2KC0A

Solution structure of the factor h binding protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
242
structure length
242
Chain Sequence
AGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Factor H-binding Protein, a Survival Factor and Protective Antigen of Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords lipoprotein
total genus 43
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2kc0A02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kc0A01
4AYNA 1YS5A 2KC0A 5EE2A 2W80C 4AYMC 4O3XB 4O49A 4Z3TA 4AYDC 3PQSA 3V8UA 3KVDD 3UAQA 4AYEC 4O3YA 3PQUA 2KDYA 4O3ZA 4AYID 4U9CA 5T5FA 4O3WA 3HOLA 3VE1A 2YPVA 2LFUA 4O4UA 4O4XA 2Y7SA 3HOEA 3VE2A 4QQ1A 2W81C
chains in the Genus database with same CATH superfamily
2UV3A 4BZ1L 1M2VA 2PW2A 3TH2T 3TF7C 2D7QA 2VXQA 5IROA 4MJIE 2MOQA 2Y1YA 4ZX6A 1ADQH 3C5JA 1OD7A 4YFLI 1KJMA 3L1FA 2J8OA 1ZLWH 1JI1A 4NNYA 1DSWA 2KQNA 1T0OA 1BMZA 4Q8BA 1ORMA 5EO1B 1KGCE 3V0DA 4BSVA 3LPWA 4PTUA 5EUKA 3W5NA 3GUFA 2G75A 4IBYA 1N18A 3BPOB 5CP7B 3FTSA 2W95A 1OAYL 1MW3A 1TFHA 2XWXA 1F58H 1LK2B 4KPHL 5IB4A 2VLMD 4H8PA 2MNJB 3S3SA 3B2UC 2D8KA 3EO0B 4XO8A 4QRRB 1KEGH 3GM0A 5KOVC 2C7UA 3HLAA 4PVLA 2COQA 3MODH 3TESA 1SLXA 2R2CA 3SDCC 3JT0A 3SZKC 4PJBB 1KZQA 4IMKC 4IRSA 4YN3A 4O9HL 1H9VA 4CUCA 3VTTA 4MAUL 4OIBA 3PFQA 4FI7A 3KHQA 4HJEA 4MJ6B 5DRXA 2VMEA 2A77L 5ISZE 4PRHA 1ZANL 1BZQK 3CDZB 2YD9A 2QTEA 1X7SA 3D4GA 3FTUA 3WEXA 5I17B 3C5SA 3NCJH 4QXGL 4WWNA 5F21B 4FESA 1PQZA 4OM1L 4GXUN 5FAAA 2BY1A 2CIIA 3LRHA 3CFIC 3CZSA 3EZJB 5F1IA 4AW4A 1RIVH 3QZMA 5I19L 1D3CA 1OGPA 3CDFA 4TOYH 4MRCA 5DZ9A 2PN5A 4OCYH 5CCKH 2YN3A 4KXCA 5DUPL 3IJEB 2CMRH 4FFYH 5HHPB 4ETQB 2NNAA 4M9OA 2H1LM 4UT9H 4AEIH 1DR9A 1ZLUH 3MJ9A 2EJ1A 3MJ9L 1IKNC 3EHBB 1AACA 2CHZA 3U2JA 4QRQA 2BH0A 1P9MC 3RDTC 3TJEH 4PMFA 4BH8A 4Y7OC 3W9EA 1NINA 4MNQB 2H6PB 5IMOB 4FJYA 3CFNA 4D9RD 