XH1A 5EWIL 3D12B 3RTLA 4X6FB 1TVHB 1OSZB 1QLEB 5E2UH 1R3IH 4JFED 3KYOB 5DA4A 2V5RA 3S35H 2VIRB 2Y2YA 2XLLA 2G0LA 2XVKA 4HGMA 4PLJD 1HHKA 1NAMA 4JQIA 1DFBH 3W38A 1YEJL 3TFKC 4I2XA 5HHVL 4UDUA 2UUDK 4I3RL 3I9AA 5IFHH 4H8WH 2MIZA 2IG2H 2Q0ZX 3APNA 4H13C 4RMWA 5FM8A 4JDZB 3V5KA 5FGSA 5CJ5A 1L0YA 2BHYA 3O81A 1TZIB 4DPCX 1NPNA 1SUHA 3CZFA 1G94A 5CEXA 5EEVA 5FO9A 3OR6A 1OAYH 1XGPA 3QZOA 5CEYB 4KKLD 3FZUC 4K3BA 1DVUA 2VUYA 1E5YA 4FF9A 5EN2B 5ADPH 4EDWH 4JR9L 1AGFB 3EOAA 4UQBA 3WJMA 1TG8A 1BREA 2OMYA 3IAPA 1MCWM 4FC3E 3VXRE 3O4OC 4NHUB 1TJXA 5HGHA 3T5WA 4NQTA 4YDJB 1U4FA 2N7SA 2I5YH 3QZWG 2IGFL 4LEXL 5F7YC 5IFAH 2HJKA 1R46A 5DVPA 4DUXA 4YDKL 3MUZ1 2CHDA 3IWUA 3QR2A 3TN0A 3VGGA 3D85B 2QVIA 4YE0A 3QS2A 5T1MB 1PZSA 3PY9A 2AJSH 1OGAA 2IALB 1GGUA 2YA2A 1XGUA 5DMIL 1JK8A 4XWOC 3B83A 1JIBA 3D69A 3X14B 5HI4C 5C0IA 3QARA 3MRRB 4TSAH 1UOWA 5GHWH 2K6ZA 3R7RA 1LL1A 2QSCH 3F6IA 3F05A 4Q58C 5B1JA 1B2YA 3DGDA 3IJ9A 3B2VH 1NKRA 4D9RE 3R4RA 1OXYA 1TEFA 2E7LC 4TVUA 1FZKB 3T3PE 1MRDL 4EI5B 3KGSA 4KO6A 1TZOA 3QS3A 1BG9A 1OD7A 2KPWA 1QRNA 4LQ1A 4WUKL 5I0WA 4FQXB 4PG2C 4XNYL 4P2QE 4I9WD 4O00A 2ITEA 1ZGLM 4QY8A 2V5SA 5DRNB 4HIIA 5EFIA 3BH9B 3DECA 4XNQA 4A7SA 3KR3L 1A14L 5F7EL 4QO1A 3EYVA 1DDHA 3THML 3T6ZA 4NENA 4IU3B 5ENWB 1MAJA 4GBXD 2Z0BA 3L1GA 4LGPB 3OMNB 3GM0A 3TNNB 3ZL4L 2X05A 2QT6A 3WTSA 2IH3B 5FECA 1Y6NR 1MHCB 1VCAA 2DQTH 4HKZB 3TZVA 5FGBC 3VMNA 4LCUA 4U4IA 3W81A 3I75B 3NAAL 1JNLH 4MA3A 3T0DA 4KJYB 5JW4Q 4LFHD 3QDMB 3NPSB 4NKOA 1FVDB 3X12B 3HHRB 4TPRL 5IZ7A 2PR4L 3T8MA 4R97C 5KBMA 2OTUA 5E5RB 3ETBJ 1W72B 1OTUD 2FJGB 3DK0A 4HC1L 4QRTA 4ZBJA 3WS6C 2CLVA 4XT1C 1AZZC 1TJIL 3H42H 2ZD0A 2JFCA 1YEDB 4DP0X 3GZPA 3E9TA 3OLGA 2AKRA 5F7UA 2IMMA 2G3ZA 3FQRA 2FX7L 1KCBA 3V7AG 3ZZLA 1JFQH 3WV0A 2WP3T 2XHNA 4PJ9B 4MAZA 1MZZA 1U3HB 1ZLVH 4TLSA 3S98A 1IEBA 3LQAL 4N0UE 4NN6B 2IDTA 2VXSL 3V4VB 3A67L 4XBGA 5CEZE 4TM9A 3SPIA 2CHNA 2GC4C 4Q9QH 1IFHH 2WVUA 3O2WL 1RLWA 3GS0A 1OP9A 3EOBB 4IBQA 4MA1C 4OH2A 5AEAA 1ZT1B 1XR9B 4AKQA 5IJCC 5TGBA 4AE1A 1EVUA 3FT1A 5IB1B 1KJ2B 3OKMA 3KPSB 4ABVA 2VISB 1X6NA 5KJRH 3KW7A 3MBEC 3NCJL 4QWWD 4R90H 5D2LA 5HJ3B 3QCUH 4GQPH 2ERJC 4LEBA 4Y2LA 5H4YA 1SF3A 2VW6A 3TBTB 1GFQA 5IHHA 3FZUD 2W94A 1XCTA 4EEEA 1AANA 3VI3F 4R7NA 4FZ8L 3UDWC 3QQ3A 4E9VA 1E5BA 4RGND 4DZBB 2V2WB 4NO5A 4CW1B 4ZSOB 3NJMA 1WYJA 1S4IA 1OVZA 1E9OB 3H6JA 3I50L 3NSYA 4XNZB 4YOKA 5FIEA 3SDDC 4M7JL 1IT9H 2IOOA 3GNML 4QHUB 2UVFA 4OTXL 2IANA 4K4KA 5E1HB 1JFHA 2XPYA 4PS7A 3WKPA 4JG1L 2CO4A 3CC5A 2X4OB 4IHBA 3TXAA 4DP1X 2JI3A 3W5NA 1V3MA 2B5IC 4XWOD 1NCAL 3ZL2A 2ZUYA 3BLKA 1BPLB 1NFDB 4BZ2A 2Q6WA 4P9HH 2AJ3B 5GISH 2DQJL 4RNRB 3RWFB 3T65A 1OAZL 1S9YA 4LE8A 2W9LA 5F1SA 4HJIA 1V3JA 2E56A 4NKDB 2UX7A 3Q6FB 4ISVA 4OZIA 6FABL 5C0FA 2JKIS 1BDYA 3U6XS 4NP4H 2FEEL 1N4XH 4N9GB 2YXVA 4JN1L 4ETYA 4WDIA 5AL8A 1NJ9B 1NGYA 3NN8A 5A2LH 3KBPA 1A2YA 2W0LA 2CA3A 2VE6B 4EZLA 2V6HA 4W9DC 4Z18A 1UZ6E 2ZT9C 4Q4IA 4I18B 4KHXH 1BVZA 4N5UA 2EH7L 3WXVH 4S1RH 1TEYA 3ME0A 1CZ8H 2MHAA 5DFAA 2Q9OA 3JZ7A 3ZKQD 3UTTA 3IS0X 2OXGA 3LQZB 3WY1A 1AHWB 3RYMA 4AVHA 1HIML 3RVXC 2MNHA 3VRJA 1FGVL 4H40A 2QPSA 4K71C 1XDTT 4F57L 5CZXD 2Z31B 3WIHL 5FA3A 1LO0L 1QSEB 1RUAL 1JSYA 1QQDA 3GS4A 5TDPB 3U30B 5DJ0A 5KVFL 5TE6H 4AMKL 2Z8VC 3NOIA 4YHYB 1MH5A 43CAB 1UM5H 4M8QB 3C8KA 4RIRA 4HEPA 5AZ2L 5FYLD 3TV3H 4LLDB 3OXSB 4QXUH 1KPVA 4G8EB 2DZEA 1ZY9A 2PTTB 5I76B 4WNJA 3REWB 4QHMB 5KVDH 2FHFA 4DSYA 1OCCB 1DSWA 3FRPB 1FP5A 3DO7B 3KPTA 5DVNA 3CVHB 5CCJA 1UATA 1PY9A 3JVGC 3LS4L 4LCWA 5EB9A 2V7NA 1LEGB 2FWSA 4PRPE 5GSVB 2CJ3A 4E41A 5FPIA 3KS0J 5DHXB 4FJZA 1WZMA 4HIEA 3ZL1A 2QTKA 1WIPA 3FTVA 4IL6O 4LEEA 4K3HA 5DZAA 4I8DA 1NEZG 4IJ3B 4XRCB 5A2IH 1X5IA 3IJEB 2CCVA 2UWEF 1BYNA 1MZYA 5BVJB 4N8VG 1D5MA 3MV8A 4JO8A 2R29H 4N2GA 4L9DA 4KMLB 3KXFE 4PAZA 3JV4B 3VFVB 4QHLB 5EZJA 3D4CA 3FOMB 1QBLH 2J8UE 1A7QL 4M6OL 3TURA 1NMCC 3WYRA 1S9XA 1XXFC 2X70B 4WW2A 2EO7A 1NGQH 1HOCB 4XMPL 1WTGT 3BN9D 1K4DA 2UVEA 3SDCC 4N24A 3ZO0A 3EO9L 2FJSA 4ZMXA 3WS3B 4FTVD 3ILPB 1X5YA 3QEUA 4NZTH 5G38A 4P04A 3EFDL 5B3JF 5F7HA 1C5BL 4JFEA 2AANA 3SDDD 4G9FE 2XE1A 3EH4B 4QLWA 4I13B 4X4XA 5FDYA 5B4MD 4ZUUB 3MRDA 3BAWA 3ZZSA 5D96B 4IKIA 2UYLB 1KIQA 4JNXA 4NZRL 5DT1H 3AFLA 4NGHL 5DUPL 2JELL 2W60B 5KEZA 1XZ0A 3I84A 1TU2B 2EXTA 1IGFH 3NCYP 3P0YH 4WKZA 1KCVL 2O61A 2A5UA 3MACH 2QVKA 1KJVA 5C07D 3BWSA 3DJZA 4KK9C 3ALPA 2WSPA 3NUKA 3SPHA 1JWSA 1ZOXA 3UMNA 1J5CA 3BP7A 4OCRH 2PWFA 2VOTA 5HGAA 1RIVL 