2KC0A

Solution structure of the factor h binding protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lipoprotein
publication title Solution Structure of the Factor H-binding Protein, a Survival Factor and Protective Antigen of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 43
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kc0A02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kc0A01
4O3XB 3HOEA 4O3ZA 4O3YA 4AYNA 5EE2A 4U9CA 4AYDC 2KDYA 3UAQA 2KC0A 3PQSA 4O49A 4O4XA 2LFUA 4QQ1A 2W80C 3HOLA 3VE1A 4O3WA 3VE2A 5T5FA 4O4UA 4AYMC 4Z3TA 2YPVA 2W81C 3V8UA 4AYEC 4AYID 2Y7SA 1YS5A 3PQUA 3KVDD
chains in the Genus database with same CATH superfamily
4NI6A 2CUIA 3QHTC 2F53B 1WHPA 1AD9B 1F6FB 2ZKHL 4JZNB 4HCFA 5E56A 1T7VA 1DQVA 3KEHA 4WENB 4ZUWA 2FD6H 1T2QH 3FTSA 4ZFFA 3QRAA 3U25A 1WBYB 2X2YA 5D5MA 1QSED 3NMEA 4MMYB 1M3IA 3D25A 1J1XH 3RVVD 2R1WA 3RVVC 3VG9B 2IMNA 5ID1A 1PZ5A 4DUWA 3DK0A 3MX0B 1Y6NR 2YRLA 2WQSA 4XCCL 2NX5D 3L7EA 3KPRD 4RFNC 5E51A 1XZWA 3RA7L 3E6FB 5T5NG 3FFOA 5IFHH 1FV1A 2YUWA 3PCYA 1KDJA 3HS9A 3D4ZA 2Z7YA 1ZLWK 4GQ9H 5C0GA 5I1CL 2YEZA 2RQEA 4X99B 4XO3A 3NFNB 4GKSA 1S9XB 1FO0L 2X40A 3KMDA 1UD6A 3EFOB 2VXSH 1IIKA 1CG9B 1KFGA 5C7XL 5E1IA 4H1LA 3U46B 3I6LE 1IC7L 3GSQA 4IDJL 4I0PD 4I0PC 1FG2A 1GY2A 2H1XA 5C0EA 3LKSB 3CSPA 3OG6B 2OM5A 4I18C 4Y5YC 5IMOA 4EI0A 2ZXDA 2HRGA 2Y06H 3A3YB 3NRPA 1CQYA 3LKPA 3PAYA 3WS6A 5BS0D 1OALA 3FO9A 3KXFD 1FPTL 3MAWA 3QK0A 3S5LB 1WEJH 2DQIH 1AS6A 4QYOB 3KR3L 4W9ZA 3KWWA 5DZLA 2WP3T 3FUKA 1QLEH 5KVGH 3SPJA 1SJXA 1HNFA 2CBPA 4A68A 3FQWA 3N1FC 5I1HH 3MGOB 3PABB 4KZCA 1BQHA 3ME0A 4RJXA 4PJHF 4QRPA 4XH2B 5I8OH 4F8PA 3M6DA 4AQAA 4KNSA 5IBTH 4W9GC 1YEKL 5DFTA 3VUAA 3II3A 3BDBA 4W9DC 3BFQG 5HSFA 3QFGA 2BNRD 3SDYH 1XCQA 4M3HA 2R69H 4R8WH 3L6FA 5GGUB 5T1LB 1AQMA 4YUEH 2Q86B 3UERA 1CD1A 3FOMB 4Z78B 3VWJA 5I8EB 4ZBJA 2ZAGA 2XRAL 4AEFA 2QPDB 8PAZA 4JO4H 4UIMB 1LK2B 4ELMA 1TR7A 2BSCA 1CYXA 1QA9B 3CC5A 3CPLA 3ZTEA 4A66A 3NZ8B 4AT6A 3D0LA 3FTWA 1S7TB 3EBGA 2FIKB 1WS8A 4RMVA 3VFSA 1TFHA 1MFMA 4G71B 1DE4B 1U91A 1UZGA 4KPHH 4PLJD 4PLJC 3U0TB 2IGTA 5EU5A 4LVOB 3B3IA 1OAQH 3ZXAC 1U8HB 3FN3A 4WUKH 1MQKL 3F5WB 3VQMA 2D7PA 3RWEB 4EUPA 3AWGA 2EDMA 4ISVA 4NO2B 3BEWB 1AR1C 2PTTB 3UYPA 4PBVC 5HJ3B 2AK1H 1FFNB 1QI4A 3DX1A 3GSOA 5BMFL 5F6HI 2QPSA 1LEIB 1QKZH 1EAOA 3BPLB 2VDKH 1MCBA 2YPLB 2BRQA 3OR7A 3S6CA 4DAGL 2VQ1A 1E2ZA 5H94A 1WUNT 2BSTA 4OZFG 4NHUB 1RUQL 3SO5A 4X0KA 1TVBB 4D0BB 4IK7A 1HC1A 4WI2A 2VC2L 3UZEA 2X4QB 2PR4L 4LU5L 1HQ4A 4O9HH 2YK1H 5C0JA 4AMKH 5ISZB 1XWVA 3C75A 2ZFGA 3MPCA 1G6VK 5EC1B 2HFGL 3FXIC 1Y18A 2VDLL 4LE8A 3LK3A 4KXZH 5JW3H 2ENYA 5KSBE 1IRAY 4O4YH 3QGVA 4EXPX 1TMQA 1XTLA 2A83A 1O6TA 1KENH 2VN7A 3D50A 4XP5L 4IHBA 3VXSB 1KYUA 1P6AB 3E8UH 3V0FA 5DS8A 1MCRA 3O3EA 2X4RB 4Q89A 5ERWB 4WGKA 1BFTA 4LSIA 1S7UA 1Z9OA 3MXVL 3MV11 3PWNB 1GAFH 4FMFA 3T3PB 4YS4A 3C5SA 2XV2A 4YHPB 3NDZE 2W60A 4PJBB 4UNIA 2JK5A 3R8QA 1A5FH 3CMGA 3TWCL 4EOWH 1I3GL 4PRID 4RAHA 3BRFA 4ZX3A 4HOXA 4MJ6A 4PJHB 4XX1E 4DP2X 5IQNA 1Z9SA 5F93C 4UAOC 4LVEA 3NA9H 5GJTL 4R97C 2DQUH 2NTFB 3DX6B 1CZ8H 5D93B 4N2OA 4QXTB 2G30A 4NO3A 2GCYA 1KGIA 4DZ8B 1Y1UA 2G5RA 5GHWH 2EYRA 4ZFZB 1VHPA 1VPOL 2NNRA 4O2FA 1T3FA 3G5ZB 3LNHA 4CNIB 4UT9A 4A2GA 1QPPA 5J6GA 2OI9C 4XNDA 2BHZA 3W11D 5C07D 3W11C 5J9PA 1LMKA 4BCZA 3U1SH 3QNYA 2EDFA 1JS4A 4RFOL 2FR4A 4GCQA 3MV8B 2QPUA 2CLRA 3DX3A 5KAIO 5ABDE 5TE4H 4JKNA 1VESA 3BQUA 3RWFB 5H2BA 1YMMD 1KJ2H 4JG1H 5F7UA 2O1AA 4QXUH 2WOBA 4FQCH 3ULUE 1MCPH 4LSHA 1NC4B 5LAPA 1H5BB 2X6UA 4KVCL 4Y4HA 4ZSOE 5MEND 4OGYH 4P3WA 3TJEL 4R4BA 2HVBA 5AOLA 5IROD 2Y1ZA 5IROC 2BP0B 1NGPH 1ITBB 4X5XA 4A7SA 4ZMXA 1KLFA 5F3HB 4FTVE 4LSFA 3MFFB 1ZVSB 1AXSB 3INUH 1OF2B 4C56B 3L3OC 4H8WC 5BPPA 5L2KA 4U7KA 3NCCB 2R23A 1PAZA 5T8IA 2HVKA 4F2MA 5TPWL 1LO0L 1IZNA 1H8SA 1BZDA 5CBAB 2BFVH 4GW4A 2OFQA 1U93B 5TE7H 1JGLL 1CK0H 4GFTB 2VR8A 5E1AA 4ETYA 4JDVA 1PZAA 1HCVA 2CDFA 4CJ1A 1MWAB 2HKFH 3O6LH 3AU1A 5C86A 1SVZA 3B7RL 4PRPE 3VXRB 1T1XB 1HHHA 1XAUA 4U1JB 2NSXA 3U4EA 5DVOA 4MCMA 3OL2A 1MHHA 4XCNB 2QJDA 3ZO0A 3MV7B 4MVBD 3NSXA 3Q9PA 4MVBC 4OUUA 1XGUA 3DIVA 5L8KB 1DN2A 4P9HC 4XPTL 2Y7SA 3KWUA 2ATAA 5FM5O 3W57A 3V4LA 3C5JA 3C6LA 4RGOH 4UZSA 3IFNH 4ODSL 5T3XE 5EPMA 3HPLA 2P47B 3NFSL 3PLYA 1NBCA 3US9A 4DGYH 1DQJA 1M2VB 1BV8A 5KS9E 1H3PL 2EDLA 3I3EA 4JFDA 4R0LA 4X83A 5EFIA 3T0BA 3Q13A 3UTQA 1KPRA 3GMMB 3WN5A 1THAA 2K8QA 4LGSB 2BNQE 4L1BA 5HJGA 1KJVB 3V4PB 4DHLA 3WGUB 2FVNA 1AYRA 2EKSB 3WL9A 5JQ6H 1CICB 2HLAA 2RH0A 2ZUQB 3H7BB 3KLAB 3J07A 4ODWA 4YDJB 1RZFL 3HUJE 4KO9A 3MUHL 1KIRA 3P54A 4L4VB 3RL1B 1YEEL 1ECYA 1GY1A 2O5XL 3TBVB 4BELD 2R1YB 3EIFA 1EA9C 2YBRA 12E8L 4P3CL 1D2OA 3VG0H 2A74B 3TM6A 4L5FL 3SDXB 3QPXH 2BDNH 4HK3J 4PJAE 4CVZA 1ACXA 2EDRA 5I6NA 5FYJH 1KYFA 5DHYB 4JEGB 2XA8H 4NO0A 4JDZB 3WEXB 1QRKA 1WBXB 4YDIH 4P2QA 2P9RA 2N0MA 3BH4A 5SX5H 4BCXA 5IB3B 4BDVA 3JV0A 1A1NA 2Y07H 3CFMA 3FU3A 2NX5E 4B9YA 1YEFL 1B4RA 2MKLC 1JL8A 4EDXA 2XWEA 1LDPL 4I88A 3ZMRA 5D2NC 2XKSA 2Y36H 3EAKA 4G8FA 4U3SB 5BO1L 3OC5A 3E9TA 3GDBA 1A4KB 3P3SA 1I8LC 1FIEA 