2M8XA 2ORBH 1BF2A 3TCTA 5A3IC 4LSTH 4Y4HC 4GXVH 4AWJC 1IFGA 1S7QA 1AO7A 2XETA 3LKQB 1I1YA 1F4YL 2M1KA 3QFDB 2WLKA 1NMBH 2LFEA 5AVRB 1Z5HA 1HNYA 5D2NA 2GQHA 4GW5A 3VWKA 5E5UB 4AG4H 1I3UA 3S5LA 1VKXA 1SDDB 1X5LA 1X6LA 3ZDXB 3IRZA 3DV4A 3IE4A 1X5MA 1PS3A 3D33A 3K2MC 2OI9C 3D2TA 3BJLA 2NQDA 2H2SD 5DJCB 2UXFA 1T21A 3L16A 1BIIA 5EU7C 4U31A 2E7LC 2F54B 4KFMA 4UTAL 1WZMA 2WLMA 5F72S 1IBZA 3F12B 4DGVL 1PLBA 3GGWA 5H8DA 1FL5B 1M6OB 2E75C 3QRBA 1NFAA 1OY3B 4AT6B 5HYQB 4PQXA 4HEMA 3WI5A 2WBKA 5I9QC 5CIPH 3BUBA 5C08A 3DUUA 3QQ9C 4EUPA 3FDWA 4NQSA 2HKFH 5DI8B 1AXTH 4KJWD 3LZRA 1DJHA 3VXPB 2Y07H 4AYDC 1VZHA 5EU4A 4I0KA 2B7DT 2Y0LA 1ECZA 3V8UA 2WXFA 4YFDB 4BBWA 1E42A 1MIMH 4GQPH 4A7UA 5CD5C 3CC1A 1L9SA 2PO6C 1A22B 1U8KA 3UX9B 3GB7A 3WNNA 4BWTA 2OZ4H 2WXMA 5F7DA 1VZGA 1PY9A 1V7MH 2PR9A 4PS7A 5DHYA 5IK3B 3NFSH 1ET8A 4KTEH 2Y9RT 4OZ4B 4CL7A 3OVUB 1USQA 1UCTA 3CHRA 3KW7A 1PFCA 3V5DB 1E43A 5E0QA 2H2PC 3V4UL 1HDMA 4U6VH 1YEHL 4HIIA 4OV5B 1H0DA 2K7QA 1N5YL 2OW6A 3D39D 4JO4H 4WUUE 5IFAH 2X28A 4HIHA 3ESVF 4YWGL 1F1DA 1PQZB 1WFTA 4F91B 4XNKA 2GW5A 3VFRA 4W9CC 1WLHA 5F1IB 5C6WH 3WIHL 4AJYV 2AQRA 1CE6A 1E9QA 2Y6SD 5FGBA 1E4WL 4QRSB 4NQDA 4QD2E 1THAA 5PRNA 1KPVB 2ICCA 3Q3GB 2NNAB 4J4PC 3HI5H 1HQRB 1TJHH 1IQWH 1K4DA 2FGQX 5EUOB 4F27A 4GUOA 4X6DA 2C1PB 1B0RB 4NNPH 3VD7A 4FFVC 3GMRB 3OPZH 3CFMA 1UYWH 4ZI8A 5DJYB 1YLBB 1P84K 3TCLB 1QW8A 3T2NL 4W6XB 5IBLC 2VMJA 4TNEA 5CJ5A 1UH2A 3VFTA 5GS1A 1VFBB 1BVLB 3MXWL 4LASL 1JV5A 3WN5B 4QDGA 5AW5B 3AA1B 1QJPA 4NKIH 2F53E 5H2BB 3ZZLA 5J06A 4MA7H 1PMYA 4WNJA 3QNZA 2BP3A 1HWHB 2HYMA 4GW5B 3PGDB 4ZX5A 5KSBB 4JCHA 5TQ2L 3M07A 4HJSA 1CXLA 4J8RB 3EADA 3FPXA 3QGVA 5CS7A 4LLAA 2P47B 2X10A 5D7SL 1QBBA 4AI7A 5AAWA 1I53A 3V0VB 3KLHC 2EUXA 1F00I 5TDPB 4GB9A 4Z7WE 1OAQH 2OYMA 4DP4X 1UTDA 2CALA 2GUOA 4N58A 1PF3A 3EXJA 1W2KT 1ECYA 2X1PA 4JDEB 3H9SB 2RGSA 2V3FA 4UB6O 2CXGA 4IS6A 