2WXFA 1G6RH 2XG4A 1YNKH 1J48A 2BSSB 3HLKA 1AP2B 3ML9A 4GNKB 5JYMA 2YD1A 1X9QA 4HF5L 5ITFA 4IOSD 4OGXH 1KG0B 3G6JF 2HAZA 3RX5A 1QSVA 4FHKA 4YBLC 4A7GA 3CFQA 4H0HB 2JB6B 5A2JH 1XGYL 4PJ7E 5CJ8A 4N8CL 2JK5A 2LLGA 3PQSA 2XZQH 2W9EH 4C58B 1BVLB 1A6VL 4U6YB 3S7GA 4P46C 4U6VL 4UOW1 3ILEA 1PZ3A 5A1AA 4XBEH 4JFPA 4BKLA 1JN6B 2N0KA 1FUNA 3POUA 1TVBA 2Y07L 3EGSA 3RVXD 4EI6B 4J39A 3FAWA 5I8OL 2VL4A 4WWID 2I07A 3PHAA 2AXFA 2VMFA 4GP4B 4YE4L 4YXLL 4MNQD 3BH8A 3NK3A 3QI9A 3X1EA 3ZY7A 2DI7A 5F93C 1JPTL 3QJFA 2IPKB 3NH7L 1G7LA 4O9HH 3SDYL 4IDJL 4KVNL 2VTFA 1MFEL 3DDFA 3ECQA 5FV1L 1XGTB 3IE4A 4QTIH 4ZYKB 4ZK8A 5K9KB 3MV9B 3ZMRA 3U7AA 4W70A 1EEZB 3L4TA 4HIQA 5I1GH 4J4PA 4EN2A 2XG5A 1G6RA 1GOHA 5IK3B 1NL0H 4WJ5B 2QR0B 3AREC 2O1AA 1JAEA 3MHZA 2DQMA 4FEIA 2WXGA 4X8GA 5ESVA 4HEMA 1MLBA 2NLJA 3T0SA 3AY2A 1FFTB 1JGDB 2NY6B 2OR7A 5K9QG 3T3PF 4GBXA 1OF2B 1UD5A 3M7OA 1AG0A 4TQPA 1FH5H 3VFNA 1QFPA 4A66A 3L7FB 4FNSA 3LZNA 2YJLA 3HNVL 3IKCA 4NBZB 3QNZB 2FNBA 4NIYE 1KBPA 1QHOA 5I1JL 5I6OA 5IG7B 5C7ZA 4KXAA 3B34A 5INCB 5LNDA 4UQAA 4V1DA 2VH5H 4HUUB 1B0IA 1LVEA 2IWFA 4N20A 2YKLL 4NRYB 2FWLB 2EXWC 5E4EB 4ADIA 3OVUB 4FULA 4JRXB 4RSYA 4KHTH 5T3XL 3ARDA 5AKTA 1CDUA 3MRNB 3D05A 1INEL 3DX6B 1D5XA 3EDKA 2FYYA 1MJUH 2VR4A 3BPNB 2NXZD 3LKQB 4OT1H 3QT2A 4QHKI 1OPOA 5J9PA 2GI7A 1MRFH 2VZOA 4P4KD 1GYVA 3C87A 3FQXB 4AL8L 4Z7VA 3VXPA 3NFSL 1SVZA 1FL6B 1ED3A 2VZ3A 1DLFL 2WZ6A 3EYQC 3ARWA 4HKXB 3BH4A 4ZTPL 2QLYA 4RLCA 1F02I 1FVEB 3DXAD 2AV1A 5KVFE 4D64A 4YWGL 5GRUH 4F15C 3MGOA 2GCYB 5I16B 1GHFL 5LWYL 4WQOA 5HP5A 1YN7B 4M1CC 5J6GA 3E8VA 3FCSB 3KVPA 2H9GB 4PJBF 2QHRL 2A9NL 4NM8H 3UZVA 5IW1B 1BZ7B 4KK9D 3RIAK 3ZGHA 3WAJA 3UBXB 5H8DA 4M43L 3SOBL 1XGQB 2YD4A 1SYVA 1XVSA 2DLFL 4YGAB 3JSSA 1MHEB 5D72L 3OJ2C 2UUDH 4FYQA 4OFQA 5ERWA 1RZFH 3CDFA 3TWCL 5HXMA 5EIIA 5DWPA 3UTPD 3ARBB 3SGJC 2A4ZA 5TH2A 5DWUL 4PWKA 3HC4H 1I9RH 4YXKL 4XHJC 4PCTA 1FZMA 3FO9A 3MRMA 4HWZB 4IM8A 3HJEA 3C60B 4K94H 3REVA 3MV7A 4Q6IA 3EGXB 1SMDA 2F5AH 2WVSA 4HIHA 4P2AA 1WFIA 1W8EA 4X6DE 1XGZA 3E6HA 1O9VA 2OX5A 5FYJD 2WLLA 2M26A 1KDIA 1LO3H 5GS0L 4BFFA 1UWGH 4M6NH 4PS4L 3AU1B 2BIQA 4H8VA 2A1WL 3D0AA 5AB2A 4PRAA 1QP1A 4ZG1A 2BVQA 4UQ3A 1NPUA 1KBBA 3FRUB 1DBJH 1N9PA 2COVD 1DE4B 3WUWB 1J8RA 2CDEB 2YNKA 2WBJB 4FI8A 1N0LB 4LDEB 4M48L 4UT6H 4AT6B 1GZQB 5CP3H 2XVGA 3VB8A 1LQBC 4H8HA 1YNLH 2ADFH 4MQSB 1T0MA 2DWEB 3LY6A 2J1XA 5L4MA 2K7PA 2R0WH 3KPPB 4MMXC 1CU4H 1PX8A 3O0EA 1DVXA 1TTCA 3IGKA 5JZ7C 2VDRH 4UI2A 4GRWB 4A55A 3Q8AA 1FNEA 5DUML 2KT6A 2KZ7B 1HDMB 3B9AA 3ARED 5IHUL 4L4VB 2AK1H 3D3VD 1OCZB 1XF4B 4XGZB 1DCEA 1ND0A 2FR4A 1RIHL 2CR0A 4OUUA 3SQOH 3DJSA 2CRMA 4ZUTA 3DX8A 2V2TB 2ZOTA 3JWDC 3F2LA 2IPUG 3VRIA 3LKRA 3OBAA 4F3FB 1O7DE 5F7DB 2XTJB 2XIBA 1CPUA 1I75A 5CGYC 3VXUB 5FKAA 1X5MA 2ZXEB 5E9DB 4LVOB 3BXNA 1ETA1 1UB5A 4NQXB 4HOZA 3SZVA 3N9GH 3LK2B 1HSAB 4LL9A 1S7QA 1G7PB 5EOCH 1DJXA 1UACL 4E42A 1FL3A 2CMRL 4PJXE 1HCYA 1T4WA 3WNIA 3PP3H 3AT0A 3EHBC 2ARJQ 2HTLC 1XB3A 2AK4E 3GXUB 4MQXC 1WAAF 3AACA 4YFLF 5TFSL 1EEYB 1JNNH 5GJTH 1W8OA 3Q3GB 4UOQA 3MNVA 3FNKA 4RDBA 3RURA 4CNIA 2ZE0A 1WT5A 1ET7A 5BQ7A 4C4BA 2GVYA 5D7SL 4IKNA 4JFDD 4S0SD 5EIQA 2W0KA 3B5GA 1RU9L 4X8JA 2IVFC 4X80H 4BYHA 4FQHB 2X4PB 4JPWL 1GGCL 3HJ0A 5E23A 2CO6B 1LNUA 1T21B 4Y16C 5CINL 5ABAA 4RSVA 4JPVH 4PCKA 1TF4A 4GKNA 1KTBA 1YAIA 3LH2H 1A3LL 5I1LB 1MXDA 1T80A 4FKKA 3O41A 4JHBA 4R2GB 3NA9L 3ULAB 2V3DA 4GUOA 2ICWI 2IDFA 1TITA 1G84A 3A0HO 4QOKD 1K5NB 1TMQA 3RFZC 2PXYB 1JV2A 2EP6A 1CTNA 4JRLA 4LSDA 3QVAA 1GC1C 4AGNA 4DUVA 1G9ML 2XT1B 4JRYD 3HMXL 3MRPB 1QBMH 1AKJA 3ZT5A 1WUNT 5C6TL 5C9JA 3FTUA 3FU3A 3G6JA 4J3OC 3ZTNL 2Y6SC 1DVTA 2FBJL 4G1MB 3VI4B 4AIZA 1DN0B 3B5TA 3V0IA 4K3DH 5ADXL 3IMTA 3L4CA 1NCCH 4YDLB 4PJCE 4QF1B 3HBZA 5BPPA 4B5EA 3QCTH 4Z7QF 1WRFA 1NOLA 4QXGH 4ABWA 2WXOA 5CXPA 5C07A 4NEHB 2ITDA 4U4BA 5T3XE 4X98B 4JO3L 4PV1C 3LN5A 3KPRB 2YAPA 3OHMB 3QFDA 3W0WB 1IGYB 2VM4A 4QLRA 1E2WA 4YHZL 2I24N 1W0VA 2UV3A 3GMNB 3UTOA 1WFJA 4M62L 1Q9LB 4IOSA 1I3VA 6PAZA 3MOBH 2W38A 1J10A 3PWPB 5E8PB 1VGKB 3V95A 2GEQA 5IVXA 4RAHA 3QORA 5HHQB 1XCQB 3T1FA 3IDGA 5D1ZI 5JZ7D 3EGDA 2ENJA 3L6FA 1CF8L 4QNPF 2GUYA 1P5VB 32C2B 2EDEA 4GINA 4GSQA 3MNWA 2OTWA 4WI3A 4N2HA 4ODHH 4HG4K 3WIAA 1MCRA 2BVYA 5JHLA 1WLHA 2KXPA 1FFOA 5AAWA 5E08H 1LO5B 5IQMA 1EVTC 3VFUA 4PJHA 1KEGH 3GSOA 3LMJL 3Q06A 1HXMA 2VAAA 5DMGC 3TV8A 5E2TH 1B4LA 3U0TB 1IBBA 3K71A 4XN8A 1HNGA 5BZDB 2JJVA 4RBPH 4MNQA 3S5LA 3MQIA 1FYTD 