4WSGA 4NQQA 2KXPA 1UKQA 1I85A 3HRZA 5AYUL 3T77B 1NBYB 3BFWA 5I1GL 4JGNA 3SPHA 1ZHLB 2W65B 3AG2B 1ZLUH 3KH4A 2X0VA 4HWUA 1HXMB 5FYKE 5TFSH 3QA3B 3EBIA 5F72S 4RWHA 3WNJA 4NQXB 1KSRA 1AZCA 1X4XA 1S6NA 3Q5YA 2OR8A 3LH8A 3N40F 2ADJB 5EIQA 5BV7C 2EE0A 4MJ5B 4OLUH 1N4XH 2P42B 5TK2A 4CVXB 5MP6H 2NYZA 2OSYA 3U7WL 5GRUL 1GVIA 1NL0L 2OL3A 2CGRH 3S5ZA 5GS1B 1U2HA 2MQ3A 2YAPA 4IK6A 2GSGA 3HLKA 4DVRH 1VIWA 2WK2A 1RZJL 1X6LA 4ZTOL 2EADA 1KYDA 4NZFA 1SLWA 3LQAL 1DDTA 1PX3A 1NBVL 4IBWA 1SJEA 4U3XA 4IEFA 1OARH 3SB3A 1MCKA 4TSAL 1N9PA 2JJSA 4N2EA 3OAYH 3X1GA 4BK4A 5FCUH 3SGEI 1H3VA 2HFFB 2Q3XA 3S4SG 2OTWA 1AHWA 3B2MA 4PY7A 1W6WA 3AMLA 3EJQA 2VXQH 3N1MC 1BSIA 5FV1L 5EH1A 4NUMA 1JWSA 2ITCA 1FZKA 4JQIH 4OJCA 3CFEA 2XV6B 3IFOB 1CLCA 2PYEA 5E8OA 1YN6B 1QQDA 4NQED 3WFCH 3AY4C 4XO4A 2EIDA 4GUQA 2PWDA 2R7EB 1KLUA 2F0CA 1UWEL 5J13C 2X38A 4DKEL 4HJIA 2C3XA 4KKCC 4KKCD 1QZNA 1SMOA 1TITA 1Z5HA 1O7VA 4NP4L 3JTYA 4YVNA 4PVNA 3W9DA 3DGDA 4TNWF 5KANG 1MWAL 1R3IL 2IDCA 3I50H 1TT6A 2X9XA 2ENJA 4W4NA 4NQDE 4HX1A 2HTLD 2VLLB 2HTLC 2ZTBA 2EIKB 3MLWH 2GAZA 1WG3A 4Q6KA 4J39A 4JY5L 1TZGH 3FKUS 4XVTL 4BWUA 4KI5F 3D3VE 3NESA 1FFTB 4GSDL 4DPCX 5ETUB 3KGRA 4R2GB 3ISYA 1G1KA 1S5IL 1FC1A 5ACMA 3QT2A 5HYIA 4IM8A 3G5XB 2NQ3A 3ZE1B 4WUUA 2GFBA 4P2RB 3HBQA 2YOCA 2BIHA 4FI6A 5DVMA 3QZPA 1W0VA 2GJ6A 5CP7B 4QNPE 4A38A 5FGSA 2VERA 1NCDH 1N6VA 2XQYK 4I77L 1QI3A 3WELA 1K5NB 1IAKA 3G7GA 4ZO6A 1XH3B 4Z7QF 1W72B 3S97C 2ADIB 1W2KT 2AAVA 2ADGA 2DWDA 3V4PL 5HYEA 3L1FA 2EUZA 5MERA 1DUZA 1D6VL 4Z7OB 4JN2B 5D1ZB 4Z6AT 5KZCD 3PRZA 4GS7C 2FHCA 3RLSA 5LCVH 2YD9A 3SYAA 1M3JA 1SJMA 3SDCB 1JNLH 4YDZA 1QMUA 1AKJA 3GS7A 3D2TA 1TTUA 4JFOB 4DCQA 4D8PA 2LFUA 3C6SA 3KPLA 5AUMA 5J56B 3UAJA 1F5WA 1XH1A 4NQVA 1HH6B 3VE2A 3PV6A 4RAUA 5HYJE 2F54E 3BISA 2H8PA 3V5KB 25C8L 2LVCA 5G4NA 2EXYD 2VXUL 1HCYA 2EXYC 4NWTL 2LABA 3DMMD 3DMMC 3QQ4A 3H9ZA 3O45B 5HDQL 5IWLA 1NMAH 2PCFA 3BLKA 2CR0A 4PS7A 1J0KA 5K9JL 1MF2H 6TAAA 2DYPB 3TBTA 4YAQA 3FB7B 4XP6L 1JWMA 4TNEA 3ZTNL 2BNUB 4ESKA 5JDSA 4N6QA 2VN3A 5SWSD 5C2BH 1R3HB 3CXDL 4G59C 3SDAD 3BH8B 3SDAC 5K9KA 3BN9D 1O9VA 3BN9C 3LN4B 1N59A 4P2OB 1Q9LB 2N0KA 1A02N 4M62H 4JKPL 1K2DB 2A9ML 2XZAL 3IPFA 2HLFD 1EUUA 3KPSA 5T3ZD 2Q10A 5HYSG 1EFXB 1BBJA 4L29B 4Y1AB 3WE6A 2FYVA 4KY2A 2YHGA 4KXCA 4FLSA 4OLEA 4C69X 4ZPVA 4IOSD 4YWGH 6PCYA 2X9YA 5JW5A 3U4BL 2EXTA 2JTDA 5D7SL 1XZ0B 3D2UA 3BVDB 4L9LB 4U2YA 1KJ3L 5GZND 2X6AA 1FNEA 2JB5H 2JF1A 2L4OA 2F5BH 2ZWKA 4V33A 5GISH 3VACA 1KIQB 1M7XA 2ZJSL 4MNGB 1AE6H 4Y7MA 3GSWB 5LBSL 4HAFA 3FB6A 5CIPB 2D2OA 2FX7L 2K4AA 4IBTA 3WKML 2VOTA 3HE6D 3HE6C 3ARSA 1MDTA 4KJYB 3UDWA 3I02B 5M7QA 4HFWB 1MRFH 4BQ8A 2CIKB 2IANE 1KB5B 2J21A 3DTUB 3QCVL 3VRLE 1MG2C 3DURA 4MBOA 4YSTA 1HQRB 3N3EA 3WHXB 1IKOP 1E6JH 4Z7QB 2EECA 5SV3A 3TBYB 2CGZA 2AGJL 3FN0H 1YS5A 4LVNB 4MWFB 2AHIA 5EBLB 3A0HO 4EI6A 2GKIA 1FYTA 3AADB 3H9SD 4QJ5B 2B2XH 5C0DB 2ORBL 4ANKA 2Y24A 5I8CB 5EF1A 4UANA 4M03A 1AGCA 4MJIA 5I66A 1EWHA 3QJHB 1S78D 4FOMA 1S78C 4JZJB 3TFKD 3ABZA 4V1DD 4IKKA 2NUPA 2VABB 3KJ4B 2X4NB 4IKIA 3TTSA 4FFZH 1FRGH 3O3DA 2W38A 2ZP8A 1E7UA 2ZUUA 2B1OA 3AAEA 3MO1B 5F0PB 3AUWB 1OEZW 5TJWK 1MI5D 4MD0A 1DVXA 1FLRL 2RQ8A 2YWYA 3TIDA 3ARDD 2R1WB 3GXPA 4OLZH 5EDSA 1CI5A 3RDTD 3AA0A 1PZ5B 1RP9A 3FTUA 4LAQH 5D7LE 2ZX7A 4HKJB 3W5MA 3CXFA 1H8NA 2XJKA 1C16B 2HX8A 3L7EB 4XCFL 3ZQWA 4XP9L 4E5XA 4XO8A 1ND0A 3AA6B 3F58L 4PUBH 5C0GB 3LZOA 4JFSA 2WLIA 1SMDA 4NN6C 4Z95L 1FFPB 1L9SA 1UM4H 2XU9A 5E6UB 3WG7B 2VDNB 4K3JL 4ODBD 3EKCA 3E2HC 4FI7A 5EU6B 4UDUB 4FX5A 1PCSA 3IRZA 3PWPD 4XN8A 3MRPB 1TIUA 1W72L 3GUTB 4AVJA 1D5IL 2P7TB 2XDHA 4CC4A 1XXFC 2IF7A 1EV2E 5IMLB 4LHUD 5KG9A 4WI9A 3HE7D 2P48B 3HE7C 3LKPB 3L9BA 3FO9B 4MMZB 5GSRA 2WTRA 4GRWE 3OB0K 4BFIB 1AZVA 4OD3L 1J9RA 4QRRD 4HIXL 1Z7JA 4D3CH 3IRPX 4S0HA 3TU6A 3JWDH 2XLLA 5ADPL 3K0YA 1KTJA 3LAFA 3ILPB 3V6OC 4U6YA 2Z8WC 3FQWB 3KCPA 4Y5VC 3TPUA 3ZKSD 2Z91B 1ZANH 1FHNA 1N70A 1S7RA 2AXFA 4UYQA 5BVPH 2UWEB 1D7DA 4QRPB 3QH3B 3SJVA 1IM9B 4AGNA 2GI7A 4KKAD 5C8JB 1I4FB 3FQXB 3QG7H 2ICCA 3QEUB 3OLGA 4OGZA 5AB0A 4I1NB 1NUFA 4XZUA 5ILTH 3TV3L 3L3KB 1FBIH 2EEAA 2C3HA 2MPVA 3NJKA 3RPIA 3DTXA 4O00A 5JMOC 3VY9X 3N1GC 5EEZA 3VWJB 4G9FE 1WIPA 1AYOA 3QBTB 4HF5H 4K8RD 1RKRA 4K8RC 3QEHA 3T0AA 5TDNB 2JQYA 5I30H 3S96A 2J1ZA 3Q6GH 5JXEA 3WEOA 5FR3A 2LT9A 3CC5B 4OQTL 2VE6A 2VXVH 4C4KT 4AT6B 3MBXL 3G08A 3BT2H 1MFDL 3QHFH 1U91B 4NQCB 3UYOD 4HKXA 5D1QD 2AI0L 2FBJH 2IXQA 2WQAA 5D1QC 3T4AB 3B3IB 1XMWA 4RZCA 3VMPA 1QWNA 1P4IL 1WFMA 2A6IB 2KLRA 2YPKA 4E41B 4PJ6A 1QLFB 1DL7L 4K3DL 4N58A 4M8QA 4YEFA 4C00A 3BPOB 3AG3B 2O5YL 2MQGA 1RVFH 3ILDA 4PJFA 1Q9FA 3X14A 5ALBL 4B9FA 1EAQA 2K7PA 4U7SA 5D1XE 2FHBA 4G7QB 1KGCE 5E5LA 2JCCA 4YE0A 2PUQT 4JANB 2O6FA 5KANI 1D5MA 5E6ZA 2HRLA 3ZHDA 2FO8A 4F57H 5GGQL 5KBKA 1U33A 2WZ6A 2X9KA 3RIFF 3GHBH 5DJ8A 3AY2A 2BSTB 3ZUCA 3V8CA 1HJBC 4N8VA 1FC2D 2QQQA 4ZTPH 4NSKA 1BMWA 1QOKA 1UOVA 3GJFB 3FFDA 4UU9B 1KB5L 3VFTA 3LV3A 5C0AB 4NJ9L 1QFUH 1XF5A 4P9ML 4JFED 2PKDA 2BRRH 2GW5A 4FQQA 4MZ2A 1KGWA 3C60B 3T0EB 1AKPA 4LCCA 3K8KA 4N8PA 3E8VA 5D8JL 4LQ1A 3IDXL 