3BE1H 3UAQA 1D5IL 4X6DE 5H37A 3T0XA 2OBGA 4AT6A 1EAOA 4P23C 4WFHE 3GBLA 4G70B 2R8SL 2J6EL 2QZQA 2YD8A 4IOIB 4PJXB 4GW4A 1UH3A 4PB0H 4YQXL 4L29B 5FK9B 1BD2A 1SVBA 1U8MA 1ZT1B 2K70A 1LO0H 3FSOA 4FLQA 5E56A 1DE4A 3LKRA 4A39A 1UACL 2VW7A 5C09E 4P2RE 4KVPA 4M4PA 5I6NA 5F0LB 1CT8B 1M7UA 2BRRH 2E0PA 3MPCA 3DARA 1MUJB 3O8XD 1BGXH 1TQVA 3MRGB 3QIUB 4EE2A 1QI3A 2MCPH 4PJ9D 3RZCA 4DUVA 2X9YA 4LPYA 2VDQL 2YBGA 2X2JA 2QQLL 2EH8L 4AENB 3JCUO 2RD0A 1EDHA 2IXQA 2RACA 4CVXB 5IQLA 3ESUF 5FUOH 2N1TE 2FYYB 3L5XH 3T8VA 3II2A 5DMGD 2GJ6E 3SKNA 4GRLD 1OW0C 1Q0XH 2YKKA 2B1HL 4W9DC 1HYSD 1NAMA 4O02H 3LB6D 5LAXA 1NCCH 3VFSB 1L0XA 1HSAB 1N0XL 1W6WA 3FB5B 4OZFB 3WO3B 3DSNB 5JQIB 1W72B 4PW4A 3VFNA 3KR3H 3CC5B 1E9QB 3ZHNA 2ENJA 1NBYA 4URKA 2OMWB 3JZ7A 5I24A 2FDBP 4XBGB 2J8HA 3HJ0A 3CQPA 3MLYL 5BOPA 4TVSa 4WO4B 4GAJL 5SWZB 5IFHL 2WKGA 5F7EL 3MRMA 5T1KB 3UIZA 4A7VA 5GGVH 3ZLQC 5JPMA 1OCCB 3ZDYF 4Y4KA 5I1KH 2WLYA 1HJCA 2CBTA 3IJYA 2AXHA 4BXSV 4ENZA 4U6VL 5K59E 4AKPA 3V8CA 4TM9A 3ECWA 5IEHB 2AJUH 4WK4B 1MZYA 2A6DA 4G5ZL 4OGZA 5F1NA 5D9SB 5KAQG 5CN1A 1UC6A 5I73C 3KLSA 1Z5LA 1FGVL 2VN7A 3S88L 3WN5A 3BUTA 2CAKA 1KBBA 1C12A 2X70B 3UPCA 4OLZL 2LE9A 3GO1L 3V0HA 3VXRD 2EDNA 5FO9A 5IVXB 2AABL 1JHKH 1LEKB 1WUZA 1BXVA 4LGRB 4KRPB 3QZPA 4KXBA 4YDLC 1I1AB 2A38A 4WKZB 4JFFA 4JJ5A 4RRPM 4QY8A 1J88A 1T2QL 3CLFH 3TT1L 1MFBL 3HG4A 1CDGA 1NCGA 1AIFB 3HRPA 4NLHA 3T3MB 1BEXA 2R1XB 1B4TA 4UBDC 4TRPL 4RFEA 4QOKD 1PG7L 3RFZC 3EG9A 3FH7A 2PTVA 5KYUB 4F24A 1UM4H 5LXGL 2IOIA 4B0MM 1IM3B 1O9ZA 4PJXF 1RZJC 1AGEA 3R06B 5IB1A 1BLNA 4PRIB 4M1CD 1OGAE 5CSZB 4FTVA 4JUSA 4WHCA 5D8JH 4YLQT 5DJ8A 1WRFA 1OWRM 1NFDE 5DL5A 5TQ2H 1U8MB 5AAMA 4J2XA 4N2BA 1QFHA 4G3YH 3ULSA 2A5UA 4KVNL 5I18H 2IAAC 2PYEA 1AKJA 1VZIA 4ZXBD 1I9IH 5FHBL 2X4TB 3QXTA 1MLCB 4H5SA 2DOCA 1E3ZA 1BXXA 4KK5D 1M05B 2VIRB 2J12B 4R0LA 4JZOA 4WVRA 5JW4M 1VGKA 3F58H 4WAFA 