2NNCA 1P7HL 4UV4H 2IGTA 3HG2A 3RZCC 3IB4A 2FIRT 3LNHA 3VO0A 2ZSVB 5LGJB 1O7SA 3HC0B 4AIXA 3NZ8A 2TRYA 1OP4A 1SN5A 2VYRE 5DRXA 4OFDA 3AB0B 4PD4J 4KNTA 4FP8H 1MNUL 2OCCB 3DX9B 3O2VL 4MMZB 3EHBD 4KQ4L 5D7LD 1SJHA 1KELL 5C0EB 2Z93A 2YUWA 1T5WB 1PZ5A 4ZO8A 3UH8A 3B43A 3GXNA 3JVGA 2JXMB 5HGDA 1FCGA 1P5UC 3FL7A 3EO0B 2KQMA 1H8LA 1Q0YL 5IB4B 3JQOB 4DW2H 4RJWA 2XQBL 2XN0A 3OGCA 2GFBA 3I9GH 2Y3NA 3HRZA 1HXTA 4Y16D 3IU4H 3OF6D 5F88B 2ZWYA 4AUJA 4Y5XB 1B0GB 4R83A 3WFHA 3N41F 4M4RA 4KROD 2NUPA 4TNFA 2DQEL 4EMZA 3LV3B 2I26N 1DJYA 3MU3A 4C54A 2OP4L 4Q97A 2WXJA 5IOPB 3Q8CA 2RMNA 4IS6A 1MAMH 4BHUI 2XG6A 4XP4L 4OZFH 2YPLB 3KLDA 2WB7A 4K9EH 3IDJA 3GO1H 1Q94B 2P8MA 4GPVA 4Z7OF 4MYWB 1YCSA 4GRLB 1NBZB 1R19A 3GUTA 1ZTMA 2FIKA 4TLTA 4BBWA 4F1SA 4AY0A 3AXLA 1T7WA 3GSNH 4Z3TA 3CD4A 2AC0A 4P4KA 4NZDA 3ULSA 5FYJH 1JF1A 2XXMB 4GRMA 4JDTL 1BZDA 3AA0B 1OTSC 2OL3L 5IB2A 5MEOB 2IH1A 1NGZB 4Y2OB 2YGNA 5IMKA 3WHXA 4U7KA 4N26A 4D0CB 5KG9A 4GH7B 1VFOA 1MQ8A 3WEBA 3PABB 5DC0A 5B38B 2R4LA 2BIHA 1OK8A 4F5CE 3DXAA 5AW3B 1KIPA 3ULVL 2C3WA 3N44F 4AH2B 4A38A 3EJPA 4MVBD 4IRJB 2Z4TA 1RZPA 4LLYB 4RGMC 1M3JA 4LHQB 3ZKMC 4JFFE 4FFYL 4KUZL 1CBVH 1FDLL 2KZKA 1N64H 1SDAB 4UTAA 4BQ8A 2IADB 4XP6L 1UXLA 3ZDXE 5EBLB 3O6MH 5LXGH 2MTPA 1C12B 2NR6C 3PAUA 4TNWF 4AJ0A 3CLWA 5A2CA 2ZLDA 5FO2A 1EAPB 1KNOA 4MJ4A 3PJSA 1E54A 2PWEA 2YD6A 5J1AB 5I19H 1M05A 2DM2A 2FH6A 4MB5A 1SUJA 4OZGF 5CJOH 3MXWL 1A64A 1E8YA 1CTMA 5DVLA 2F18A 1ZVNA 4YQXH 4LU5L 4XMLL 3SE8L 4J3OF 4P2OB 3QC6X 1IEAB 2IXQB 4OF0A 1CGYA 2NQ3A 2DWSA 3A0OA 3DPBA 4OZFA 1NEZB 3RDTC 3S36X 1VZHA 1S8DB 5F1OB 1CFSB 3RWHA 3VE0A 5L8KB 3ECBB 2QGEA 1F11B 5FO7B 3FONB 4L5FL 2JKXA 4U3SA 5DS8B 1NGPL 3GSNA 3BPCA 4PBXA 5FUOH 3DETD 3POXA 2YO3A 1I8AA 3TOPA 2AQNA 4U7MA 5LNGA 2V3FA 3RY4A 5JIQA 4Q14A 3T1WA 5LAXA 3AUVA 1MW0A 2VGLM 5DMGD 3SDXA 4MSWA 1LP9A 2X89D 3DC0A 4M5YL 5D5MB 4B96A 4LPXA 4PLNC 1T3FB 2Q8AL 1WWWX 4IKKA 1XXDC 2Z91A 5DJDA 3ZTCC 3P4MA 4OQ1A 1O6SB 3UTQB 1BSIA 4LRNL 4AGOA 3AGWA 4X6DF 4ZPTB 1J8SA 3NCWA 3VVWA 1N68A 3G5XA 1ZHKA 2XWCA 3B7YA 5JIPA 2MEJB 2XVLA 4WFFD 1UYWL 2BXYA 5D2NB 2R56L 2BCKA 4Z3EA 1MRCL 2WVTA 2OMVB 1IAOA 4Y1TA 2G3NA 4FRTA 3FQWB 1J8KA 3D3VA 5BZWA 3SZKC 2ICWA 1GKOA 3BGAA 2UXFA 4AJVA 1I1FB 2BC4A 5GRJH 3WN5A 2FX8L 4X4ZA 1UD3A 4OLUL 4OZ4A 4BFOA 3FU7B 4UB0L 1ZIBA 4WFEE 1WCBB 3NIGB 4W9EC 5E6IC 3GJFK 3MRHB 4FUVA 1PKQA 5C2BL 1U41A 1IGMH 1A7RL 1MEXL 4JZJA 4I0CC 3F5WA 2HVKB 4JFHD 5C7XH 1TQCC 1U8KA 3VD9A 4D8OA 1MG2C 4XWGL 2IWKA 5JIKA 2FQDA 3TJEH 4GAYA 1A9EA 3UX9B 3F7PC 4L29B 1MCFA 1MJJB 4Z6AT 3QPQC 2F58H 3L7EB 4D8PA 5JHMA 1OWRM 3RB7A 2R2CA 2CGRH 3V55A 1F4AA 1Y0LB 3P9LB 5JPMB 3GEWB 1U6AH 2IBGA 2OMFA 3DHPA 2P43B 4HEPG 2Z7WA 1J0YA 1ZRUA 4J7RA 3PAYA 4XCFL 3TYGL 1EMTH 5CBEA 4JFDA 2PCPA 1JHKL 1X4YA 1DVFB 3WFBH 1XIWC 4NNPL 1RZJH 1THCA 3D0LB 5IMOB 1UENA 1HEZA 2EUXA 4YHOH 1YUHB 2PTVA 4CN4A 2PORA 1TPXB 3FCTA 7FABH 3P73A 4NZUL 1QEWB 5HDQH 2UZXA 4E0RA 1YUKB 5KYWB 2WQ8A 3L3GB 2DEXX 3N1GC 2JCCA 2NR6D 2QHLA 1ZWIB 1G9NH 2B59B 1SOQA 4TUKH 1PJ9A 1AS6A 1KB9K 2DWDA 1ITBB 4HKBB 3T0ED 4XHQA 2AXHA 1QA9A 4JRYA 4GW5A 1MCPH 2A4EA 1OL0A 1BYPA 1RUQH 4LLQB 3H9SD 5JUEL 4GI9A 4LPTA 2QSTA 3ZSTA 1CFTB 1PNCA 3RDTD 1OW0A 1JK9B 1L9MA 3ZKXB 2C1PA 3P4OB 3S5ZA 3UU2A 4PUXA 3PWVA 2KERA 1LE5A 4FT6A 5FO8A 4JANA 4OGYH 4PWEA 4DCQA 1W91A 2CKBA 5JXAL 5D1QD 2P7TA 4TYUA 2GJ6D 2NY3C 3KPOB 3MBXL 1JXDA 1KDJA 2ZZUT 5J13C 1QLEL 5JMOC 3QDHA 2PW2B 1Z6JT 3CFBA 3VXSE 1UH2A 4XVTH 5KN5A 3F7YB 2NZIA 3K2UL 5DR5H 3C5JB 2DYPD 1SZNA 3QA3B 1BV8A 4UAHA 4KZDL 2P48B 3N1QC 3BKCH 4YC2C 3M1BA 2JV6A 3GGWB 4NQDE 3OX8A 5C9KA 4H4NA 4Y2OA 1UM6H 4XC1L 1NLDL 1HH6A 2EIDA 1V10A 4MNGB 4CGTA 3QEQE 1I1YA 1MHPH 4UQIM 3EBAA 3JV0A 1KBKA 3ABGA 3OAUL 3HZVB 1Z9LA 3QZLA 3RAJL 3UO1L 5I74C 2BW4A 3KPMA 2EDQA 4U0RC 5F7NC 5HGBB 3QZNA 5C0BE 1CYGA 1MVUA 1MVFA 5IF0A 1GSMA 5KS9E 4TVPD 3ULVE 1PU0A 5E7FA 3P30H 4XPAL 2A2QT 3BKML 3US9A 1UA6H 3UBFA 2KL6A 4JGUA 2ENSA 1YNTF 1YY9C 1QSFD 1ONQB 1D5BA 2WHVA 3RU8L 3WDIA 2YC1A 3RTQC 3LK3B 4TULL 2UXGA 1F8TL 4FXTA 2X28A 3KVDD 2M83A 5E6ID 3VH8B 3V0JA 4XO8A 1PYWB 5KAIO 1D6EA 4Y19B 2HKFL 3IF1B 1FYTA 3H9YA 5AZEL 2PWGA 4HDIB 1U8LB 1JG9A 1ROCA 2DWXA 4GIAA 1K85A 3AWFA 1IC7H 3CFDB 3ASNB 3ARQA 2QQNH 2E7CA 5I1HH 3IGLA 5T33L 2VERN 3OAZH 5E2UL 3UACA 3IMVA 3BT2H 3S35L 1NGWA 1LD9B 2YD0A 5G55A 4JFYA 4LPYA 3JWNE 5L88L 4L5FE 1MIML 2VLKB 4OI7A 2H32B 5FK9B 3H9ZA 3S3CB 4GG8B 1FO0H 3KNBA 2IG2L 4H8WL 1FA4A 4EXPX 2JJSC 3MGTB 5IT2H 