1QRND 4D94A 3LK3B 3ZW3A 4PH8A 3PWVA 4LSVL 5T5FH 4XVUD 5I0WA 4XVUC 1BAWA 2IOIA 3QDMD 4FI8A 4MX7A 5TQ0L 5LHDA 1BH3A 2EICA 3RZWA 1QBMH 3GK8H 3L08A 3P4MA 1EHKB 4GAFB 4PW9A 4XOBA 5I1EH 4R96A 3WLBB 3QDJA 3EDDA 3QARA 3U2SB 2FDBP 2A4CA 2G3XA 4JDEB 1AAJA 3FO2A 1S7UB 5F9DC 5B8CB 2OXGB 1XGYL 4WFFE 3C5SB 2W60B 3EYSL 3NCWA 1N3NB 2ZXEB 1HEHC 2YXVA 5E2TL 1MW0A 2VITB 4L8CA 3ARBB 3U0WL 1BAFH 1LE5A 6PRNA 3WNKA 3QCUH 1DBKL 1XFPA 4N8UA 2MSPA 2X70B 4JS7A 4NO3B 2GJZB 4OLXH 2IQ9H 3MODL 5FGCE 3LXCA 3BIAX 1DUYA 2ICEC 1YUHA 3PWJB 3MREA 3M1CA 4P46D 3MJ6A 4OZ4A 4P46C 1T3FB 4AE0A 4KVNL 1JMZA 1MW2A 3ULSA 4HPYL 4GSXA 2L3BA 1YQ2A 2V8LA 2I9LA 2W0LA 2XZCL 3UROR 2DLIA 3CPUA 3ERXA 1EEZA 5I1KH 3AQZA 3QNYB 4RQQB 3C87A 1PJ9A 4NNXB 3JCUO 4FZ8L 1A6UL 1OSPL 4G8GE 4U1GC 4A63A 2XPYA 4MB1A 2ZLDA 5CGYD 3KNBA 3IPBA 5CGYC 1V54B 4HK0A 1O6SA 1HYSC 1PNDA 4PS4L 2AP2A 5EZOH 5BRZD 4OLYL 1Q4NX 3ESNA 3A6CL 1Z9PA 4Q6YA 3RY6C 4RA0C 5A40E 3MXWH 3CC1A 4EI5A 3QQ3B 3V0DA 4J2XA 4JQXA 3PL6D 3PL6C 3S36L 3HEIB 5IW1B 4X5XB 1A6VH 4PG2C 3BVXA 4E9TA 3G5VB 4GP5B 1Z3GL 4NOBA 1GS7A 2X28A 4FZLA 3U2IA 2WXIA 3OKMA 4K5PA 4L0ZA 2FSDA 1ZPUA 1GS8A 2VR5A 3LS5L 5L2KB 2J8UB 1RJZA 3APFA 4YGAB 3EGXA 5C9JA 2J12B 4F2MB 4LSUH 1L0PA 2B0SL 2E59A 3ZIMA 3SYCA 3A0OA 4GKZB 3IU4H 3BKYL 4GQPH 4RAVB 3ZK0A 3SY7A 5E1AB 3TF4A 1SDDA 4TQEH 2A0LD 1VGEL 2A0LC 2A6KA 1HAWA 5LUMA 3AU1B 3B9EA 4AOFA 5I6XC 1NEZG 1FUNA 5CSZA 1HHHB 1PF3A 3CJJA 4DH2A 2VDRH 3HC4L 1BJ8A 4RCAA 4XMVA 5DS2A 5EN2B 3TA3A 3WEAA 5FUOL 3VXUD 3EH5B 5L88H 3NA4A 3OMIB 2X6CA 4X6CF 4J4PA 4OU3A 1ADQL 3R18A 1FZJA 3BVWA 3FW6A 3TEYA 1KC5H 1XGUB 3SYPA 4C4BA 5JW4Q 4TSBH 3C6LB 3EDEA 4I85A 4WY7L 2LTQC 3GSVB 1GPOL 1QSFD 5IQLA 2P5ED 3BIKA 3NJIA 1WWCA 4AQ1C 1H6UA 4S2SA 5I5JA 1Y0LA 1BXXA 1UJ3A 4HFUH 4ZX5A 1NMCC 2J4WH 3MLUL 4GSUA 5EFIB 5HDBF 3L3IB 4R7NB 3PJNA 4HQQH 1BBDH 1FVCA 1B0RA 1UH3A 2MEJB 5KVDE 4O49A 3TIEB 3WN6A 5KSBF 2YXWA 1X5AA 1SHXA 5I71B 4OD2B 1NIDA 3ROOB 5IF0B 2C3GA 4M7ZC 4OF5A 3WI9A 3WTWA 1XF4B 3FFCE 2VLJD 1K4CB 2YBRB 2PCPA 3FQ1A 2HH0H 1TZOA 1NCWH 1R5VB 2FQEA 3GS4A 3GB7B 4KV5E 4H8QA 1PPIA 3V5HA 2E47A 2WCGA 5A2JH 5EBGA 2QQNH 1NKRA 3LRHA 1G7PB 3O6KL 3E1ZA 1JV5A 4P2QB 1RURH 5HYSA 2YGQA 3BAEL 5IUSA 3CVCA 4DN3L 1QWHA 3ZSTA 1A1NB 4Y19B 4HUXA 5KVFE 5DGQA 1HOEA 3UC0L 5ESVB 4AWJC 4EDXB 5IUCA 1S46A 3EW3B 4XB3A 4N0UE 5ITBL 1OCZB 2AJSH 1B2YA 4WI4A 3ULUH 3V10A 2Y3AA 3VWKA 2ARJQ 4FFVD 1HL8A 2OX5A 3HHRB 3CX2A 3JTSB 1EQWA 4FFVC 5CILL 5KSAD 5SWZE 5KSAC 3FRPA 2QHRH 5D1ZI 4N87A 4LIQE 2AK4A 2XTRA 2P44B 1R3LB 5EZPA 5IT2H 3HRZB 2X89D 4XMKH 4P3DA 3GTTA 3RYMA 3ZMEA 7PAZA 5T33L 4CRPA 4OLWL 2K9UA 1JPTL 4TQ8A 4AZLA 1VFUA 2R4RL 5F8RC 3MLTB 2PWFA 1IBGL 2ADFL 3HCVA 1TZ8A 3NJJA 1IEAA 3SQBB 3BKML 1IARB 4X8CA 2FWOA 3AQXA 1J8HD 3HN5A 4UT9L 2IGFL 2N1TE 2CU9A 2GSGB 3FK3A 2OMVB 2E7LA 3NJTA 4X6CB 1GGBL 4IJ3B 3F00A 2MWCA 3I74A 4XMPL 1C5DB 3UL4A 5J89A 2YPVH 1NUNB 1EEQA 1NCGA 4XC1L 4G43A 2W1NA 4JRYB 1PNCA 3QS3A 5L6YL 3PG2A 1BQSA 2H0FA 5D7KE 2AJUL 3UYRL 2EDXA 4WEEA 2DI7A 1A6TB 3W2DH 5T3XH 4G3YL 1N64H 3C5ZA 5KSVA 3QEQA 2GSIA 1CDBA 1G43A 1WITA 3WNLA 4O02H 4LEEA 5HDBB 4EVNA 3UACA 1FZKB 4X8JB 4XN7A 1Z32X 3VA6A 3NSGA 1OGPA 5E8OB 3GFUA 1MCNA 4IRZH 1TYJA 4HIIB 1A7OL 1KLUB 2D3JA 4FKHA 1HHJA 4UTCA 5C0BA 3VSUA 5E0FA 2Y2YA 5HHVH 4PN6A 4EKXA 1F97A 4ONOA 4JPVL 3B9KD 1G7IB 3IF1A 3S3CB 3J2PA 4HJEA 5ESAA 1KY7A 3GZPA 3KE0A 3OC8A 1CTOA 2YSSA 2APSA 1FVDB 3ET9F 1E40A 1E5ZA 4CMMB 3MBEA 4KGJA 3HUJF 4X7DC 4OIBA 4X5QA 4F5CA 2B59B 1A6AB 3KPQA 3BCFA 4WFED 3D4GA 1MCWW 3EUUA 2VN6A 1E9OA 3GI8H 4JG0L 2CRMA 3EZJB 4JRXA 5J11C 4HEMA 1PZUB 1UB5A 5GSVB 2OSWA 1SBSL 4MD4B 3IJSA 1XHHA 4OV5A 1EJFA 4PJAF 1MFCL 1ZLEA 1TETH 4PJEE 2EH8L 3LZQA 4JFEE 4DP7X 3ASNB 4EXKA 2Q8AL 2D73A 4R90H 1OCCB 4KMQA 5IYUA 1BOYA 4HA1A 3GSXA 2R0KL 3OMZA 1CU4L 5EB9A 1KPUB 3HVNA 1XCTA 5IHLB 3MJGX 4N2NA 2O30A 1M71A 1UYWH 5FYKH 4QOKD 1MRCH 3CU7A 1XIWB 3QNXB 4ZSOB 1J87A 5IQ9B 4IRJA 1WFTA 2JB6B 3VFOB 4NUGH 1IFHH 3G6AB 3L5JA 1AO7D 5EU7C 3L4TA 2K9FB 4DCQB 4H7VA 5A1AA 3QUZD 1BOGB 3QUZC 5DJ2A 2DY2A 1Q9OB 3RE0A 2CDEA 1S7VA 5JLZA 1NPNA 4ZD3L 3HZVA 4PCKA 2H8PB 4TLUA 3LK42 2XWBB 1Q9WA 3QJZA 2DMCA 3PNWA 4L3ED 2B1AL 1KWKA 1U3JA 5E2VH 1UADC 3TC9A 2J56A 3HBPA 1WAAA 3ULVL 3MSPA 1T1LA 1NIBA 2HKHH 2KZWA 3DVGA 3V8UA 4YPGB 2Q6WA 3LNIA 5DHEA 1NAMA 1JWMB 3F6IA 1ZA6B 4KTDH 4JW3A 4PRHE 4YHLL 5IB1B 5KVEL 3BAYA 3UJTL 1JNHB 4E9WA 2JMMA 2BVQB 4JQIA 1D3CA 3F04A 3GMRA 5DWUL 4PJ8B 4UQ2A 4M4RB 5KVMC 3WE1A 4IBZA 3RFZC 1FAKT 1AXTH 35C8L 4M6OL 3ZYIA 4GQQA 4N2BA 1N6QH 1E90A 3VFRB 3DKHA 4BUGA 4JRFA 2XUWA 3BP6A 1EBAA 1XGTA 1E27A 4ZMAT 1BBJB 1GGTA 4Q6IC 3WE6B 1Q9KA 2C9AA 5AVWB 2QEJA 3TCLB 3FNKA 5C08A 3BP7B 3V0WL 2OZ4L 3GXUB 3HOEA 1JWUB 1CCZA 4XR8C 4X8GA 3FSOA 4N74A 2J4UP 4BGDA 1AANA 2DWEA 4Z7NE 3D2UB 5E70A 2Y1AA 3AM8A 1D7FA 3VA2C 1BLNA 1EK3A 3CZLA 4OT1L 5E4OA 1CGWA 3HUJB 2ZKMX 1B90A 4S1SL 2X5PA 4FULA 1VZIA 4IL6O 3E38A 4L1LA 2KKQA 1AY1H 3KJ6L 1ETB1 5H35B 1TQCC 2GB2A 1NBQA 2CKNA 3QZMA 5F21B 5IB5A 5AB9A 4AMXA 1WFIA 3SE3A 3WBDA 3PIQB 1NUDA 2IDSA 1ZRUA 4FUVA 2H7WA 1WF5A 2A4EA 2X4OA 5JPNC 3BRGC 5FB8B 4U0RB 