4RJXA 4G9FB 5L2JB 3VZTX 2JTDA 4I18B 4NZJA 5LNGA 1P5VB 4A2FA 5DRWB 3S48A 3I02A 1YAIA 1FL5A 2I24N 1M6OA 3L9EA 5GIRB 4K3BA 1UXWA 5C0BD 5HYQA 4ZW5A 4UTBL 1QBML 3KD4A 3MXVH 1I1AD 5ITBH 4E9TA 4YO0A 2DRUA 3PFUA 2Y1ZA 3T6XA 3PGUA 1ZKAA 2K45A 3ZDZF 1C1EH 2WBJD 2O1AA 1EV2E 4HPHA 1SN5A 3BKML 1AHMA 1OGAA 4UYQA 3W11C 5JA8B 3QISA 1SN0A 1TTCA 1JZ6A 1ET5A 3CSYB 1NGPH 2BIHA 3VFNB 2B5IC 1M57B 1MFEH 1HWGB 1U8KB 3PWUB 3DVGB 2K6YA 4UQBA 1OANA 1BOGB 1I9RH 3D2UD 4TQEH 1BDYA 5TF0A 2R4RH 1V3KA 3IMUA 5CU5A 3CZJA 3PL6A 4O2CB 4GSRA 1AR1B 3GUTB 2YSSB 4MD0B 1XIWA 3BC9A 5FW6A 4B5ZA 1FP5A 2FJFB 5KBLA 1OAUL 4ZMAT 2YRLA 5CJQL 1HDMB 4QQ1A 2WY3B 3WKPA 2OL3H 4IMKA 4C54A 2CKBA 3LHPL 2XPGA 4AEHH 5EZOL 3VNZA 5IMLB 4OV5A 3GXPA 5D9SA 4AYMC 1S7TB 1FO0B 3P0YL 4N2DA 1W91A 1ZOXA 2DDQH 3GZQA 4JPKL 2VR7A 2R83A 4H44C 5I26A 5C0RH 3IKCA 1HHIB 2PCYA 1L7TH 2AXGA 5FFLA 3MLTA 3QUZB 2KMWA 2Q3AA 4U0QB 1GXEA 1IC4H 4XPHH 3UBXG 2A3TA 5KZCD 2NPLX 3P40A 2DQEH 4TUKL 2D2CC 3TZVA 2WIIB 3GRWA 2ICEB 3WCYA 5JQ6L 4BCYA 1I8KA 4X4XB 3F58L 5DZNA 3RU8L 4M5YH 5SX4H 4EIUA 1SYSA 4UM9D 3N1FC 5D1XE 4O49A 3AMKA 1U4EA 2YAQA 5CMAB 3FTVA 3OKEB 4P23D 1AGFB 3M1OA 4XI5D 1WAEA 5AUMA 4JKLA 1FDLL 1KC5L 1INDL 1A9VA 5C8JA 4WK2B 1A4JA 1OZTG 2OULB 3FT4B 4MCNA 3ESMA 3MNWA 5IB1B 1N2RB 5HHOE 3WNMA 5DURB 4P23A 4RFOL 4MMYA 4YK4C 3AXHA 3ZOAA 1OTUC 3P02A 3G9AB 2JJUA 2NTFB 4WV1A 4PHZA 2PW1B 4YHML 1OOWA 1GIGH 1TSRA 1QWUA 2ZOTA 3ARFC 4WIQA 4F9LA 2PYEB 2P8LA 5DUJA 4BH7A 2Y6SC 4YUEL 4HKXB 2O61A 4WI3A 2YOAA 3NJFA 5AVQB 4P57B 4GRMA 2OXGA 2FUQA 4Z7UF 3VQ1C 1YC7A 2H32H 3BIBX 2NW3B 1JRHI 1NCAH 4FQLH 4N68A 4TNWK 1MPAH 3JWNE 4G9FA 2H41A 4XAWL 5CJQH 2Q76A 5AZ2H 5B21A 2OYPA 5TE7H 5L2JA 3Q0HA 4K0OA 1HS6A 3EH1A 3H9SA 1TQSA 2PR4L 4HFUH 3AWGA 3OXRB 3L17A 5GIRA 1RUPL 4W4NA 2VUKA 3A6CL 2FSDA 3NSCA 2J5WA 3SDYH 3RUGE 3GO1H 3QDGA 3O9WB 4QRBA 4YO0B 3IRPX 3GMLA 1AZUA 2YA0A 4JCWA 2BIOA 