3GEFA 1XV8A 5H37H 5I1KH 4Q9CA 3VU1A 1WBYB 4MMYB 2Q3ZA 1AD9B 2V4LA 3D48R 1UH3A 3DSNA 3OPZH 4I0PD 4B6ZA 4PJAF 1NM4A 1EA9C 5EBWB 1LEKB 2OJEA 1S7SA 3P54A 1SF5A 5A6MA 1B3JA 2F0CA 4MJ6A 5HY9B 2O6CA 2G60H 2OZNA 2WXRA 4IBWA 4EDWL 2BSTB 2MOVA 4XXDA 1PF3A 3LKOA 3PWLA 7CGTA 5GS2H 5LBSH 1EIBA 4JQVC 2EDFA 2DQIH 4I87A 1LK2B 1PBYA 5DK3A 1Q4NX 1AGEA 2CUHA 2I5YL 3EJJX 1BIIA 5IFAL 3T20A 3S96B 1WC7A 5IWLC 2R2EB 4RH4A 5IVOA 1DBKH 5BS0B 3MCG1 4WI7A 3V0WH 2AJSL 2EKSB 1M7IA 4JAMB 4X8CA 1E67A 2CO7A 2E9IA 1EHLL 2X09A 4OW6A 1T4KA 4TSAL 2BX5A 3P2DA 1O7VA 3DTXB 1UA7A 4EPSA 3NFPB 2EE0A 3NTCH 5FW7A 3WGUB 1XFPA 2CE6A 1UB6A 5DL7A 1IE4A 4FXGB 5FCSH 3TBSB 4JKLA 3V4PB 5CHNB 1T1YA 5FLUA 4B9PA 2NY3D 4N2KA 3GMPB 2OSLA 3CFCL 3LD8C 2ODJA 5KSUB 2KPNA 4LASH 5H37A 5ISZE 4OQTA 3STLA 1M7XA 2OZ4H 4TSBH 3SJVE 1OF0A 1K4CB 2LQRA 2A6KA 1J9QA 3ZHFA 3RX7A 1U8PB 4ZS7H 3P02A 2CCWA 4Z7UF 5ICZB 4W9HC 2A83A 3KMDA 1AXSA 3KWTA 4UF7C 4N0YH 2HPOA 5HHNA 4IIQB 5GGSB 3RPKA 2C9AA 3CIAA 5K93A 1C7SA 3M07A 1KJ2L 3HKFA 1OT4A 5LBSA 5K1VA 3OB8A 4NQSA 1DEEA 4O02B 1J1XL 4W6XB 1JVKA 4AV4A 3DYPA 3FOLB 3KBFA 5EO1B 1JL8A 2DW5A 4TKWA 3NJVA 3SGKA 2CBTA 4HX1A 5EF1A 3VCLA 4PRHE 1Z9MA 2NY2B 1U8JA 2EDKA 2YUXA 5EIIG 5HHME 4Z8FH 2EACA 1ETZB 3LAFA 3UIZA 4AV5A 3ZHKA 1H5BC 2UY6A 2ICES 4AMXA 1JNLL 4H7VA 4QPEA 1I4FA 1TJHH 2N4IA 3NJJA 2VITB 5L8LB 3U2SB 3RTQD 2X89A 1B4JH 4Q4EA 1G7QB 5C08A 4AGMA 1IQDB 5DJ8A 4Y4FB 1MPAL 2J1YA 1OAKH 4FAAB 2ESVA 3I6KA 4WSKA 4X4YB 2C9XA 3LRLA 3TS8A 4LP5A 5CUSH 3CN2A 5C6WH 2GJZA 3B9EA 4C56B 3FN0H 2NY5C 4AUYA 1FBIH 1U8OB 3FB7B 1JFQL 1RULH 3ZE1B 4HPYH 1EERB 4J3TA 3RWJB 3GKZA 3QPXH 4K9JA 1MFMA 4ADGA 3UXFA 4BUQA 4Z7NE 4MD5B 3FHEA 3W56A 1YSOA 3ZT7A 4QRRD 4TMPA 5SWSD 1BW8A 1L7TH 3GMMA 4Q9QL 1I3UA 1AE6H 2ZX7A 4AM0Q 1JZJA 2Z9TA 1M53A 2WXIA 4K7PH 4KZCA 1BOGA 2RR3A 3VJ6A 1CFBA 1HWWA 4NP9A 3X13B 1SJXA 2QVFB 4FZLA 2GB2A 4UDUB 3TWYA 2F53D 1EO8H 4R7DA 1J0KA 2JJTC 2K0RA 4KTDH 4RFNC 3BW9A 3P4NA 2NTFB 5AZUA 1KXHA 2YQBA 5F70A 5MI0B 1PD0A 3KPLB 3CZFB 4FXLA 4CDHA 5CEXB 1UT2A 1QFHA 1VDGA 4BK5C 5I18H 4KKAC 5FDWA 2XWDA 2XBDA 2DKMA 1XGPB 4JVPA 5KUMA 1LO4H 2IC2A 3P11L 1S46A 3DGGB 5BV7H 3QUYC 3SZ6A 4ZD3L 5HSFA 4O51A 3CVIL 1IT9L 4ETQA 2XICA 4X83A 4RDQF 3US1A 3NQKA 2QKIB 3OR7A 4GIOA 3PIQA 4ZTOH 2Q20A 3QIBA 5D7IF 3OXRB 4ENEC 5DQJB 5E8DH 3WU2O 1W0WA 4PRIA 4YL4A 4NOFA 5AD0A 3HS0C 2HJKB 4GUPA 1KTLA 2BNRD 3QIUC 3DUSB 4ALAH 2H0EA 4NQVB 3ZDZB 1X5XA 3CGTA 3TBWA 4PIBA 4NHCL 2RACA 2Y24A 1HEJC 2HFEB 2CGZA 2NY0C 1H6FA 3DJRA 3D69B 2W80C 1WVZA 2AS5M 5LNEA 1ZDSA 3GTNA 5C0CB 1M4KA 1GFMA 1N4XL 4WNQA 2K4TA 5EO0B 2HPTA 4KAQH 1TEGA 3D9AH 3LPWA 4LAQH 5LCVH 3TA4D 2WLIA 5JNYA 2R89A 3AT8A 4GMSL 4R7XA 3MTXA 1CGSH 3Q8EA 2L7EA 2P46B 4KHXL 5EORL 3T0EA 4WGVB 1QVOA 1GGBH 1UA3A 1BFVL 3PWJB 4TVPH 1CZ8L 3LVEA 5M94B 2IF7A 1J5OH 4NZ8A 2Y3AA 4HIJA 3H9SA 3V10A 4XNQB 3X11A 1WHPA 4YZFE 3ZHNA 2AXGB 5FC9A 3CQFA 2GK2A 2EDHA 4R4BA 3P4LA 4QO1B 4WJG3 1DDHB 2CK0L 1PKOA 3JZYA 4NENB 2CCLA 3IXAA 4DK6A 1CQKA 3RWEB 4NNXA 3RPBA 3O6FD 4MX7A 1TIUA 2MKLC 3OLIA 5D1QA 4RMQA 1UM5L 2GJ6A 2E9WA 4JLRA 2AABL 2J20A 2ZUUA 3PS6A 4RRPA 5AVTB 5IHZB 5HDLA 4TQHA 4HLJA 3QUXC 3TV3L 1X4XA 3C6LD 3QDGE 4K7PY 3TZVB 2X6UA 1TZ8A 4LCUB 3V4UL 5KVDL 5EU4B 1ROWA 2DYPA 4XC3H 4N2LA 4Y8DC 3T77A 3UL4A 3JWOC 1AG6A 1TJMA 2EQDA 5ANME 2FHBA 3HOGA 4KX8A 4NCDA 3QDME 2NNFA 3BDXA 2FLBT 2OTUB 2V37A 4BFBD 5LCVA 4DNLA 3V8CA 2CLVB 1KJMB 3U9UB 3ZRSA 4RMUA 5GGVH 4G71B 1BJ1H 1MCHA 3NRPA 4TSCL 4LSPH 2GBUA 1TYRA 1F3JB 2VLMD 2YGOA 3KWXA 4FDWA 1U36A 2BSCA 1TSHA 3IDXL 4ZTEA 4AW4A 1JHTA 3D09A 4E1SA 5EU6D 1JD7A 1CDCA 1DJSA 5HHOA 2G5UA 4EKJA 1HHGA 2R29L 4JREC 2IAMD 3QDJD 1IEBB 4AYMC 3SPCA 3FYEB 1R4XA 1QSFA 5L2JA 4N1EA 1BM7A 4MAUL 2V5YA 3ARTA 1CLOH 4RVBA 4XBGB 1BLNA 1HH9A 4Q6KA 2ZIDA 3PPSA 5CWSA 4MA8L 3ZIYA 4AYFA 1MCIA 4WI8A 1QBBA 5E8NB 4NO2A 4PJAA 2YRBA 1K8IB 4BD4A 4EE2A 5JDPA 3OKMB 5G4OA 4AQAA 2YD5A 3RL1B 3Q01A 5B8CA 3KPSE 2R2BB 4KI1A 3P3SA 3FUNA 3H2PA 1XTMA 1L9OA 1JGVH 3NSFA 3OKEA 4KKAD 3UAJD 4H20H 5KSAB 2P5WB 4HMDA 1BQHB 1NEPA 5F0LB 2AFNA 1WHOA 3HAEH 3I6GA 3QUYD 5JR1L 3MJGX 4R7NB 3S5LG 3QQ3B 3NDZE 3UADA 4HJSA 1CDIA 4Y4KA 4F91B 5EU5A 3RX9A 3ARGC 4XBPB 2D7MA 3MLUH 4FFZH 4ZMTA 3IJYB 3P0YL 3E6FA 4NYLA 3CXFA 3MACL 4N2MA 5C09D 4JN2B 1IZNA 1HKLH 2VO8A 3QIUD 4BH7A 3ZKND 5A2KH 3WD5H 4JY4B 5IW6A 3SO3C 3IFNH 3CC5B 3R1GL 4I0PA 4WAFA 2FO4B 4OCRL 2YR3A 2NY0D 3L4YA 4HK3N 4HK0B 1RURL 2Q6WB 4DP7X 5CLTA 1HEHC 4NPYA 3OWEA 2GTWB 3T65B 1NFDE 2Z35A 