4HWZA 4UZUA 3VXUE 2AV1A 3QUKA 1VEPA 1A8ZA 1RZKL 5LCVA 2W94A 3NIFB 2K3TA 2B39A 1I8MA 4XN1A 2OK0L 1X6NA 2J6EA 2QDVA 2PP8A 3FT4B 1IO4C 1BM3L 1FSKC 4TLTA 2A1WL 1MHCB 1QATA 4JX0A 1BJMA 2BERA 4FQLL 5EO0A 1B4JH 4PJ0O 3BEVA 3MA9L 2OMTB 3GMPA 1J05A 5I76A 3VB9A 2NUPB 5DVKA 1HTYA 2CMRH 2CIIA 4ORGA 1NANH 4J1UA 4W9HC 4N86A 1B9ZA 4MD0B 1AC6A 1X5KA 2BIPA 5DT1L 3CK0L 2HVJB 4BKTC 2F74B 3NZHH 3APNA 4XX1G 1P7QD 4LLYA 4Y16A 3AA0B 2HPOA 2ZUYA 2VQ4A 4MA7H 4MRCA 3RGHA 3TA4D 1C12A 3OX8B 4OZIF 4JJ5B 4ZOCA 1UD8A 4E5XB 3K19A 5EEWA 3WMSA 3DTDA 1XEUA 1FGVH 3PQYA 3RG1C 1P2CA 4O58L 3UAAA 3S8GB 1AQDA 3H53A 2A9NH 1CFTB 4FG4A 5F9WC 2IALA 4QWWC 2WLIB 1P5UC 2ZF8A 5FXCH 5DZAA 4JCMA 4K94H 5ALCL 5BOZG 1DLHA 1YG9A 2BC4A 3GXDA 2HYMA 3JZYA 3MLSL 4K71B 5DTFA 2EZ0D 3P3TA 2EZ0C 1CDGA 1U8QA 3GBML 5JYLA 3IAPA 3F7YA 5LDSA 3KYNA 1SJVA 4IGBA 4NKDA 3K2UL 1TJGL 2F08A 3KYKL 3MTXA 1F86A 4WFGE 3GNML 3CV5A 4F9LA 3EYOA 4PVBA 4WVRA 4X5PA 1ZV2A 5KG9B 4Z3IA 4P5KA 4UB0H 3QZWB 4IIZA 1ZHYA 4MCZA 3FSWA 5DJXA 4RIRB 4TTGA 1NEZA 4G42A 1IGCL 1JYXA 5AAWC 4ZMYA 4N3TA 3FSZA 4H88L 1GOGA 2VR9A 4WHCA 4ODTH 3UCRA 2OMWB 5CCKH 1U4EA 1OAKL 3DETC 2PP7A 1FN4A 2G75A 4NM4L 4H2AA 4R4NC 5AVSB 3HS0B 2QELA 4N2HA 4XBGA 4MJHA 5B3NA 1LO4H 5I0DA 1AMXA 4I2XE 1AGDA 1KCBA 1LQBC 1NAKH 2E5EA 2VN5A 4YHIA 4F9PC 1RP8A 3WU2O 2ZPKH 1QSVA 3Q6FA 3VXTB 4AJYV 4QF1B 3C08H 1QFWM 5EC2A 2H3NB 1RFDH 3BUIA 4XP1L 3REVA 4F91B 1I75A 2ESVA 2KDYA 1D5RA 1EAJA 2BJML 3GRBA 2WJRA 5GRZA 4JLRB 4QT5B 5L0QC 4FAAB 4YQXL 2QZ5A 4X9BA 3POQA 4HWNA 2E6PA 2VJ0A 4PGDB 3D3VB 3DUUB 3QG6A 5JHDE 1SFDA 3VCLB 3W39A 2NYYD 2NYYC 2FSEA 4TQIA 5AVQB 1JF6A 4XCYB 5LAXB 2I24N 4PTTA 4NBYB 1DZBA 1AR2A 1ZT7A 5DL8A 3VRLF 2IXQB 2AXGB 4XNUL 3SQOH 4F7TA 2Z31B 2P8MB 4MJJA 3VNYA 3GMOA 3VXMB 1S3KL 4RZCB 4TL5A 1O0VA 5HHOA 3AT8A 2BZCA 2YPKB 3MRLB 1URZA 4GAJH 4ZW6A 4KJWC 4N1CA 1LO3L 1P4TA 1HI6A 3G6DL 3OWRA 5EZIL 1NCHA 4Y2DB 4N8CH 1QHPA 1WFUA 1FNAA 3DLQR 3DXAA 3L9EA 4U4IA 2I9TA 1KCLA 1MCDA 2JCCB 3VH8B 2MCPL 4JM4L 1D5MB 3AG4B 4OZIB 1GYUA 4OQ1A 4LHJB 3SDDD 3I9GH 2AQTA 4OLVL 3SDDC 1NM9A 4N8VB 3V4VH 5BUGA 3UIZA 1QBBA 3PGFH 4FJ6A 3T0XA 4NSKB 2F58L 3V52L 1KTRL 1Z9MA 4NC1C 1E8YA 3WHE1 3X3FH 1GZQA 1XF5B 2VLKE 4I8DA 4KUZH 4WGWB 5F97E 1BVNT 4MD5A 4YSSA 3UGXA 3BC9A 1UOKA 3ZHKA 3TNNA 2OKMA 1RUMH 2H26B 3NJLA 3QORA 2JXMB 2OYMA 4HIHA 2G2NA 4YR6A 2JELL 2RIKA 2V7NA 1QFWL 3PWVB 3EO0A 2BSRA 1P7BA 4IDLA 4GY4A 2A73A 4NKMB 4DKTA 4Q9CA 4X6FA 4LCWD 4UTAA 1Z2KA 5HHNB 4Y4KA 4R96B 5ES4B 4GRWH 5E6YA 5LGHH 3FO2B 1RZ7L 1EZUA 4RESB 3MA7B 4XXWA 1NCJA 2WKGA 1A1OA 4KTYA 3FHAA 2CZNA 5LKNA 4S10A 4D9QD 3QIBD 3SEPA 3QIBC 4L8CB 1CGTA 4BUQA 1LE5B 1YQVH 2LFGA 4KRNA 3QR1A 5AKSA 2WZPA 2VMEA 4NENA 4D65A 2ZKYA 3UBFA 2E27H 1XF2B 4J8RA 4DTGL 1RHHA 1DUYB 4ZPTA 2DMGA 3IKKA 15C8L 4J3OH 3RU8H 5DJCA 1KT2A 1B0GA 1JFHA 2MHAA 1X7QA 3K2IA 3ULSB 5FS5A 1ZLVK 1NGWB 2AABL 5ID0A 2N2LA 1EEZB 3H9YA 1AD0B 1HHGA 2Y7NA 3GIVB 4FTDA 1FL5A 1FORH 1JXDA 4ALAC 4F3FB 2Y6SD 4QHKJ 4HS8H 1SUJA 4LEOA 1S7XB 5JORB 3D1MC 2NCEA 3BPCA 2NDFA 1MAML 3KNBB 4XPHH 3OGCA 5JNYA 2XG4A 4HK0B 2E9WA 3RX9A 2ZOLA 4PJ5E 2G2RA 1OCOB 1INEH 5HBBA 1BYPA 4JFXB 3ABGA 3LB6D 2ZQKA 3LB6C 4JGUA 4RLDA 4EI5B 3HFML 4AYDC 4PCYA 4TNVF 4GSQA 3VSVA 1FDLL 5E9DD 3BMWA 4K2UH 4HKZA 4PRNA 1N26A 4IU3B 2JLLA 4F7MB 1F4WL 1J9QA 1NCAH 1V3KA 4LO9A 3OKMB 1XD1A 2PMZA 1RIHL 2HX9A 2G2PA 3EGXB 2NSMA 4ZAKC 4ZAKD 1T89A 4MFHA 1OCWH 4YHOH 1J8KA 5CAYB 3DHJA 5EUOA 1BAGA 1TOXA 4G83A 1SHWA 4RA3A 4OCSL 1GSKA 4LEXL 3TH4T 2B15A 3WFEL 3EYFB 3TBBA 3JT0A 4LSRH 3BQUD 3BQUC 1BX2A 1QTSA 3NFPB 1U8LA 1Z5LB 2AAAA 4RWYH 5CSZB 2EYSA 3ARUA 1CLYH 4U1HB 1LNUA 7PCYA 3RWDB 5HGDA 5T5FA 4Y4HD 4Y4HC 1GC1C 5CEZD 2QR0A 2E3VA 1FZJB 1UWGH 1F11A 3KLDA 2KT6A 2YC1B 5TTRA 2D03H 3S2AA 4R7LA 2NY6D 2XTJB 1DO6A 2NY6C 3TBCA 3UZQA 1WCBB 1M56B 5GXBB 3D85A 3MLVH 3POXA 4KZDL 5CLYA 4LPWA 5I0XA 1NGZA 3MUZ1 4M7KL 2HJKB 1UWYA 3BZEB 1UJ3B 1XF3B 2FD6L 3H42L 2FE0A 1BGXH 2E46A 2HT3D 2HT3C 3VGHA 4YSQA 1W0WA 1F4YH 4OJFL 5DD0L 4PP2A 2ZOTA 4N0FB 2AXHA 3CZSA 4GFXA 4KMTL 1M53A 4QCIB 4Y0GA 1ET8A 3TN0B 3BAIA 2Z3FA 1ZHBA 3ABMB 1BZQK 4X9FA 1J1XL 1OOWA 4HDIA 5TF1H 3U7YH 5FAAA 4FG0A 3AXHA 2WBXA 1EJ8A 4P4RA 1I1FA 1JRHH 2QQLH 1DVQA 4PJIE 3WFHA 3ZVVA 4NC2B 2DIJA 3JV6A 3HG1A 4IW4C 1LO5A 5AQ0A 2DH3A 3AA7B 2AJVH 4YSPA 4EN3B 3Q5OA 4MB5A 2HN7B 4QXGL 1KXVC 3VH8G 4WI7A 2DIAA 1INQB 2CO7A 1U8NA 4TPRH 4NYLB 1OAYL 1PG7H 4KXDA 4EIZC 2VQTA 4OTXL 1O5PA 1JFQH 1XD0A 4G8IB 4KQ3L 2BS9A 2WIIA 1OAZL 4HUUB 3H3PL 4Y4FD 1JV5B 4Y4FC 5EOQL 2YAOA 2RB8A 3TT1H 3QYNA 4R0LC 4G5ZH 3MLXL 2XE2A 3FQNB 1A8JH 4QHNA 3FUHA 4HUXB 5C97A 4DP6X 2FZ3B 3F7VB 1HXYA 1OB0A 3TO4A 1UM6H 4UIKH 3QWOB 5F7EH 3STZA 3O8XB 1A3LL 2V5YA 5E7FA 3BD5A 2DQIL 1RAMA 2C9SA 1U8OA 4C4KO 1T1ZB 4CDHA 4HH9B 4YSEA 3STLA 2ZCLH 3L3GB 2RALA 4Z8FL 4PGEA 1JGVL 5E94B 2OTPA 2AK4B 3MV9D 3FO1A 4P4KD 1Q72H 1RPKA 3QDHA 3G5YA 4QHUA 5F1SA 3JTTA 2F5AH 1MH5B 5A2IH 5D7IE 1A9BB 1EGJA 2AJYL 5DVLA 2I26N 1PL3A 5T3ZH 2EDQA 3KBHE 3QSKB 1IILE 3IDIA 3GTNA 5DHVB 3Q8FA 4NO0D 4QY8B 1NKGA 4WKXA 3BD4A 1BZOA 3RNKB 2GEQA 3PQSA 1MIML 4HWEL 4N59A 4XNYL 3MRGA 3U79A 