4L1SA 4DVBB 3DO3A 4JMNA 3VG9C 1KBGL 2F5BL 1V8HA 1NAKL 2Y7LA 3EBHA 5F6IC 5KG9A 2V37A 1IUZA 4HLEA 4S1SL 5HYSB 3AAZB 2Y7OA 4L4VA 4NZDA 4L9LB 4ANVA 4ACTA 3ZE2E 3GPSA 4FG4A 3DX6B 3FUMA 3LQAL 3NRPA 4K8RH 3RU8H 3WFCL 3WEOA 5DEGA 5MEPB 3O6FC 4JJHA 1MIML 1GH7A 5CLZA 4APXA 4OLYH 4QF1B 4PR7A 4G7SB 4M48H 4UILH 1HXYA 2ZT9C 2WOYA 4ZW8A 2WYIA 1MRDL 1AE6H 1QBLH 4EI5A 1MAJA 5HI4D 3E38A 2A4ZA 3KPQB 3UTTE 1NANH 1YY8B 4MMZA 1F6FB 2FYYA 3HVNA 4HIPA 4R2GC 3V4VA 4JRWA 4BSJA 4EKXA 4ENEC 2CKBB 3TV3H 1J87A 1MWAA 4ZUUA 2BZDA 3EFDH 3F5WA 4GMTH 4DO6A 1FO0A 2N01B 4PJ5A 1AI1L 3N41B 4HSCX 3SKOB 4F37F 3KGRA 5F9JB 3PNWB 4Q4IA 4ZMZA 1H8OA 4B6ZA 1TXKA 4WW2C 1UXSA 3VFSA 4OD3H 3HUJB 3IDXH 5TDNA 2VISA 2XA3A 4YEEA 2XWBB 3QSKB 3QT2A 4JQXC 5I30H 3VU1A 4I2XB 1F02I 3QUYC 5DHVA 1NBYB 1IGCH 3CBKB 2JE8A 3JYCA 4YH6A 2V9UA 1IEBA 5CNHA 1A4CA 5TDOB 5FF6A 2XXFA 4DP1X 4XGZB 4HQQH 5TE7L 2ZTBA 4Y4KB 4AKMA 4UIMB 1GA2A 1AMXA 4H8WC 2YWZA 5IB3B 1LD9B 1PG7X 1D5RA 2E47A 2I9LA 3LN5A 1PKOA 3FFDB 3O81A 2HWZL 2CR0A 4MX7B 1FL3A 5A2CA 2K3TA 1SHXA 3RWHB 1BYOA 4J39A 1J7VR 3OAZH 1G9HA 3BKCL 2A0LD 2CGYA 2WNGA 3ECBB 3FYEB 4MZ2A 4Q6IC 5SV3A 1A3QA 5D7JA 3U2SA 4ODXA 2EDFA 4KMLB 4KXDA 4WHYG 4KFZC 4Y5YB 5EPMA 3VGHA 2G60L 5DWUH 3HC0A 1D6EB 3X14B 4LVNB 4AQAB 4FQQA 1N68A 1P1ZA 2I07A 4UOW1 3WSQL 5JYMA 2CM6A 3DMMC 2EE3A 3RVWC 3BIKA 5JHDE 4J5VA 2EZ0C 5FYJL 3UAJC 5AW9B 2EUWA 4G7VH 4QY8B 2IPKB 2QSCH 3FBKA 3QUKB 4Y2DB 5GGRA 1WCBB 4ZFZB 1T7XA 3HG1B 2PXYA 3WJLA 2XN9D 3Q1SL 3ZE0E 4CC0A 1RL1A 2OJEB 4WW1B 3SO5A 1VERA 5JW5B 1NBCA 3SZVA 3G04A 4K2UH 4RX4A 2GSMB 5CCJA 3MXWH 1ZIAA 3KZ8A 1M71A 4RIRB 4X7SH 2XBTA 4OZHB 1IM3A 3VTAA 3U25A 4NB7A 3TBCA 3ZSSA 2F53A 4CJ1A 1B4JH 1UFGA 3GXIA 5C70A 5E08H 2VSCA 3O9WA 5EV7A 2BY3A 2FEDC 4IGBA 4LLYA 5F8QC 4BK4A 2O5ZH 2QVIA 4O58H 4AGOA 3Q5OA 2A9AA 3BVVA 3ULVH 1L7TL 4HGMA 2N2LA 4TQIA 2DS4A 3HI5L 2D73A 1RJYB 3NIGE 3TEZA 1CI5A 