4M5ZL 5FX3A 3KHQA 1H3XA 3RY6A 1EXHA 4HXBL 3WOVA 1FJ1A 5D7KE 3BVUA 5BCAA 3N1FC 3IRPX 2ITCA 3BDYH 1RFDH 4FLOA 5FFGA 4FX5A 4GKZB 4X50A 2EUWA 2ZKXA 3HN8A 5D1XE 4ZDHB 2YOCA 4LLUA 5AKSA 1XB6A 2YOAA 4KDVA 5DEFA 1Z3RA 1GSKA 3NN8B 2A6DB 2F7PA 3IRCA 3QDAA 4XBEL 1HNYA 4QD2E 4L18A 2VQUA 1Q72L 3HAEA 1RL1A 1BFOA 5JQ6H 2MHAB 5GGVY 1F6FB 4AQ1A 1AZCA 1FSKB 3GJFB 2FGZA 5IVZA 4L3FA 4FFZA 3RNKA 5F7LB 3PDGA 3KL5A 3N06B 4NT6A 3VRJB 4OKVA 3DROA 4O9HL 2WCGA 3MRQA 4XN4A 4K8RL 3FAXA 3QUXD 1CR9H 5ABZA 4AUUA 3ARSA 3EYUL 4QGTA 5DHYA 1QSEE 5DJ0B 2QGDA 3ETSA 2OJZL 1GW6A 4UU9A 3C8KB 5I1GL 4XMUA 3FQNB 4Z77B 1NL0L 4E9WA 1OAQH 3RWGA 3BAJA 2LOEA 3HI1B 4WO4D 2F1EA 4YN3A 2YFOA 3QUZD 4GI8A 3F58L 1KC5H 4A1RA 3IVKA 1A02N 1EJOL 1ZLDA 3AQYA 2E4FA 2EABA 3OKKB 1Y18A 4I85A 2E8ZA 3T09A 3AXIA 1JBJA 1TLMA 3MYJA 2CO1A 4OD2B 4R3SA 1F90H 4OF3A 4HKJA 2F8OA 3QJQB 4HJGA 4M5TA 3BSHA 1AGBA 4WGKA 2ADJB 4O3YA 3E38A 1IGJB 1A6WL 2VH5L 4DVBA 1MDTA 3W11C 4B53A 3UAQA 1OCWH 4OZFG 1U58B 1S9VB 4G8GD 3ARVA 4Q74A 3OKNB 4C83A 4E68A 1VFMA 2GAZA 4AEIH 2G2PA 2YUVA 3MV8B 1PG7H 4MB1A 4AQ8C 4LP4A 2EE6A 4N2NA 3PDOB 1MJUL 4OT1L 4XCYB 5EZJB 1XEDA 1EAQA 5ETUA 1MRFL 1U8NA 3DOSA 5H4ZA 3OJMB 3LIZH 3M8OL 5FWQA 2C7FA 1K4DB 4Z95L 2R8AA 4IJTA 4YDVA 3O9WA 5LO7A 2XKNA 1KZYA 4HZ1A 4GS7C 3MLTA 3QEUB 4L3EB 4W93A 4KKBC 5CJQL 4PJGA 3ATBA 2ZJSH 3BVNA 3TGXA 4FADA 5FB8A 4M7KH 1E9PA 2XA3A 1Z32X 4JFEB 3GSXA 4KX7A 1FAIH 4FQLH 1RI8A 1JVOA 1EAOA 3IFOA 4NM8L 1DQTA 3D30A 2NMSA 5FYKU 2F53A 4L2YA 4UM9A 5GGTH 5JW4N 1NICA 4WKZB 1RHFA 4MJIA 4C59B 5JOEA 3STZB 2O61B 1QR1B 5H94A 4P57A 1GPOH 2V8MA 3QRGH 2WINA 3ISRA 3JV6A 2V7HB 1MFDL 1EGJH 5D8JH 3ZJAA 1K3IA 5K1NA 5HGAB 1XF2B 1ODUA 4XNZC 2Z1PA 4G9DA 5BZXA 1WS7A 2A77H 4K94L 3MROA 3NIFB 3BP5B 4QI3A 3MMEA 1DLHA 2D0FA 1L0QA 4RGOH 4BM7A 1KULA 3HC3H 3VG9B 2VLRB 4LLAA 1KXQE 1K6QL 3HS8A 4A37A 1UKQA 4M6NL 5G4MA 2MCAA 1ZS2A 4D9RD 1UURA 3GMLA 2C1OB 4CGUB 1I8KA 2OS7A 4RLDA 4XCCH 1XR8A 1FG9C 2MWCA 4N25A 1SLUA 5JW3L 1I82A 4JFPB 2NCMA 2HTKC 1OGTB 1BPVA 1P7KA 4UT6L 1TVBB 2PCYA 4YH6A 5DYOA 2ADFL 3EZ8A 4BCXA 2I07B 4ANUA 4AYGA 1A6ZB 2R0WL 3BH8B 1CU4L 5GGTA 2JIXD 4OI8A 4FJYA 3QJFB 2VDRL 3CQQA 4NQEB 15C8H 2YN5A 3FUEA 3TBVB 3OC8A 5DZOA 1O9WA 3O3EA 4QHNB 3MOAH 4U1IA 2MQGA 4MXQD 5JYLA 5HYSA 1YEIL 1OAUL 4KKNA 1EGJA 4N2CA 4B60A 4EIZC 3SE4C 1TTFA 1CLVA 2VQ1A 3MV9E 3VSTA 5L2KD 1NC2D 1I3GL 1FIGL 4DPRA 4PBDA 5T3ZD 2WGNB 1Z3GH 1T0NB 3C5SB 3U30C 4OCYL 4F7EA 3O6FA 4WI9A 1U8QA 2LT9A 2HYMA 4JDVB 4X6CF 1IC5H 1H5BA 1AGDA 1LMIA 3V52H 4M5SA 1QKZH 4PSRA 2PO6D 3C6LA 5EOCL 2NQDA 2D3LA 4YSOA 3TVMD 3T4AB 1CYWA 1EDQA 1FNAA 3C9NB 4P07A 4CVWA 4HBQA 5F0PB 1CLYH 3VYNA 3WKQA 3TNMA 1UOLA 3BKYH 4QRPD 5I73B 3GHPA 4FNRA 3NRQA 2EE2A 2PP7A 1JNNL 3MRJA 1F5WA 5E00B 4GEJA 5FHBH 3SE3C 3T71A 3FSVA 3K5SA 1KACB 1Q9WA 4MQ7A 2CHXA 2WW8A 5M95B 1VPOH 4W81A 5GTIO 3CSYB 2BZDA 4YHLH 3ECVA 1BQSA 4S1DC 5HHPA 1D5XB 3F7KA 2C9UA 4M9OA 2O5XL 2ZCHL 5K9JH 1LM8V 3NK4A 2J6EH 4XMKH 5CLXA 3L5XH 3W2DH 1I8IB 4Z7VB 1JZ7A 3LH2L 4WFGE 5EU6A 1ED3B 2G3XA 1IFGA 5CD3B 4IMKA 2Z3FA 4WEBH 4IBYA 2IAMA 3QDJA 5KBLA 3WJLA 2KH2B 2Y1ZA 4M3JA 3HPJA 5EWIH 1COBA 3FO0H 2VLLA 3VE1A 3CPLA 2W91A 4NQQA 2BHFA 2JJTA 4BQCA 3WEAA 3S3SA 2VN7A 5AUMA 5J6GB 3EBIA 4KQ3H 3U0PA 1SXSA 3BWAA 3GKWH 5CO1A 3UTZB 3UZVB 1DHKA 3NSXA 1BEYL 1QBML 4PTUB 1JPEA 3UAJA 1EPFA 4FZEH 1U3JA 1DJWA 3QWRA 1F6AA 5E1AA 1X7QA 4WUUE 1A21A 4XNUL 1FFPA 3IGAA 5EIIB 2W8CA 5IHLB 2OMUB 5IY5B 3GI8H 4U1KA 4K3DL 3O4OB 5F9DC 1NCCL 3FTXA 2P42B 4MTMA 3MRMB 3QCTL 3AQDA 3REVB 3S8WA 4XE0A 2PWDA 4U6XA 1K2DB 1SQ2N 4QXGL 5C09A 3BQVA 3R18A 4EF3A 2FSEA 3QIUA 4HIHB 5F7FA 2NZ9D 5E7BA 2CA4A 5G5DA 1QSZA 5FV2A 3E6HB 2J6EA 2E9GA 1F6LL 3K8KA 3MA7A 2OX5B 3KM2A 2DQFA 4UT9H 5EV7A 2WLLB 1E43A 3EO1B 3DARA 3G08A 2HTKD 3GXIA 3LKSA 2XBZA 1ZLUK 4QTHA 2D0HA 2D73A 5DF0A 4PRAB 5EH1A 2BVQB 2VL5B 2IBZY 4R8WH 2NNXA 1HNFA 4ZQTA 3FMGL 4Z78A 3KDMB 1Q0EA 2FO8A 2B08A 1KXVC 5CLWA 3OSVA 1A3RH 5HDOA 3CSTA 1IL1A 2ADGA 4TNWK 1J9TA 1DUYB 1SHMA 2OW6A 3OB0K 1RK0A 5AKRA 3TPKA 5E08L 5DU7A 4LSQH 2GW5A 1KEGL 2XYBA 1EBAA 1SPDA 2LTQC 4ICWA 5IR1A 3VFRA 4GRWE 4IBUA 3SDAD 2DQGH 3QXAB 5EDSA 4ABQA 2WO2B 1NDGA 2YHGA 5IBUG 2DTSA 1E4WL 4OUUB 3UG4A 1RZIA 3TA3A 3FS9A 3DA3A 1ZT4A 3NSCA 4CMMB 4NZFA 4XB8A 4C4UA 3P3YA 4LBEB 4XO5A 4CADA 2YRZA 3H3PH 2AJXL 2BP8A 3LKRB 2VABA 2DMBA 4XAKE 5KBPA 4R5XA 4ZOBA 5CN3A 3DX4A 2APSA 2XTJE 4G6AC 1OD9A 3BXNB 3VXUE 2ZSWA 5E9DE 2Y23A 3E3QE 3DYMA 3EF4A 1KEML 5AAPA 3FBQA 2WLHA 