2E7HA 1O7DC 4GAYB 2XXMB 4CKQA 2J57A 4N4YB 4H0IA 3O4LD 3MNVA 3QIWD 3QIWC 3ARED 2ZICA 3AREC 4PB9L 2GK0A 1JZ8A 5AG9A 4Q9QH 2FWUA 4HC1L 3OF6D 1WS7A 4J7RA 1A7RH 2BM3A 2VDQH 4KU1A 4Z0BH 1M6OA 2BY1A 1JVOA 4G43B 1A14L 2G9HA 3EF4A 4OFVA 4F7PA 1L6ZA 1V7ML 1KXTB 3ARFD 3ARFC 4HGWA 4ILDA 3VYNA 5IY5B 5E08H 1MXDA 1YDPB 1I85C 4WW2F 5I8KH 4IMLA 5F7MC 1DVFA 4X6BA 1T2XA 1I7RA 4UILH 5CINH 4YFEA 3LPGA 2BY0A 1YPZE 4GUPA 3QJUB 4WI3A 1A65A 2V2WA 3QEQB 1SM3H 1CUOA 1T0NB 2Y72A 3CH1B 3DV6A 3KPNA 4KRAA 5FX3A 3FQTA 2IFFL 1ZS2A 2NW2A 4LLDA 1PKOA 3QXAA 3LK2A 2WKOF 1SLUA 1U0QA 3B5HA 3JV4B 4KY1H 4L4TD 1JHTB 1K5WA 2XV3A 3CZEA 1KEMH 1MM5A 2VDKL 3LKQA 5FLVA 5E2WL 5C09A 4ODVL 5KVDH 3FB5B 1JYVA 1WHOA 2G3NA 5K9OA 3V0EA 3DA0A 1HHJB 1W6LA 4FEMA 5C0BB 2DBJA 3BPNC 3DROA 4OBSA 4DF9A 3LPWA 1YNLL 3UAEA 2CG9X 3RUGB 3VXNB 4OB5H 4LRIC 3IF1B 2G3ZA 2JJSC 2QADB 1ZWIA 4TUUA 3CSTA 4MXWL 4P5TB 3TL5A 2WLLA 4LP8A 4OSUH 1AHWC 2DW5A 3F01A 2ROYA 1N7MH 2XNAA 4APXA 3CX5J 2WZ0A 3MHZA 3DX7A 4FG6C 2AEPH 1JYWA 3KPQB 3DC0A 1VGKA 3PF1A 4QHLA 1BD2D 3O6FB 3KPOA 2CUHA 1E4XH 4HMEA 3MGAA 3E8UL 5KVFH 5IQ7L 1UB5B 2MCMA 1JERA 2AJ3A 4NRXA 4RGND 4RGNC 5DJ6B 3EFDL 2VRKA 3CE1A 2K6ZA 4PPTA 3FQUA 4FTVA 2VCOA 2CKBB 4AYMC 2XETA 4HT1H 4Q4IA 4DUXA 4WTZA 1UFGA 2HJLA 2VUKA 1Q1JH 4YLBA 1JE6A 4M7LH 1L9PA 4LIQH 5HGBA 5HGHB 5IOPA 1XCTB 5AW7B 2J43A 3X13A 1OPOA 5JPMB 4JM2F 1MJUH 3DSFH 1YYCA 4MA1C 4N1HB 1PSKL 3GEWB 3LN5A 1M71B 3L5IA 3T6XA 1NCNA 4XAWH 4YX2L 5LVEA 5DEJA 3SGDI 2NY4B 4NO5A 5GV0A 5DUMH 3QDGD 5GJSH 3ZL4L 1C08A 4IBVA 3OJDA 3M7OA 1NCCL 4PRPA 2XN0A 1WTLA 5DJ2B 3NTCL 1PBYA 4ZJ9A 3U6RB 3SKUD 3R7QA 1R0AH 4N0CD 4N0CC 2YPVA 4X6EA 1DSFH 3JZ7A 4W81A 4YE4L 4NPKA 4G80B 3L5XL 4LCUB 5E95B 1TNNA 4HCRH 1IAIL 2VW4A 2AW2A 2DLEA 5E5MA 2Z4QA 3F6LA 3TEWA 3EJSA 3IDJB 4OF7A 1BWWA 3IDNB 2V5MA 1NCIA 5F1OB 3ZTCC 5EZJB 3K6OA 4AC4A 3FT9A 4H5SA 4WW2B 5CSGA 1RU9H 3PFQA 1NAMB 3D09A 1UXLA 1JOIA 5KS9A 4NRZA 2ERJB 5GS2D 1RD6A 4X42A 4PJ9A 1IGJB 4O3WA 1NGPL 3WTXA 1LP9A 4YBLB 4U1NB 3GMRB 4HUMB 5C0CE 2EEBA 4IRZA 2F7PA 3HAEH 2EIZB 4X5WA 1FCGA 4A6YB 4OM0L 4M6MH 3T65A 2XVLA 5ACLA 1E27B 4JMXA 4UQEA 2ZX5A 3BO8A 1FZOB 3PGSA 4P23D 1OGSA 4P23C 1H9DA 4JK0D 3GHEL 5C08B 3BUPA 2Z8SA 5DJ0A 5IWLC 3N2JA 1OGAE 2DQHH 3UABA 4CBZA 4P59L 5E9DE 3T3ME 5LWYH 2BMKB 3MYJB 1J1OH 1I9JL 4RMRA 2VSKB 3ZQXA 3IDYB 5F1NA 1BLNB 2DL2A 1MRDH 3DV4A 1BP3B 4N0YL 3QNZA 3BZFA 1OE3A 3LRSA 5J4MA 1BXVA 1I1CA 1SZNA 2ROXA 1EHXA 2ZUTA 2NX5A 3HC0A 4KK9D 3KPRA 4KK9C 4RETB 3ELQA 1LTXA 4KX7A 4UT7L 3S34H 1KIPB 2X41A 3FFCB 2MNJB 5ITFA 3TZGA 3ECWA 3OKKB 4J6RH 5G4OA 1QUPA 2QGBA 3GZQA 2ID5A 3LKOA 2NQDA 3LEVL 2YAEA 4WU5B 4G75A 3UTTE 5JXAL 2X4OB 4J3XA 2L0DA 2BCMA 3BKCH 3WSQL 4FKEA 1YRKA 4PU2A 5HD8D 5HD8C 3IJHB 2BIOA 5I74B 4BSWA 5L7XL 4X7EC 4I18A 4Y5YA 5DJZA 4U2ZA 2MPAL 4XPGL 4JM2B 4Q8BA 5DC9B 5BS0A 4A7GA 3UIYA 3MTRA 4ONFL 5HPMA 3DGGA 2R9HD 1OSEA 2R9HC 3KYMA 1V3LA 2NY0B 3ZGHA 1YN7B 4PJEF 2EEFA 3NBNA 1J05B 5I76B 1CJYA 2LU7A 5HDRA 5AW8B 4ORGB 2CIIB 3RY5A 4UOW1 4J1UB 5CZVL 3UDWC 3ZRCC 2PN5A 1PX8A 2V5RA 3WIFA 1XVSA 4WEMB 3MCG1 4FXKA 3NCYS 4KC3B 1Z5YD 2WQXA 3I9IA 4L8SB 1CF1A 5HHMD 5KYUB 2ZYHA 1UH4A 2X7LB 2WVPA 3P0YH 4B50A 2F53D 1SYVA 2Z93A 1G6RA 2AV7A 1U41A 4Y16B 3BUDA 4RISH 1DANT 2Z65C 5F0JB 2KHAA 3EJRA 4B95C 5FK9B 1BIIB 1YYML 3ARGB 4QRSB 1CGSL 2JKSA 1CXKA 4OZGF 2NNFA 3T08A 5G3AA 1VFAA 3KS0J 1BJ1J 5DMIH 4G9DA 4D9RE 1NC2D 3MRJA 1P2CB 1EX0A 4NZJA 3NK4A 3CLFL 4NZDA 5JQIB 2K3HA 5DC4B 4IIQB 2EUVA 4PJCE 1BJ1H 4P48A 5EOCL 3LIZL 1RZ8B 1U6AL 1LK3L 3MBWA 1DLHB 2BC4B 3OZ9H 3NCMA 2CKBL 5DTFB 5TFSL 5K1NA 3RGVB 2VZ3A 4KXBA 2BPBA 4NIKB 3F7YB 3FUDA 4UM8A 4V2CB 5JOFA 5AVRB 3JYBA 3REWB 2OCCB 3O41A 4PYHA 4PJXE 3K80A 4QPEA 4ES9A 2MFNA 1NCBL 3TYGL 1SLVA 1AVAA 3CHRA 3WS3B 1UH2A 5INDB 3CFDA 4LMQI 1PRNA 3N55A 4U6XA 5DJXB 3CFKA 3IMTA 1T03H 4GT0A 4NGHH 2OW6A 5TD4A 4WO4B 1T5KA 2F7OA 3H1ZA 2PYFA 1KB9K 4NQDA 3LH2H 1FL6B 2XPZA 1CR9H 3MV9E 2N01B 5KAQF 5FDWA 2BY3A 3CLWA 3UBXB 2G75B 1ZE3C 1VLXA 2JJTC 5AALA 3S36X 2IWGA 2RGSA 4HOWA 5CZXD 5CZXC 4CU8A 1AGDB 4LOFA 1NOLA 3B7SA 3CFCL 5A16B 3S37H 3WTVA 3WDJA 3T1WA 3EADA 3Q6FB 2F15A 3TS8A 4GUOA 1JDCA 4YDLB 5IHZA 4QRTB 3RWHA 2DZEA 4TVSa 3MCYA 5DQ9B 1YCSA 4Z7NF 4POUB 1MUJB 1NAML 1IM3B 2GK2A 5ANME 2VZTA 4I3RL 1UACH 4JQIL 3LRMA 5DZ9A 5FKAA 2PRNA 3TBWA 5GS0D 5GS0C 5E8PA 2ARJA 3BYYA 5D71L 5T1LD 3GJFK 3WFCL 2FSEB 3H9HA 4YNYA 4KFZC 4KTGA 1IQWH 2IPUK 4A6YL 4PTTB 1NFKA 4JR9L 1TQBC 5CF3A 3W0WD 3GBNH 4JFPB 4MMXB 2GPZA 5DQJA 2UZYB 4I3SL 1BQ5A 3A23A 3GMOB 4OCWH 4HWBL 2EIMB 4JFTA 5E99H 5HYJA 2F54A 1ODAA 3HOGA 4IKJA 4PRIA 2QGDA 4RVBA 5BRPA 1HOCA 5DD6B 3WI5A 3SZVA 4HVBA 4LSEA 3W37A 3ZDZE 4XNXL 5EBWA 1TZGL 2R0WL 1GGIL 1DLFH 1YY8B 3IDGA 3L54A 1TJIH 4AZ8A 4JO3H 4DGIL 1C8PA 4PW4A 4MNHA 3SKJH 2FO4A 2CUMA 3NIGE 2IDTA 4OZGB 3O2DL 2WNGA 2OMUA 1F8TH 1SXBA 4GUCA 5JXED 5JXEC 4N68A 3RWJA 3O4OB 3MRFA 2WXKA 3KVPA 3N0PB 1JZIA 4S1RH 5KTEL 2YPLD 4YHKL 1S5LO 5HDWA 1J1PL 3QUYD 4XNZB 3QUYC 2XICA 3D34A 1YMMA 3D0VB 4KTEH 4FESA 2OW7A 4HETA 3VX0A 3VW3L 4D2NA 3HNTH 2YD2A 2KZBA 3WY4A 43CAA 1RJYA 5B7FA 1RL1A 1BD2E 4PWEA 1DANU 