3PXJA 3UTPE 2EKSB 1EHLL 2X4TA 4F9PC 1B88A 3P30L 3QDJB 4RMUA 3SE4A 1SHMA 4AEHL 1M05A 2VIRA 1BQLH 3AY4C 3X1BA 5LDUA 5IJVB 1U8QB 4AGQA 2AJVL 4IU3B 4JQIL 2IGLA 3K19A 4ZOEA 5DS1A 4PBVC 3S9DB 5FYLE 1PIFA 3DBXB 3TFKD 4OLXL 1YMHA 4OGAC 4M1CC 4PSRA 2Z8SA 3P2BA 1QUNA 4YWGH 2Z1PA 4DSYA 1MFAH 3GMPA 1S5HB 3IFLH 2WWOA 2DMBA 1A7RH 4R4NC 4LLWA 2XE3A 3C8KB 4C69X 1RU9H 4KZ0A 5D1ZI 4BQ8A 2LABA 1F6AA 4KH9A 3WLWC 1HXTA 4XPGL 2NNXA 5GRWA 2EC9U 2PF6A 2OYLA 4F9PA 2OW7A 1NAKH 1OV8A 2X3CA 1Z9OA 5ERWA 2HMID 3MCYA 4JY6A 4LCYB 3ZL4H 4XMTA 5C7XH 2LU7A 1SLWA 4F1ZA 3LQZA 3PABB 4IRSC 2R2BB 1YYCA 4DZ8A 1AZBA 3LIZA 3UZEA 1H15A 1KIUA 2PP9A 4XC1L 1OP5K 3NCYP 3P11L 2DQHH 1OM3H 4X5RA 5KYXB 4XN4A 1X7QB 1KCWA 3OD3A 3SY0A 4E9SA 3W57A 4MD0A 2Y23A 3D0AA 1NLDL 4H7VA 3I85A 5K9JH 1P4IL 4X9IA 5IHZB 3I6LE 4P99A 3WAKA 4PJAF 4Z78B 4XT1C 4LP5A 3REVB 1QFWL 2JH2A 4XVOA 3LTVA 1MI5A 2D3JA 4U9CA 1OP4A 5ESAB 2EINB 5KVDE 1PEZA 4OIIH 4Z7WF 4N90E 3L4CA 1NANI 4MX7A 1FL3B 1RQ5A 3FOLB 2Z91B 3WY4A 3BIAX 4HUKB 5D96C 4JY5H 3FU3A 4XPFH 2GJRA 4JHVA 4H0GA 3EBAA 5CGYD 5AOIA 2HKHL 2N7BA 4I3SH 4JRYB 1XH0A 2Z92B 3MLTB 2AQTA 3UERA 1FYTB 2XVBA 1O7DC 2EABA 3HS8A 4ELMB 5EIQA 5C0IB 3VI3A 4LSFA 4RZCB 3GSVB 3NSYA 2ZOUA 3SGDI 5FGSA 3OSKA 2VSKB 1QPPA 5K9QG 5E6UB 3GMNA 1CYWA 5C0AA 1G43A 1KCUH 2NY7H 4GP4B 4OD1H 3FN9A 4XXDB 3SODB 1EJ6A 3TP4A 5A2JH 1OTSD 1HJBC 1T89A 4FADA 1BFVL 2QSVA 3HG1A 4WI4A 5AG9A 2A74B 2DQUH 4X42A 3IN2A 1QZNA 1KNOB 3OPZL 1MFBH 3F7RA 3PGFH 4ABWA 2IANB 1A4JB 2AXTO 1KJVB 1ASPA 2DQCH 4GAGL 8FABA 3IETA 5JOEA 1JV2A 1KGUA 5C07E 3T3PB 5FA3B 2LQRA 2XTQA 3B2XA 4Z23A 3H3KA 1JHKL 1KJ2A 2JNZA 5E8OB 3GJFB 3VFOB 4CILA 1KOAA 4HWZB 3SE9L 4N2GA 3NTCH 1KXHA 3MV8A 3WIFB 5JOPD 4XO5A 3ARFB 2FYVA 2G4EA 2DZEA 2ED6A 3WEBA 3PJSB 3L4XA 4PJ8D 3VU2A 4NM8L 1T1XB 3HLAB 3C60D 3MNZB 2GTQA 2DYPD 4J3SA 4P9HL 5LCVH 4NI3A 1KCKA 4J8QA 4NQDD 1F56A 4OZHF 4FQHA 3QVAA 4L8BB 