3DOHA 2A6JA 1K8DA 1DBBL 3DYOA 3MUY1 1C5DA 2BJML 2VZSA 4WO4A 1FL3B 5H37G 4ZFGH 5GJSH 2EDNA 3QUZA 4GQ9H 3MKKA 4R97B 5DFTA 4TLUA 5AWNH 2B4CC 2KLSA 4XX1G 1F0LA 3V79C 1CG9B 4S1DD 1XF3A 2DQCH 3VGFA 3FB8B 2EICA 1VGEH 4XTRD 4APQD 5C92A 4HWEH 4CNIB 4TTGA 5BQ7B 3IU4L 1C7TA 3SGEI 5CAYB 5I28A 1S9WA 2XWTA 4F2MA 4KV5F 2X2JA 4X6BB 1PIFA 1SFDA 4Y2NA 5E95B 1R5WA 1L9QA 2X1XR 1CDHA 4G8GA 4GKNB 1URZA 4XXCA 5EZIL 1MAML 5CD5C 5T1KB 4MA1B 5ID0B 2H8PA 3GO1L 1E28B 4X7SL 4MJ5B 4FXKC 4G9FD 2TSBA 2NW2A 3UEQA 3HTLX 2EDTA 4S2SA 4F8TA 4K5LA 2J2ZA 1QASA 1U92B 3WNNA 4RJXA 4EN3D 1L9TA 1U8CA 5D7JA 1JV2B 2NYKA 2VKWA 3CN1A 2JB5L 2PPEA 2H7WA 1QMUA 3CDCA 3OKDA 1FLRH 4FTVB 3L54A 4ONFL 3R06A 5B7FA 5C9JB 1TJGH 1QFWM 3G6JB 1OSPL 4OF5A 3SDDB 4AIZB 4POUB 1OZUA 3EJRA 3VI4E 3WE6A 1C08B 1N64L 2SEBB 4U1LA 5AENA 3A2SX 2EIBA 3GMRB 4MWFA 3O6ML 4X7TB 5J6HB 5LXGL 1CMOA 4BSVB 1HZHH 1OE3A 4D7PA 1RHHB 4WSJA 4IOIB 3VXRA 3K7UA 4N74A 3QNYB 4LDCA 5DURB 3MBWA 2ADYA 3BLBA 3KAAA 3B1UA 4ZFZB 1YEFH 2B5IB 1HSBA 4YBQC 1B9ZA 3X2QB 1TLKA 2BNQE 1REIA 2CLRA 5CJOL 4I48B 5E9NA 1G9EA 3DVFA 1WP6A 2WWKO 3LN5B 5E4IA 2V0AA 3KS0H 5EIVA 3OAWA 4ZFOA 1FE8H 2R0LH 1H15B 3OWRA 1I8UA 3KPRE 4P59H 5CN2A 3D08A 3W0WE 1FGNL 2R4SH 2ZG1A 4ZMZA 7PAZA 3AC0A 1R3HB 3HZYA 4ZXBC 2X2IA 5BW7A 2NUTA 2VQ4A 5HI3D 1FRGH 2VDLB 1NBVH 3UJTL 4DP6X 2C7UA 2VR5A 3PWPE 3V6OC 3L6FB 2Y0HA 1USQA 1E6OH 2PYFA 4P23C 2OTWB 4GO8A 3EOTH 4I77H 2KXPB 1FFOB 4TRPH 1IARB 3VFSB 1AO7D 4P2QA 1F4XH 1HXMB 2VAAB 1KB5A 2HSIA 5KSBF 4X6CA 3TC9A 1NFIA 5ALBL 4U1MA 2DAVA 3EYOA 4K71B 3AA1B 3K71B 1KYAA 1WS8A 5H2BB 3DZMA 1NTDA 4TQ8A 4MNQB 1GCYA 5DO2D 1MWAH 5CEZH 3HE6C 1UKTA 2JIXA 3TYFA 3RPIA 3GP6A 1UASA 1FV1A 1IGIH 3R0NA 4Y88A 4F1ZA 4E9SA 4PJDF 2Q7AA 2MCPL 3Q9PA 3G5ZA 4QCIA 5DRXB 3X1FA 1RZ8A 4JFTA 3VM5A 1WIOA 3M45A 4FQ1L 3CJJA 3S3PA 1MHHA 1YJDC 4JY6A 5GRJL 1G9HA 1SJHB 1QWHA 3VM7A 5L2KA 1NC2A 5E2VH 1A0QL 3MLVH 3BP6A 2OMZB 4S1QH 4G7VL 4DO4A 3MA9L 5GRXG 2ICEC 3DV6A 3KDPB 2JQYA 2HMID 4LVOC 3T2LA 1WUZA 2F74B 2F1TA 1IGML 4ZOAA 4MAYC 3TH2T 4E1TA 3CFJB 5AYQA 1RUML 3PXHA 4O2EB 1GZPB 3SKNB 2PO6A 4O4XA 1UHVA 1XAUA 4M7LH 2LVCA 3TVMA 5BO1H 4AZ8B 4ZMYA 3AM8C 5KVGL 1A1NA 1UJ3A 4QRSA 2NUPB 4G80A 4M56A 5ALCL 4JHZA 35C8H 3TTYA 2IPTH 1KLFA 4WJKB 4Z9KB 4F33B 3C09B 2X4RA 4PJBB 1RZKC 2QFPA 4RRPG 3CH8A 3RVTD 5EO9A 4N0UA 4IS6B 1NMCB 1MWAA 2YZ1A 3IDJB 4Z0XB 3B5HA 1NIFA 1EMTL 1ZEAH 3CIQA 1HL9A 5INDA 3RUGF 4OD1H 3RHWF 5HYJD 1OE1A 3EYSH 3WEOA 2NXZB 4WI0A 3LKPA 2ZKWA 2H45A 1RZJL 3B9KA 3MRBB 1E42A 4GRMB 4YHOL 1LEIA 4FQJH 1NINA 1YMHB 2OMXB 5EC1A 5IQ9A 5IB2B 2IH1B 4QRQA 3WHXB 1I3RB 3VD1A 4R2GC 3LIUA 4TUOA 5KAQF 1S78D 3D6GA 3DXAB 4AV0A 1KIPB 1YEJH 12E8L 5HHVH 1IM9D 3ULUL 4F7TA 2A9ML 2G0KA 1N59B 4AQEB 2BINA 2WQXA 4HFUL 3ABMB 4QR7A 1T2QH 3GBEA 4DP2X 2WMPB 2PXYC 4NLHA 1QO3A 4OFKA 1YY8B 3GXFA 3MJ6A 5DSCA 1Z2KA 2I60H 1RUQL 5C0DA 5EF2A 1T2XA 4RMRA 4JW3A 3MJ8B 5MHSE 3C5ZA 4EZJA 2EUVA 4JR9H 1OCOB 3ZTJH 1CICC 1CGUA 3PFUA 4FS0A 5J11C 5CNHA 1JF6A 2X38A 1WBZB 4ZXBD 5IMLA 2A7BA 4PSPA 4YBLB 5EUKB 4Z3GA 5GPRA 3DPBB 5FM5O 4DQAA 4LEXH 4M6ML 2X1WL 5EDXA 1GYCA 2ZCZA 4PLKC 4XVTL 1ZANL 3BPCB 4NO0D 3CN0A 4P46B 3VRLF 4ZOEA 2O93L 2G4EA 2Q5BA 3TJHD 2A9AA 1T7VA 4JPSA 4JFXB 1P4IL 3SDXB 4N1CA 2YZ8A 4MSWB 4XOEA 5IKCA 2XA8H 1A47A 1Q90A 2FH8A 4JKNA 5FGRA 4HOWA 5LKNA 1U3NA 1LE9B 2ARJB 2LV4A 3Q44A 5FLVA 2A74C 1P84J 3OZLA 4OZHF 1BEXA 1MRDH 5EU7C 3HHSA 4MCYA 1R3KA 3MCKA 4WUKH 3MLWL 5CSZB 4DP8X 1WWCA 3P30L 1ZHBB 1ZHKB 5DD6B 3W39A 4IMLB 2O5YL 2XSKA 4X6EA 3T2PA 4ONHB 1F58H 1G1OA 3KR3H 1A14H 4H2AA 4I5BA 5D2NE 3AREB 4LLVA 3HPLA 1S7UA 3SDAA 1JXKA 2BP5M 5F7EH 5AW5B 5T1LB 4HHAB 5BZWB 3THMH 1YS5A 1EK3A 4IIZA 1UWEL 3S4SB 4ZFFB 1GZHC 2BC4B 2PP8A 1HU8A 2FECI 5CCHE 1BD2D 1GA2A 1U95B 3ZMNA 3FSAA 1ZSHA 3W37A 4LARH 5IROA 4OZ4B 1FN4A 4QGYA 4MAYD 4QHKJ 1RQ5A 2GITA 1IC7L 1XF5A 4HIXH 3UG5A 2AK4D 3HAEG 3LRHA 1JVLA 3NIGE 3D18B 4HZAA 2MPVA 4O3XB 2WCPA 4CILA 3N43F 4MMZC 4GRWF 4PRPA 3L13A 1U8KB 3NAAH 1I1AA 3HKZA 4KWUA 4F7PA 1EAJA 2MNJB 5A16B 1A9EB 1O5PA 4TPRH 1FO0L 2PR4H 3PGRA 2VC2H 3SE3A 1H3TA 4IDLA 1DP0A 1XF1A 5ICUA 4F7KA 1BOYA 1M57B 2ZXGA 3GQFA 4HC1H 4JHAL 1SOXA 4J3VA 4ZMQA 5I1KL 3TCLA 5LGKA 4B0MM 1FI8C 2GT9B 3CAFA 1SJEA 2AAVA 3OPZL 4JQXA 3KXFA 4PY7B 4RCAA 4APQA 4MQTB 2VSMB 3BZFA 3QYMA 2VJXA 3S97C 2J8UA 1PQZA 4AYNA 2DIJA 2PCPB 2MCMA 2CM5A 2G60L 3WY4A 2AEPL 1GYAA 3LQAH 4O02L 2VXSH 1KJ3L 2DQIL 2DJUA 4BSWA 5G2NA 1T89A 4F15B 3O2WH 2O6DA 4HJ0C 3FCTB 3WLBA 2PPAA 3ZRFC 