2BSRB 2YFNA 2IWEA 2A73B 2J6EL 2X2JA 3ESVF 3AWEA 1BQLL 2B4CL 3G6JF 4X6FB 5IROA 1TTGA 1TXKA 2OP4L 5T1DL 2UXGA 1T2JA 2XYBA 3GINA 4MNQE 1KBPA 3T0WA 1NA8A 3L4XA 1LD9A 2QBWA 3MROB 1PFOA 1PDKA 3MKGA 3LEYL 3P40A 1W80A 3RILA 2KQNA 2NT0A 1DQLH 2UYLA 3AQDA 1V55B 4AG4H 1RZGA 4S11A 4GRLA 1E4KC 3M07A 4HMCA 4U1KB 4YHNB 5ICYA 2ARWA 1BVLA 2TSAA 3RAJH 2BINA 1JPSH 4FCAA 3BW9B 4LCCC 1RHHB 1NGQH 1IAII 3R7RA 1XL4A 4N90E 4BH8A 2AMGA 2GABA 4OD1L 2CK0H 4R4FL 1UD3A 1KT2B 4E1SA 4FQIH 1B0GB 1X7QB 4HW6A 2W91A 4ZNEE 5GTHO 5K1VA 2WB7A 1MFAH 2XN9E 4L05A 2EDWA 1FL5B 3PGUA 3QDJD 2E4FA 1A3RL 2APVA 2ZUXA 5DZOA 4WNQB 1AIFB 5I82A 4XNLA 5IHUH 4C8XA 3ZZSA 3D39E 5HVFB 5JNYB 2I60H 2XG4B 2WXLA 4Z3FA 2ZOLB 3CVHB 1JGUH 2YQ2A 4Y5XA 1OKEA 2HWZH 5CN3A 2CM5A 1A6PA 4DPRA 4N20A 3PPEA 5DJDB 2PR9A 3ETBJ 1IGYA 5ADOL 1J86A 1VRSA 1JF1A 3H0TB 4YPJA 1WWAX 4LKXB 5GISL 3HAEG 3NZSA 5I28A 1NC4D 4G8EA 1FNLA 2DQEL 4XTRD 4XTRC 5DZJA 2ATKB 4B53A 3ZTDC 4BZ1A 4UM9D 5GGVH 3T04D 4BWWA 4LLMB 3T20A 3V4VA 5AKTA 4GAGL 2VXTH 1XAKA 4Z7UE 2OJZH 1EDQA 1QJ8A 4JHAL 1UATA 4LGRB 2DQFB 3NACL 2VL5B 2IWVA 4G7YH 4HZ1A 4C56D 1KXQE 1ORSB 4LRNL 1BX2B 1GL4B 3ETBF 4PREB 3S3PA 3EFFB 4NPYB 5DI8B 2FB4L 4M7JL 5IR1B 4I5BA 5IESL 4UT6H 5DUBB 2QMJA 5HGDB 2NR6D 2NR6C 4F58H 5DMKA 4JQXC 1KNOA 2B2XL 3OXSB 4BQBA 3LVTA 5B7MA 1HEZB 5E23A 1B4TA 4C83A 4K23H 1KFAH 3L3DA 4KAQH 3VFWB 2R8SL 4NX0A 1AOZA 3OGOE 3RVUD 3RVUC 5D2NA 2XWCA 4BFJA 3D85B 1L7IH 3G6JB 3Q8CA 4GQRA 2LLGA 3MV7D 3NAAH 1FRGL 2SEBA 1I8LA 4DKFH 3MC0A 3SD5A 2YGNA 5DRWA 2B1HH 2DD8H 4PP2B 4AM0A 5L2JA 2CUAA 4JFUA 1DSYA 3WIIL 1ZHBB 4L8BB 3T1FA 1PCXA 4MHHG 4GG6E 1EHLL 4PCTA 1XMEB 4Y1TA 1KV3A 2ICWB 4P4RB 1PKQE 1XBDA 1JZ2A 1KXHA 3HG1B 4XE0A 5HHXH 3FULA 4K7FA 3ZZQA 1E67A 1K3IA 4JDTH 2WPGA 2WLZA 3HTLX 4K3EL 4TTDD 4UQAA 4TTDC 1MFEH 4ZUSA 3C8HA 1NH6A 2CXGA 2CO7B 2Z7ZA 1JCKA 1S4IA 4ZYKB 2FLRT 4N25A 1N5AA 4UUJA 4M5YL 2WBJB 5FYLL 3ZR5A 3L3HA 4AYNA 1YJDL 3FONB 4L4VD 3QI9B 5DUPH 1MSPA 5KSUA 3VRIA 1ZS8B 3K71A 3DDFA 2WXPA 2EKJA 1CF8H 1MZYA 2R2EA 5GTIO 2FBRA 4AUUA 3OLEA 4LPUA 1EXUB 2JNZA 3BHBA 5IGXH 2NNAA 1X9LA 1K4DA 3P30L 5FF6A 2A6JA 4TVPL 3WIHA 1PLBA 1O9ZA 3QFJE 5DDHB 1G9MH 1LWRA 4UTAL 1N5YL 1QWUA 4FL4B 3GPEA 2CO1A 3WJJC 3RRQA 2QKSA 3L5HA 1IBHA 1P5VA 3RL2B 1NICA 1V7NL 3P4NA 1CL7L 1L0YA 3OXRA 3CZGA 2P8LB 4KNTA 2RCSL 4NQEA 5EIIG 3AY4A 5D1XA 4GMTH 4FDWA 4R5XA 5KAQG 2R29A 1TNMA 1KELH 3AJ7A 2DQTL 1QABA 1I1YB 2XQBH 3R0NA 1ECZA 4O4UA 3PFUA 2FJHB 5BRQA 2HJFB 4BXSV 3WMPA 1VEMA 3WTTA 3BDYL 2DLFL 3L48A 4KQ0A 1AQKH 5HY9B 2HUHA 4MDIB 1C1EH 1PY0A 5FO9B 1G87A 4WW1B 2NY3B 4WJ5A 4YHZL 5I30L 3T0SA 3DSNA 4RJWA 1CFSA 3IK2A 1IMHC 2GK0B 3H7LA 5JIDA 1F3DJ 3ARVA 4G1MA 4FN0A 4TM9A 5DYOA 5IFAH 43C9B 1RJLB 4NUJB 3FL7A 3LEXB 2C3VB 5A7BA 2RA1A 4M56A 4F93B 1M6OB 4DOHB 3FCTA 3QS2A 4JPQA 1MLCB 5GS1C 1F3DH 2G9HB 1IAOA 3N50A 5K39A 5FC9A 5TE6L 4HGWB 3SE9H 4EDWH 4F7PB 4N22A 3OKNB 4HMDA 2P5WB 4NB7A 3CVHL 3NCEB 1I7RB 3OKOA 2HT2D 4X6BB 2HT2C 1U58A 3BGMB 5JHAA 1K72A 5KOVC 1BDYA 4BKLB 1FFRA 4PV9B 2VLKB 2J3SA 3P3UA 3O0EA 3MRCA 3AC0A 2Y9RT 4UV4L 4BSJA 1T21B 3MU3A 4Y8DC 2H32H 2XPGA 3SE4C 2I07A 3IAQA 3QXAB 4XC3L 4NKIL 4LKCB 3A6OA 2BH0A 4IOIA 1NBZB 2FGWL 3NQKA 1UQSA 3HNSL 2WXQA 3FTGA 2L8AA 3Q7JA 4ZO8A 2NY5L 5C09B 1ZHKA 3PHOA 1QSZA 1HSAA 5E1QA 2JIXA 3T8XA 3C2AH 2E7LC 2DKMA 3Q8AA 3L1OH 4DERA 1DDHA 1KTDA 3HI1A 3ZSSA 1M7UA 1EO8L 4O2EA 1T1WB 1GKEA 1B6UA 2BRRL 1CB4A 1ZWIB 3DMMA 2GITB 2Z4TA 3HI6H 1IAMA 2YFOA 1SQMA 2WLLB 4G8GA 5EULV 3TXAA 1BIHA 4PJIF 4FQHB 5EEUA 3P9MA 3C5ZD 3C5ZC 4E2OA 2E75C 5EHFA 4FF9A 2OV0A 3QCTH 1UXSA 4J3VA 1DQMH 3WJLA 1VGKB 4QHLB 3H54A 3NJXA 3KPOB 3V6ZA 2DMHA 4PBXA 5E6IA 5I1EL 3OPZL 3QR2A 4E0RB 1B0IA 2F1BA 2KYIA 5I1JH 3LHPL 3SDAA 1QPXA 1AG6A 3CLEL 3MRNB 3L13A 3ZE0B 3L95A 2AJZA 4BSVB 3FQUB 1GXEA 2O6EA 4Y2OB 5C0IA 3F62A 5I2IA 3HRPA 5EORH 3GZOA 3THMH 1F6AA 5FYJD 2HJLB 5HVGB 1I8IA 4GAAA 5HGBB 1OT1A 4JHZA 3F65A 5SX4H 4ZFOA 3X13B 1II4E 3ZKQD 4PJ5B 1OAXH 3S35H 5E2UH 5DYFA 3DJ9A 4IOSA 1DJSA 4TSCH 7FABL 5HP5A 7TAAA 5ISZE 3K8MA 3EGSA 4TNGA 3MBED 3OJDB 3MBEC 1KCVL 4XX5A 4IBUA 2I27N 5GZNA 1EO7A 4G6AD 1CLOH 1H3GA 1T5XA 1E2VA 3RI5K 1SYSB 1S9YA 2KS0A 3PNRB 3EUDA 1SOXA 4WDIA 4X6EB 3SDCC 3SDCD 3QUXD 4DP9X 3QUXC 4PTUA 5GGSA 4F7KA 3B5GA 4G82A 2YJQA 1U8MA 1A9EA 2LAGB 4G6FD 3HE6A 4PJGB 2WHVA 1CVSC 3P0GB 3TFBA 3T3PE 5B38B 2QSQA 3LQMA 2QHLA 4UMGA 4HUVB 3MCLH 4PJBE 2MMXA 3K74B 5IV2B 4X80L 2OYLA 4H5SB 2PETA 4WV1B 4PJHE 2AITA 5ICXA 4HIEA 5EO9B 1IKFH 3MNZA 5LG1A 2OS7A 3GSNA 4IRJD 4IRJC 1QVOA 2DYPD 2ADYA 3EOTH 4FQ1H 3GJEA 3H9SA 2EH7L 4BFBD 5KYXA 1UT9A 2FL5A 2YMXH 2UXTA 1XGRB 4NAJA 4PJ7F 4ZOAA 3WXWH 4ZXBA 3DI3B 3T65B 3NN8B 5BZXA 1IUZA 2BIMA 1EGJL 2EC9T 3PF2A 5GGTH 2HG5A 3JWOH 1UXMA 4NQTA 1QLRB 3U6XS 1F3JB 3CXHK 3MV8E 4PBDA 3MRRA 3VDBA 3CSYB 1SPDA 3GUFA 3PWUB 2AC0A 4PB0L 4OIFA 5F1IB 3UBXI 3ROLA 3WCYA 4ODUA 4W93A 5FUCE 4G5AA 4HP5A 5J1AA 1QSEB 4L0PB 4YXKL 2XYCA 4Z0XA 1RUPL 4CMHB 2I85A 3ARDA 5LG6A 5IJVB 4DZBB 3QNZB 4PJIB 3BZFB 3RDTA 5FM5M 4AE1A 3A6BH 3EO9L 5C0ND 5C0NC 3WKYA 3KPRB 1Q0EA 4JFHE 4PV1C 1KACB 2YJLA 4QGYA 3N85L 2B8OT 2HFEB 3OR6B 3V6BR 