4Z7QB 3ZHLA 1E50A 5SWZE 4HJJL 1T22B 4PR5B 4GRLC 2UZXB 3ROLA 3RWIB 4E0RB 3VX0A 3FUHA 2ENPA 4G9FA 5J5EA 2BO0A 3K4AA 4G72B 3WNJA 2ZPKL 4XNXH 2DWDB 4EN3A 4QOKB 4NIKB 3NESA 1NGXA 2JKRM 4FZ8H 3WUZA 1QA9B 1AQDA 5I8EA 3GK8L 2GC7C 4JRYB 4KKCC 3SKOA 1CICD 3JWDH 3V6FA 4AVIA 1L6XA 2AEOA 2ZXBA 5E51A 1BZQK 2D7QA 3I50H 2I85A 5T3XD 1E8ZA 1PLBA 2XWEA 4M7JH 4HC1A 3GNMH 2PKDA 2R4OA 2EYRB 3BISA 3PWVB 3SE6A 2GJPA 3BSGA 1KENL 2OZ4L 4FHJA 4HA1A 4TSBL 3S3JA 4KUCF 2J8OA 2B15A 4JANB 4KJWC 5KVGE 1R24B 4A6YH 2OW7A 4ERSH 2CKBB 4DGWC 4L37A 3QRLA 2P7TB 4JB9L 2VXUL 2P5PA 1NCAH 1IKNC 2R51A 1PFOA 1OCRB 2DQJH 3CFBB 4A2DA 2HT4C 2GABA 2XWZA 3V8OA 3ARFD 4PJ7A 4A7QA 4Z5RB 1E9QB 5E1QA 4X9IA 3KYNA 1QTPA 2P1YA 1V55B 4BJLA 4P2OC 1MCSA 4NQUA 3ZSSA 2R7EA 4HUXA 1BGXL 3IFLL 4XOAA 2PWHA 1VA9A 1OARL 2ZYHA 4JN1H 4HAFA 1G1YA 2WD0A 5BMFL 1ZLUH 4MMXB 4Z8FL 4KO5A 2WYHA 3EFOA 4GCPA 1XB8A 4A7TA 1YDPB 4DQOL 5FOBB 4MNGE 3FT4A 1SHXA 2EH7H 1G9MC 2XN1A 3ULUE 1JGIA 1ZPLA 3CZEA 1B4JL 1Z5HA 3QULB 4XVUC 1PNDA 5AB1A 3VYPA 4OLVL 1XWVA 4ZX5A 2C9VA 5I1EH 2XBTA 2XWBA 1OAKL 3U82B 1KWGA 1AO7A 1D5BB 2XWJA 3OB0H 5DRWB 3IMBA 5CUSL 1BBJB 1Q9OA 3WIHH 3BVWA 1LO0H 5AVSB 3WFDH 4LKCB 4HD9A 3EUDA 5I5IA 1FBIL 6CGTA 5KVFH 5KANG 2Y7SA 1RULL 2NNAB 3TT1H 4AMKH 4MFHA 3RWDA 3N41B 5J3HC 5GS0D 1XZWA 3AS2A 3AG3B 5AZ2H 4N2DA 5AB9A 4FGMA 2B9BA 1KUMA 2HB0A 2VDOB 4KTEH 3GHEH 5IB3A 1AE6L 2OTPA 3FT2B 2BP0A 3QXVA 3EHBB 5FA4B 2R69L 4U6HA 5DL5A 3LB6C 4K7PL 5D7LB 4OIBA 1FH2A 3L17A 4Z7OB 3A22A 3FTGB 5DI8A 1CDBA 4FLQA 3LK42 3LS4H 3AJ7A 1VFAA 1MCWW 1EV2E 1EO8L 2VLKE 3KNBB 3BGMA 2KMWA 1JZ8A 5HYSG 4KTDL 4XZUA 3HLAA 1ICTA 1P7QA 1OALA 3UPGA 4W4OC 2J43A 4LLWA 3H4HA 5I18L 4Y16B 4LGRB 3AAZA 2OJEB 1S7VA 5MEQA 4BH8B 1S7SB 1UEMA 4R4FH 3N44B 4NN7C 2BOBB 3OG6B 5BV7L 2M8XA 2CIIB 4KROB 3FO1B 3FU8A 4HQQL 4Z76A 3RVVD 2VQTA 3OKLA 2Y72A 1GY1A 4XXDB 3SPJA 2W59A 4G76A 4ZTOL 3CDYA 3WIHA 2FLRT 1A7QH 2D2CC 1AGEB 2QADD 5CP7B 1QFUL 4JKMA 4TN9A 4XMPH 1BIIB 1FPTL 1WC7B 5HJBA 1TENA 3MO1A 4ALAL 4ZUSA 1QI3A 5DFVC 3IMWA 3EO9H 2X0WA 1AVAA 3H6AA 4OZGB 2WWNA 3EJTA 5BS0E 2CO7B 3EFDH 3QQ9C 4PG9B 2Z64C 1DANT 1UADC 4QXVA 1C5BH 3NJKA 3BPOC 4MS8D 1HI6B 4LAJH 5EOQL 1HX0A 4Z3JA 2ZXCA 2SODB 4KAQL 4NZRH 4WV1A 1IM9A 5DUPH 4QQ1A 3D9AL 4LAQL 3W9DB 2WN2A 5ACZB 5JPNC 2JELH 2N0MA 1T1YB 5AYUH 3CV5A 2OSLB 3VD0A 2AQ3A 1QD0A 2A73B 1WQVT 2OYMA 1HKFA 2YJQA 4X0KB 5ESAA 3PQYE 1GGBL 1HHJA 3FF8A 3B7SA 3PCYA 1MCBA 3EG9A 2HT4D 3ZHDA 5IUSA 1NC4B 1J5OL 3BZEB 1AR1D 4LSHA 1IBGH 2ZNXA 1EXUB 3S34H 4UANA 5ICXB 4NI6A 1AXSB 1HJCA 3MYZA 3GSWA 3K6SB 1AZBA 1NCBH 2K7QA 4HF5H 3LKNB 1BM3L 4L1DA 2NY4C 4WW1A 1DEEB 1JMZA 4IYKA 4ZXBA 5M7QA 2Q8BL 1SEBA 2WZ0A 1XGYH 4X2UA 5BRZD 4HX1B 3VNZA 1CDYA 4BA0A 2PR9A 1I8MA 4NUPA 3WNKA 1VFBB 3U7WH 1U8JB 1LDPH 1UFGA 2FL5B 1M1SA 4NO0A 1M9WA 4XVUD 4KI5E 3MSPA 2UY6B 4NNYA 3TTSA 4XC3L 3EH1A 1DSYA 3O45B 1G7HB 2Y07H 3HUJE 4OBSA 1MW3A 1I4FB 3GLAA 1MCJA 5IW3A 3KPNB 3LZOA 5C3IA 4HAKA 1XBRA 4NO3A 4PGEA 1QHQA 5I8OH 3K2MC 4JO4L 4HW6A 2MNUA 1BQRA 3CX5J 4PS3A 4YE4H 4YXLH 4KR8A 2AHIA 4ODSH 1EZSA 4JZNA 3V9EA 3ARXA 1JPTH 5HVWA 5GGVL 5J3HD 4PGDB 4AWJC 4LSPL 1IAKB 1IBZA 1MFEH 2E0PA 5HD8D 5CU9A 4WFED 2F08A 4OV6F 4C56E 4HCGA 1NKGA 1JGLL 4PJIF 3ZE1E 1CYXA 4PJEF 3F7VB 1XD1A 5BJTA 3WI5A 1CLOL 3QG7L 5D5MF 2OXHA 1GMIA 4RZCB 3GMMB 3L4VA 4HWUA 3HR5A 3ZDYF 1F1AA 3C8DA 1P5UB 1E7UA 3KWWA 4MRCA 3L3DB 5E4AA 5KYUB 1BD2A 4L3CB 3T6QC 1BOGB 3BLPX 4KO9A 4PJXA 2V8LA 4I3GA 3VJ6B 5I1IL 1QFWI 1KYFA 1ZVYA 1EFXD 3Q1EA 5FUCC 2AK4A 4R7DB 3CZSA 4Z7WF 1JGVL 3CLEH 2WAQA 5HTSA 3MFFA 3VWJC 3BW9B 3P4NB 5I1JH 1YEKL 3RI5F 2ATPA 1UXSA 1ZSDA 4N0FB 5CGTA 3V0VB 2H6UA 2DL9A 5IEHA 2AQQA 2YBRA 2J57A 1G4MA 1OANA 2YKLH 4OLEA 4Y9FA 2J8HA 3MLUL 4YHIB 4FFZL 1A7NH 2Q76A 4L1HA 4MA7L 5D9SB 3DURB 5T3XH 2AI0H 2BHUA 4YEEA 2HP4A 2APTA 3PHQA 4TNVF 1INEH 4GG6F 1IV8A 2N1TE 3SPGA 2K1MA 3PIQB 3INUH 1X9LA 5E4OA 2WPGA 3H3BC 3IFNL 4QT5B 3AY4C 1WBXA 2RHEA 2JQAA 2YXWA 1BX2A 2W5PA 3N04A 3QQ9D 4AL8H 1NCNA 4POZD 2Z8WC 5AD0B 1HK6A 1NOFA 3NFSH 3SBQA 2ZCLH 4YDNA 4DAGL 1Y6KR 4AMWA 3BQUC 4ZTPH 3I6LD 3TO4D 1MELA 2ED6A 4G42A 3A4FA 3ZDZE 3DHMA 3BWUC 2UZIL 3EDEA 4WY7H 4HGWA 3TEXA 2W9DL 5LUMA 1MFBH 2B1HH 4RGMB 5LWYH 3R19A 2HFFB 5HYQA 2R2HB 5C0JA 3S36L 5IESH 1JPSH 4WNQB 4L4TD 2QHRH 3L3KA 4MB4A 2A9NH 5C0CE 4BE5A 5C0AD 1A25A 5DK2A 3QWOA 3MODL 1ZK5A 3ZN6A 1V05A 4M43H 5AAMA 1TKWB 1OP5K 4D7BA 4FA6A 5JNYB 2BMKB 1RP8A 2DLFH 4XNAA 4Y2DC 5D72H 3B1TA 3ROOB 4GUQA 4PJCA 2FRGP 4HH8A 1ZE3H 3TWCH 3BUYB 2HJLA 3MR9A 5LDSA 3VFPA 1F3DJ 5DWUH 1CICA 5DZVA 3VA6A 3PXLA 3VXSD 4G8FA 4HIJB 5E2JA 3X11B 4GSDL 4WFHE 5EUOF 2P80D 2Y5QA 3RDTB 4JPIA 5I15L 2QVMA 4WWKD 3L9RB 4QKXB 4MX7B 1N2RB 4NQDD 3TBBA 5JOFA 5D1QB 1PJWA 2GJ6B 4UQ2A 4JLRB 1GL4B 5GS0H 3EJZD 5TPWL 2FGRA 1KIUA 1HXYB 3QEQD 1HE8A 3IJ7A 1L4IA 4FQIL 4IIQC 2ZOWA 3TZGA 1ZHLB 2ZWKA 3ARFA 1S7RB 3ULVD 2AJUL 3U6RB 4L4JA 2EZ0D 1KC5L 1U0QA 1T5XA 1Z9SA 3GDBA 3QEGL 2DYPB 2E3VA 4GXUM 5K33A 1N6VA 2D31A 1DN2A 2XACC 4AJWA 4U2ZA 2AJZA 1A1MB 3QZBA 1NCWH 2YXFA 1F90L 2DMCA 2X6BA 1S9KC 3FTSA 2KHAA 2DQUH 1I8LC 3LSOA 5DK0A 1EEQA 3RVWC 2V33A 3GZOA 2HT2D 3MUGB 5ID1B 4HPOL 2YEZA 1F42A 4HCRL 1P6FA 1PPIA 1JHTB 1L9SA 5AL0A 4Y4FC 4X8XA 1PG7L 3GM8A 1GZHA 2CUAA 3L9EA 5T5NG 2I9TA 5DTFB 1QSFB 4HOXA 4RFEB 4JM2C 4FMKA 4NAQA 4UTCA 4LCCA 5E6IB 2ZF9A 4PJAB 3QWNA 2GHZA 3LIZL 2ODIA 3GBNL 3VWJD 4ZNEE 5B8CB 3LK41 3GZQA 1CB4A 1NPJA 1TQCB 4LGSB 2J1NA 2DH2A 2N59A 4GLRH 4K2UH 4I1PA 2ZKYA 1R17A 5FAAA 4PBWD 2CMRH 2J71A 2ZJSL 1I31A 4AEHH 2R88A 4HS8L 2IOIA 5HYEA 2P4AB 5EC2B 5A6IA 2P5WE 3DNKA 3KLAA 4MNHB 4YIQA 5TFSH 1PZBA 4GF4A 1J1PL 2ADIA 3J27A 3X3GH 4PUBL 4RISH 3WFCL 3II3A 1GY2A 3EDDA 3FFCE 5F2FA 4QJ5B 3PGUA 3E6FB 4JCWA 4AJYV 4NYLB 5D7SH 1HJBC 5G3AA 2WWKT 3H9HB 4CBPA 5MI0C 1CT8A 1ZA6A 2HX8A 2NOYA 1OSEA 3QRGL 4Y5YA 4YNYA 4AGQA 1GGCH 2ZCKL 2BNUB 3OHXA 3L3OA 4I0PB 1XIWB 4U3CA 1NSNH 4G6FD 3GINA 3PQUA 1A6UL 4OD3L 4N5EC 3ZRCC 4WCYH 3RJDA 2YEQA 4EQ3A 3H3KA 2EECA 4NPYB 5IOKA 2F9BT 3RG1C 1CDJA 2GHWB 2Z35B 4X5PA 1QFWH 3V0DA 3HE7D 4RGOL 3RILA 3PRZA 3HC3L 4FL4C 4DKEL 3ZGIA 1TETH 3QYCA 3VXOA 4HG4J 4F5CA 2GSIA 4Z7UB 4Y2DD 1IE5A 3TN0C 4PREA 1HZKA 4JFFA 1RV6X 4XCCL 5ISZD 3HMXH 2FBOJ 2VDQB 4IGBD 3WHE0 3SJVD 2IWWA 5BOJA 1QOKA 1MQKL 3GXPA 4V11A 4A2GA 4JVWA 1IGTB 1NBYA 3FF7A 5B1JC 1Q1JH 2EO9A 4AQ1B 2AERT 3BWUF 4PB0L 2FWOA 3ZYJA 4EAEA 3KM1A 5F72S 3RNKB 5DHVH 4ENZA 4TOYL 1M6OA 3QJTB 4BELD 3FFOA 3DROB 2NY3B 3MRQB 1U42A 2BWQA 4HUVB 5J13B 2ED8A 2ZX5A 3G9AB 3MOAL 4PR7A 1I85A 3F62A 4FNLH 1GJIA 4X5RA 4NJ9H 3HNSH 3WEMA 2XU9A 5DMKB 4R84A 4JO3H 4PRHD 4M61B 3GS7A 1L3NA 3QIWD 1MCLA 4HS3B 3U1SH 5HHMD 4PI2A 4E5XA 4YC2B 2HLAA 1JMXA 2ODHA 3IVKB 5A43C 3BOVA 1H6UA 4G82A 4AM0B 2AITA 2ORBH 3WJJA 4JX0A 1AQ8A 5A7EA 4PS8A 1CUOA 1Y18B 4BUGA 5IFJB 1IC5L 3IEAA 3EFFA 1CF8H 4YDIH 4PJIA 4U31A 5BRZA 3V52L 3I6SA 4U0RB 5I74B 3MYJB 3HMXA 3EBGA 1FZOB 3MUJA 3VFMA 4HJGB 5DQDL 4D9QD 1Z0NA 2DPKA 3D0VA 2XIDA 3LMJH 2HT3C 2VLJB 3TJPA 3OLDA 4KJQD 5EPMA 4UTBH 3FH7A 4KBPA 3K1KC 2G2RB 5FHBL 3MLYL 4JM2D 3P77B 2P28B 5C0GA 3RTQB 1YN6B 4D0BA 1VPOL 3VD2A 5IJKA 3MV8E 4PTTA 4TQIA 4MZ2A 2I9LB 2XPGA 2K4WA 3GSUA 5ETUB 2EYTB 3L3JB 4AUIA 4M1DL 1U8NB 4LIQE 4A63A 5I66B 3D39E 3W2DL 1F56A 4L8SC 1JJUA 5F7MC 2QLVB 4EDXA 4K07A 1SHSA 1MNUH 5CIPH 2YEVB 1A5FL 2F1VA 4YX2L 5TK2A 3O2VH 3HVDA 1LLAA 4KQ4H 4BE6A 3VW3L 1ZVSA 1XX9C 1KELH 2RQEA 2K3HA 4GW4A 3UZQA 3MLTB 2APFA 5GZND 5AALA 4QRRB 5SWSB 3BVNB 3ATFA 3FH5A 2CLZA 4IK6A 4L3EE 4OF7A 3BAKA 1KN2H 3L2LA 2IQ9H 5D7IB 1Q0YH 3GSXB 2JKNA 4HSQA 4DGYL 5C8JA 4OF6A 1XTLA 4KQ3L 4O2FA 3GKWL 3IDIB 4JM2F 5ESQA 2VJ8A 1EFXA 1AQMA 4OAWA 3I9IA 5JDSB 1NAKL 4KJPC 4P57B 3ZTJG 3G04A 2X41A 2YA1A 2WINB 3JV6B 4AENB 3G7TA 3VVVA 1OZTG 1CFMA 4LSTL 3SY6A 2O26U 2WJQA 2OP4H 3OKOA 4P4RB 4WU7A 2CALA 1ETB1 2UZYB 3QJUB 1JXJA 2LU5A 2K0LA 4UUJB 4XP4H 3WG7B 3WY3A 1WE5A 3VY8X 2VB5A 3D85D 4CN1A 4DTGH 4X5WA 3CQPA 3JT2A 3MX0B 3N40F 4F9PA 5AFAA 3TN0D 4BQ9A 1I9JL 5IBLC 4FKHA 4NWTH 1OGAD 4UT9L 1U91A 1MFCH 3QHZH 1T66C 2VLRE 4Y9CA 4JDTH 3SPVA 5JXEA 3A6CL 1E5ZA 4RFOH 1W9XA 2BNRB 5F9WC 3GMLB 1PTZA 5MENB 3TO4A 2F1BA 1KBWA 4LF3A 5DEGA 3ULVH 1DYZA 4DVRL 4EI5D 3PGCA 5ANHA 4XO9A 4PGCB 9CGTA 1JWMA 5BXFB 4FQXD 2FJFA 5DYOB 4FFYH 1FDLH 3HWBA 1A3RL 1HHHA 1QRND 2AF2A 5C0AA 1TTUA 3KLHC 1KFAH 1PLGL 4C4VA 4LSQL 1DVYA 3VTMA 5KBNC 2VSKB 4NQEE 3CU1A 4M93B 3ZDZF 4GCQA 1V54B 3ZE2B 2M07A 2BDNH 1BLIA 5F3HB 3MXWH 1INQA 2Q7YA 3QFJE 4LU5H 4XMLH 5DRZA 3SE8H 1HILB 2YRLA 1JZEA 3IDNB 2VQ1B 3QDGD 2EH8L 3VXSA 5JW4R 4JO1H 3I3DA 3LQMA 3H3PL 2P80A 4K5PA 4Q56A 3WTWA 1IVTA 4LNVA 2E8YA 3SY9A 3OM3B 3LVTA 4BZYA 3JWNH 4L5FH 4WWKA 2JF1A 2NW3A 1NGPH 2D7TL 3GMQB 4NBXB 4HK3J 4NQDA 1KY6A 4BXSV 4MJJA 4CMHB 4D0DA 1H5BB 1ZK9A 2OL3A 1KGCE 3Q1SL 4P9HC 4S1SL 2HT3D 3QEQA 4PJ0O 2FQFA 3MC0A 5MERA 5HYIA 4GW1A 4E2OA 2ITFA 2C34A 4M5YH 4PJ5B 4WHYG 4LOFA 3AAEB 5C0BA 4ZFGL 5KS9A 4G43B 5AWNL 3DSFH 2WSKA 3GXDA 2FNWA 5I1DB 1E4KA 4XNMA 3GMOB 4BQBA 1UD2A 4NC1C 4FFYA 2V17H</