1KCWA 1G9NL 4N0UA 1RERA 5CHNA 1XB8A 2AQNA 3CN1A 1GJWA 3GM0A 5ELIA 2VDOB 9CGTA 1I9IL 2C3WA 5G39A 1DQKA 3LKOB 3DA3A 2BOLA 2XHNA 3PY9A 3V0GA 2XV0A 5I1DA 1BT9A 5CEYA 1AHKA 1KCRL 4PHXA 1A4BA 4I0PB 2YUXA 1MJ8L 2IGLA 4NHCH 1BEYL 3P11H 4Y5YB 4JCWA 1XB3A 1NJ9A 2B14A 2DTMH 2QV2A 2A9BA 1OIOA 4LHUA 4QRUA 3U6XA 3VXRE 1E50A 4K7PL 5EDXA 2IADA 2QTVA 4HPOH 1SNRA 5BS0B 3KXFB 2YMTA 4DEPC 4LOEA 2PORA 3K46A 5HPMB 5I1AA 5HPOA 1D5BA 1SVBA 3F6JA 3LRLA 4QRRA 1X5MA 4K9EH 3X3GH 4MHHI 2JJVA 3VGGA 5FFLA 3BD3A 3EHBD 3EHBC 1CD9B 2EP6A 3FUNA 3V6OA 5LNDA 1RULL 3P77A 5DURB 2DQDH 2VUOA 3KDPB 4HCRA 3L9RA 4NERA 5I0YA 2WLKA 2YA2A 3EYVB 4X4XB 4PRBB 3WNMA 1Q38A 2B20A 2E9IA 4N26A 5FGBA 1A1MB 3KGTA 2A6DA 3KYOB 1G6RB 5ABAA 2V2XA 5IOKA 2BNRB 4G6KH 3D87B 4HH8A 3FQ4A 1NFIB 4P99A 4FQPA 1UD2A 2WUCH 3IM1A 4S1DD 4S1DC 2BWIA 3JV5A 5C0RL 1UM5L 1ETZB 3JWNE 4Q4EA 3QRCA 4WWNA 1YY9D 3DVNB 1YY9C 3HAEA 1G90A 4FABL 2E76C 4MDRA 1MREH 4R9HA 1XO8A 3L4UA 1W15A 5DK2A 4E9SA 3O0LA 1XF1A 3P73A 3SSGA 4ACTA 8FABB 3LS4H 1FE8H 2YRPA 3SDXE 4PJ7B 4Q9RL 5DJAA 5B21A 4UM8B 2VH5H 2Z35B 5I19L 5JOFB 2R1XA 1RPUA 4OIIL 2J88H 1CL7I 2Q20A 4ZDHA 5K1JA 3V95A 4I48A 3JUYA 4AW4A 4F8OA 3APMA 2D0GA 1EHNA 2A99A 1Q94B 3UAQA 3FH5A 2KDGA 2XQYG 3KM2A 3B1TA 3FOLA 3LNGA 1A7PH 4JFZL 1AR1B 5JDJA 3LNEA 1IZJA 2V9UA 4RMSA 2RFXB 4I9XA 5J0BA 5FDWB 2X2HA 3PQYD 3L1GA 4L3CA 4KZEH 1UD4A 2YPVL 1AI1L 4MB4A 4JKMA 2DJSA 3MLZH 3PS6A 2X09A 5EF0A 4AC2A 4WHTA 5IB4A 2Q8BH 1CT8A 1NDMB 1YNTB 2NY7H 1A7QL 2MNHA 4B5ZA 2Q7AA 5JHLA 2OJEB 2V4LA 2VLRE 4D7PA 5GGRY 5B38G 4DQAA 1HWHB 1NFDB 2EC9U 1N64L 3GO1L 5IHZB 4NKOA 3SKNB 3T3MF 1N8ZB 2MIZA 1TPXC 4IGBD 3GSRB 4IGBC 4JFEA 1U42A 2Y5TA 3QO0A 1R3JB 4F9LC 1BCIA 4C58B 5IMMB 3O2WL 3I3BA 5DRZB 2SODB 1X4YA 2WVTA 5TDOA 4OCYH 1FH5L 4YXLL 2BVPA 3WTYA 3DZMA 1BHGA 4M8RA 2DBLL 3KG5A 1NEUA 1EMTL 3GHPA 4JKKA 5E8PB 5B39G 4HJGB 2W95A 1GC1H 3X12A 3GKWL 4IRZL 4UOZA 3QDMA 4AYID 1TLKA 5H8DA 3SY0B 4XHJD 3O11A 4XHJC 3OKEA 2AMUA 5DQDH 3UG5A 3GP6A 5AZ2L 2J71A 4Z7WB 1QX1A 3V7AE 4PGBB 1TZIA 2XXCB 2F9BT 2Y2WA 1HILB 3BS0A 1U8KA 5KJ7E 1ZGLA 2QSCH 3C9NB 4PRIB 4P57A 1SEBA 3P0VH 5CUSH 4Y9BA 4UAOB 3BAXA 3QPQD 3IJ7A 3QPQC 4HSCX 4YJZL 4R97B 5I1LB 1HZHH 1H3WM 2COVD 3EYUH 4AK1A 5EMYA 3TVMA 2ESVD 3DX9B 4C54A 1AG0A 4E41D 4N2CA 2FO4B 2C7UA 4NRYA 1DJIA 2HAZA 4AV4A 4P46A 3ZO9A 2OMUB 5A6LA 3WUWA 4FQJL 4MZIA 4POZD 3HI5H 4POZC 4YDKH 1TETL 3WIAA 2X1QA 4TVUA 5G5DA 3T2NL 3MRFB 4N75A 5C07B 4JPKH 1G7JA 5CWSA 5EIIA 1CE1H 4WEBL 3LD8C 2EIJB 5F96H 3NH7H 2DTSA 4L1TA 5GZOD 1YMMB 5GZOC 5HHOD 1A6WH 5BRZA 2BOBB 3UMTA 2YQGA 1T80A 2BVTA 3E3QE 4EBQH 2Y7QA 4JHWL 5TQ2L 5C0AD 3RY6A 3U1PA 3N9GH 1HSBB 3UEQA 3QHZH 5MENB 4F7CA 4NFBA 2XZZA 5EE2A 2ODHA 1DEDA 4AKRA 3B7YA 3NCYP 4PJCF 1MFBH 4EZKA 2FJFA 5C3IA 1AQHA 3V7MA 1MIEL 3LZFH 1YEGH 4PG2A 5C0CB 3ZBMA 2Z92B 4MCYA 4ZW7A 2ICWI 4V11A 2BHUA 3ZE1E 4KK8D 4KK8C 1LD9B 4P2RE 1P84J 2DWXA 3L3OB 1BFVH 1DN0A 1WZAA 2ZCZA 4ONGL 1A66A 5E2VL 3VD5A 2VM9A 4GIAA 2GIMA 5E79O 1PMYA 4PR5A 2XKNA 1LO2H 3UTSE 4OM1L 3WYRA 1RZGB 1UHVA 4F8NA 1GMIA 2VDPH 2XWDA 1G6RL 3Q3GA 4W9EC 5B4MD 5B4MC 3F12B 4QGTA 3LCYA 4LDOB 1OXYA 3T3MB 4OFKA 4HAKA 3VRJB 4P07A 1TENA 1GW0A 3KEDA 3QORC 3QORD 1R5IA 1KN2H 4FFYL 4JO2H 4BH8B 3ARBD 1NGXA 1SF5A 3VXUA 1Q0XL 4XP4L 4OGXH 2QVTA 3OHXA 3JWDC 2FH8A 3F7LA 2J20A 4BHUA 3VU2A 4BZ2A 1R24A 4CL7A 2GVYA 2K7QA 4OI9A 1NLBH 1QSFA 2W88A 1B2WH 5CM1A 2P5EA 1KGYE 3B2PA 4F33A 4XXWC 4WCYL 5I6OA 2Q7YB 3ULAB 2DDQH 4OF6A 3IDMB 2NQCA 3QXTA 3WDHA 1AJ7L 1U8IA 4XPFH 1OO2A 5LXGL 1IKNC 1MCEA 1JAEA 2IFGA 2A77L 3V8OA 4AIZB 4EN2A 5SWQA 4NDMA 5EIVA 5KYYA 4HZLA 5AW3B 1MAKA 4I9WD 4LNRB 5FUZL 4X4KA 4LBEA 5F6IC 1SF3A 3RWIB 4WIQA 4LLVB 2FTAA 1X5JA 1ZTXL 2FNWA 3VXQB 4U1IB 4OAWA 1P4LB 4JFFD 1I3VA 3PYCA 4OCMC 3V0VA 3SOBL 3QWQB 2CR6A 5DZPA 5C3TA 2VLJA 4WKZA 4MQ7A 1HJCA 2FJSA 2ZG2A 5CJOH 4CU7A 4Q9BA 2PPDA 2Q0ZX 5LQBL 3MCKB 2PPCA 5DD5L 3HNVL 4Y1AE 3ZDZF 1GYCA 5PCYA 4JGJA 2ZKHH 1KNOB 4F37K 4WSJA 3NIGF 4UNVA 2K70A 3U48A 2WNKA 1Z6JT 3CVBA 4XVJH 5JO5B 3MNWB 4MNGE 4F8LA 2P8PA 2BIIA 4KI5E 4DFHA 5J6HB 1SHMA 3PPSA 3A5VA 5KSAA 2SEBB 3EGDA 5CO1A 4PWGA 1AGEA 4XCCH 1T89C 1QEXA 5ECJE 1TQVA 2X89A 2IVFC 1N0LA 4AEEA 4YVUA 3TNMA 3RA7H 4KI1A 2VSDA 3I9PA 3K6SA 4I2XA 5CSBA 5I1CH 3OKLA 5BV7B 4MA7L 4H8PA 1A7BA 1K8DB 1FO0H 1SEQH 1YEDA 4Z7QE 4W9KC 5C7XH 4G7VL 1URIA 1IC7H 4IDJH 4GP8B 3WY1A 5IB2A 4IU2A 1J8HA 2P3YA 3ILQD 3ILQC 1RY7B 2QQKL 3MLPA 5F7LB 3JYCA 2X9ZA 3MJ7A 2ZT9C 2YD3A 4UUJB 2HKAA 2PWHA 1CXHA 4FNTA 4CW1B 1FPTH 5KSUB 5KW9L 1CYWA 3VRIB 1OD7A 5JHDA 1K6QL 1IEBA 2BW4A 2IG2L 3OQ3B 2R2EB 3KR3H 2DMBA 1QBAA 2BSBA 2OBGA 4LZKA 4UWQB 4FP8L 4HIQA 1N19A 2YN3A 3V0AC 4O5LL 2G60L 3OMAB 5DK0B 1K4DB 4X7TA 1NMBL 4UV7L 5AKVA 1UG9A 2A6JB 1J8SA 1P6FA 4FCHA 3I6KB 5CJBA 2NMSA 4NOFA 3PXHA 4QLRA 3T6VA 1HHKA 2JH2A 3VFPA 4KO6A 1KZQA 3MJ8A 4KMLB 4NQEB 5CGMA 2DRUA 4H8WL 4UBDD 4MA3B 5J13B 3KBEA 4WWKA 1SDAB 3DDGA 1N18A 2XRAH 2NW3A 1ZHNB 4UOJA 3SGEH 1DJWA 2VB5A 2WQWA 3HN8A 5EU6E 4NNYA 3D07A 4L37A 4NN7C 3B9KA 1XSJA 1HH9A 3HG5A 4EIBA 2H0PA 3M17A 3QUMB 4JVPA 4UT6A 3AW5A 2NLJA 4LK4A 4D7BA 5KUKA 2OSLB 5DEGA 1ID5I 2XQ0A 3TO4C 1U8JA 4TUKL 3VJ6B 4WNSA 3QXDA 4G1MB 5DYOB 3HVDA 4JN1L 4OFYA 1MQKH 2VJXA 1YZZA 3L3JB 4XI5D 4P9HL 1O7SA 3ESPA 4XI5C 4Z7UF 2XN2A 2N7AA 4PGCA 4XPBL 3FCTB 1RUAL 2JKXA 2MQCA 4HLZH 2OMXA 3I6GA 4ELKB 3GBLA 2UWEE 3UJIL 1CVRA 5C1MB 2EE9A 5BMFH 2IH1A 4QRPE 3L2LA 1S7SA 1T5WB 1N0XL 1WD9A 2X4TA 4P49A 3ZL1A 4DAGH 1TTCA 5IHWA 2MJWA 4YXHL 4OZFH 5DEFB 3T2LA 1RUQH 2VYRE 4PJDF 3H56A 1UENA 5JIMA 2XI9A 5IVOA 4QO1B 1UQSB 4ZUVB 5IKCB 4LCYA 4MZ3A 2VC2H 4BZ1L 2VR6A 2PR4H 2Q3ZA 1ZLUK 4LU5H 1V27A 1AO7A 1OP4A 1MELA 3TH3T 1HSAB 1JP5A 4JVWA 3T8XB 5CCJA 5MEOA 4UDTB 4NT6A 1KTDB 3AABA 4PWJA 2HFGH 3T6QC 2VDLH 2IPKA 3OZKA 5IEKB 5BZDB 1UCTA 5D9SA 1FGNL 5FFOA 1QUNB 5GGRB 4JB9L 4KNQA 4L3EA 1REIA 4NQCE 4DW2H 4XP5H 3DMMB 1XBRA 5F7HA 1JZEA 1DVFD 1M05B 1DVFC 5C2UB 1Z9LA 4R5TA 1TKWB 4E41E 3MXVH 3ASWA 3KGUA 5F9JA 3SKOA 4GMSL 2X27X 1R17A 2BP5M 3BKJL 3NSCA 2YRZA 4BBWA 1R3KA 1I3GH 4GW5A 2EDTA 3IBOA 1BQRA 4FC3E 5SWSB 3PWLA 3E6HA 5I18L 1GS6X 5GJTH 3SDAB 1SOKA 2L7QA 5F3BB 3MI6A 5J8OA 3SPVA 5C0IB 5I2IB 2O5ZL 1MCLA 1WVZA 1VPOH 2X12A 5JOPE 1CBVL 4U6VL 1T20B 4Q58C 4A1RA 4FJZA 5MHSE 4X9YA 4ZFOB 5C0AE 5BQ7B 1T22B 1UA6L 4HBCL 1RZPA 2E8ZA 1LM8V 1T1YB 3T0EE 5BV7L 2H6PA 2WKLA 3MZGB 4YDVA 1KYOJ 2HMID 2HMIC 3EGSB 4GKNB 5LNGA 2YLHA 3MN8A 4BM7A 1DBAL 5FO7A 3VI4A 1I7ZA 4PI2A 3AWFA 4K5MA 2CR3A 5J7CC 3ULUC 1T5XB 3ULUD 1XIWD 1S9YB 1ZDQA 1E0OB 3FT3B 3ZPDA 5B39A 4PRAA 4KVCH 2G5BB 4PTUB 4XMZA 1GFPA 3QO1A 1WLHA 3TJEH 1PTZA 2CRYA 4EF3A 2E9BA 1I1AB 5E4IA 4LARL 1J9CT 4YHML 4FTVD 4HIJA 3A0BO 4HGMA 3QJXA 3HHSB 4GEJA 3WTSA 4HYTB 3WKNA 1WE5A 2ETWA 3S0PA 5ICXB 4AEIL 5DMJB 3PJSA 3RWCA 5JPNA 2H32A 4DQOL 5TPWH 1LO0H 4K2UL 1L9OA 2WM0A 3IFPA 3IJYB 3MNZB 4H25B 3WIHL 3GSNB 5JUEL 1JGLH 5IREA 1QVOB 3GI9L 4PJDB 3H9SB 2BZ7A 2ATPB 2GG1A 5KYXB 2FL5B 1L6PA 1MJJA 4RBPH 3TBVA 3ZDXB 4MQXD 5AOMA 4MQXC 5EOTB 3RVXD 5BJTB 3RVXC 2D31B 4HLEA 3I2CL 2B9AA 4O51B 4ANWA 1UTDA 1P69B 2R29L 4V1DB 2IV9A 1ZSDA 3CFUA 5BZWB 3U36B 4MQSB 2A4ZA 4AYBA 3ROLB 1MI5B 1IL1A 1W0YT 1CLVA 3CCHA 3L2MA 4ODSH 1EAPA 4Z0XB 2ENQA 4PD4J 3NFSH 2PLTA 4OZHB 1A4AA 1P7QA 4WI5A 5LGKA 3BVUA 8PRNA 1H3PH 4PJ9C 1QJ9A 4M8VA 3BUTA 5J12C 2BNQD 1PZ3A 3WENA 1AGFA 3QUGA 3NJHA 1UVQA 3QR0A 1N12A 2ZOKA 3C5XA 2VIRA 5I15L 1E9PA 5L2KE 1TCMA 2J8UE 4KH9A 1P5UA 4F2ME 1RZFH 2OQJA 2OZNA 5KBLA 4AYEC 4QJ4B 1YEEH 3B56A 3TGXA 2O5XH 3E2HB 5I1DB 2R2HA 5CEYB 5L9DL 2FLBT 5CD3B 3PWPB 3D05A 3U7YL 12E8H 1U8PA 2ZP9A 3CFNA 4P3CH 5D7IA 4I4WA 2QQLL 4CADA 4L5FH 4LL1A 5BXFA 4TQPA 5CJ8A 1RK1B 2CDGA 3Q2LA 3HE7B 4B5EA 4JZOA 4N6RB 5AAWA 3P9LB 3AB0C 3QFJB 1MLBA 3EJTA 3K5RA 2BSSA 1WGOA 1PG7L 5A2BA 4W9IC 1KLGB 3F84A 4Z5RA 2Y0KA 2BCKB 4BQ6A 1XT5A 3I6SA 3PHAA 1YEFH 5I16A 3PGCA 4Y5VB 5JQHC 1FP5A 3L4VA 4RLBA 3L9RB 4KO7A 1MQ8A 5F7KC 2IAMA 1LDPH 2W0FB 1WA0X 3ZT5A 5AW2B 1F3RB 3TT1L 3BWZA 3MRDA 3NCFB 1MCQA 4R3SB 3WUZA 1KG0A 1HAUA 2A6DB 2DYRB 4F9PA 1DFBL 5BO1H 2OXHB 2E8YA 2F19L 2V2XB 2VKWA 3C8KA 2QPFA 3DIFB 4P2YA 2R88A 2JMRA 3CQQA 3QQXA 5I1GH 4LSTL 5AYUH 3HLAA 5D7JD 2XZQL 3GRWL 4OW6A 3NSFA 5D7JC 1YPZA 5FYKD 4MKMA 4WU7A 1OSZB 4AQEA 1UKSA 2ZX8A 1AZZC 4I13B 1ZIBA 4X7FC 2FX9L 3SCMD 5IFJA 3SCMC 3RWGA 1J8RA 1I3RA 3B83A 3T3PF 3BQVA 1G1YA 1F90L 1JV2A 3U7WH 4BRVA 1CLZL 1G5GA 5GGTA 5GRUH 5IVXF 3MOAL 4G7SB 4PJBF 3VVVA 4DK3A 3CDFA 5F7DA 5AB1A 1G7LB 2UUDH 2QPEB 5D1QB 1FZMA 3OLIA 5H37G 3HZ3A 3DPBA 4ZFOL 3FHEA 5I1IL 4C4VA 2BVOA 1RZJH 4FXKC 4ZTOH 4NBZB 4P2QE 3ULVE 5EUKA 5FOBB 3CDYA 1NBVH 5K33A 4ENED 1L9QA 1QP1A 3LNDA 5E8EA 1ES0B 3QJVB 4ZX6A 3AITA 1RV6X 1USQA 4Y19E 4TSAH 2JKRM 4RZKA 1G7QA 4GNKB 2PXYB 3FOLB 3BFOA 5ESQA 3VDCA 4ZFGH 1E43A 4OI8A 1H6EA 5LJYH 2GT9A 5KVEE 2XTLA 2QZQA 3NRFA 1CTMA 5IVZB 1IFRA 5AYQA 2X1OA 3BH9A 3BVNA 1SBBA 3QJRB 1HKLL 4HXAL 5IB4B 3SDDA 2DJMA 5CEXA 1TYEB 3SYBA 2X3CA 4P5MA 4UINL 1S7WA 3VD0A 3D06A 1UZ6E 2F6AA 3OJVC 5CINL 1JK9A 3HS0C 2AXJA 4A2EA 2CBMA 1UWEH 1V10A 4KX9A 4DKEH 5TDOB 4RSYA 1ZLVH 1OSMA 5KYWA 1HINL 2XIDA 5EBMA 1P4BL 3GSNL 3O3AA 1QRNB 4NP4H 4N9GB 1K8IA 1ONQB 2WLNA 1ML0A 3QDMB 2NNCA 1MWAH 4LLQB 4HLZG 1R3IH 3O11B 4NQDD 4WWOA 4LCWA 1J11A 1BFOB 1TEFA 1AMYA 1TJHL 1ED3A 4WRLA 2NTSP 1LILA 1PIFA 1SLXA 1VADA 3MR9A 4X6CE 4AL8C 4BRJA 2DJUA 1EHAA 4M93B 2MKWA 3D3VD 3WD5L 4JY5H 4XVTH 2UV3A 2XFXA 2TAAA 4GSDH 4H26B 4HV8A 4JRYE 1S5IH 1U8KB 5JTWA 1ZGLB 1VFOA 1JI1A 2GTWA 3QIBA 4WHDA 5GIRB 1ILUA 3MJ9L 1HEJC 2EIEA 4X4ME 4Q2ZA 1XX9C 1U92A 1DZ0A 4HISA 3LTVA 5LLIC 1UOLA 2N56A 4I77H 1PZBA 1EEYB 1IE4A 4K0OA 4NZUL 4NRYB 5E8NA 2ICEB 5HDBE 3A4EA 3EF7A 4KKLC 1PY4A 4KKLD 3L4ZA 4M7LT 4M61B 4P46B 1L5GB 4ZZFA 1MHPL 3N5AA 4BFGA 3V4PH 2XE5A 5F89A 4DUVA 3WUWB 1D6VH 3B8SA 1LQSR 2FYYA 2CO6B 1M57B 1GYAA 3PRNA 3JWNH 1G7JB 1EERB 3MRQA 3BIBX 1JPGA 3CBKB 3LDBC 1I8KA 1SDYA 4U1GB 3TJPA 1PJWA 3U9UA 5D70L 4KNUA 5BZZA 5E6RB 2H0EA 2EACA 1PD0A 3CUPA 1DP0A 2EDYA 3DX8A 5IVXB 4IS6B 4NZRL 5JW4N 1CMOA 5BRZB 2EYTA 5HYJD 2F54D 2Y7QB 5LGJB 4XRCA 3P4OA 3QUHA 3DOSB 2X1PA 4DO6A 25C8H 2VXUH 1FJ1B 4F7CB 3EO1A 3FF7A 1DJZA 1RZIB 3F7QA 3IETB 3PL6B 4AI7A 1OGAA 4TLKA 5HDQH 2EVFA 2BSED 1NDGB 5E9DA 4AKRB 1HNYA 2WXMA 3U83A 6FABL 2IBGA 5E9NA