1DJWA 1NMAL 1ZA3B 1KV3A 1XF3A 5FYLH 3GRGA 1SNRA 1YMHB 2ZUYA 2C34A 3BVNA 1AJ7H 1YPZA 3RNKB 4POYA 1LM8V 4OM1H 1GYUA 2D7PA 4UT7H 2VE6A 4AM0Q 2EDTA 5I17A 1C9SA 1NBZB 5DO2D 1F18A 3CIQA 2NXZB 4PGBB 1BG1A 1OCWL 5D1QB 3IPFA 3DDGA 4GKOA 2ADJB 4N2CA 3B1TA 1JPTH 1VDGA 4HEPG 4IRSB 1TZGH 4F7KA 5FFOA 1SJMA 3BUYA 4LESA 3S5LG 1ZY9A 1SEQH 2ZX9A 4LLUB 2NYKA 3QUXD 4MJ6A 3D3VD 3IAQA 2JJTC 1NA8A 3IJEA 1D7CA 4JO3L 2DLFL 4IBVA 1WIUA 5CUSL 2F7QA 2O5YH 3KYNA 2PPDA 5D70L 5KVGL 2ZG3A 3LJ3A 3GINA 2F8IA 1X5JA 2XYCA 4X83A 5E6RB 3D9AH 4NENB 4APXB 1A7NL 4G76A 4MNQA 2ZG2A 5GZOA 2OMYA 4Q0XL 5IW1B 5F3HA 3V0GA 3TA4D 3US1A 1HKLH 4OLVH 5D6DA 2O6FA 4AIXA 3HBPA 5IQ9A 4OAWB 1UUSA 1MXGA 1A7OL 3SGJC 4ZAKC 1DEDA 5KSAD 2V5SA 4CMHC 3M8OL 4BH8B 4KJQC 5DT1L 5HHVL 4G1EA 4UT7L 3STLB 1BD2E 1F4WH 1HAWA 2GJZA 2ZKWA 2PORA 2P44B 4HC1H 2H1PH 2Z92A 5MENA 5F71A 1XR9B 5E7FA 1JGDA 2EACA 2DD8H 3FSZA 4JFXA 4U6YB 3EZ8A 2V33A 3VQLA 1E4HA 4V2BA 3B7UX 5IQ7H 3BP4A 3LS5L 2R56H 1NIFA 1AOHA 4JFWA 1AKPA 3VWKB 3HG3A 4LCCC 3NJIA 4GSUA 1NCUA 4JN1L 4XXDA 1G7HB 3WG7B 3BLBA 4Y1AA 5T1JA 7FABH 2EH7L 3H85A 4K5PA 5KSAB 1H8NA 2N4IA 1U4FA 1DSFL 2SEBB 4UQCA 5FW8A 2VCOA 1MRCL 3DGGB 5DLMH 2ZG1A 2IANA 5DI8A 2B1AH 3QRFM 2ZSWA 4KRAA 5EU4B 5FA3A 2OM5A 1XCTB 2RFXA 1P84J 1KPUA 4XO3A 5C7ZA 1KJ2L 1SBSH 3FSVA 2Y72A 1C7TA 4HWZA 2YD3A 2BERA 1XGPA 1CGYA 1WGOA 4ZDHA 1DSYA 3KPTA 1FFOA 4XP6H 1CE1H 4TNVK 5IK3A 1IB5A 2B3IA 1A7RL 2DKMA 5KVFH 3N40P 3QAZC 5GS0L 4KTDH 2IPKA 3V0JA 2P7TA 1M9SA 4GCPA 4G8GA 4N1CA 2AEIT 3A2SX 1EMTL 3FTGA 3K4ZA 4FFTA 4L8SC 5CEZE 3QJUB 1MRFH 1HEHC 2FBRA 3QQXA 5E6IC 3RVUC 4NWTL 3WJJC 2EXWD 3NYKA 1KENL 1RZKL 3FONA 2NY5L 3GB7B 1PZ2A 3H42L 2BP0B 1WBXB 4RIRA 4O2EA 5E1QA 3TEXA 2UY7B 4ZUVA 1EHLH 1EVUA 3DLQR 3BGFB 4WHYH 2CUIA 4XNLA 5H94A 4LLYB 3EKCA 3WGVB 1NICA 1HI6B 4K73A 5E5RB 1UM5H 1A14H 4M6OL 1GYAA 3WFDH 3HFML 4NQDB 2D3VA 3O2WH 1NLDH 4MQXD 1CFTB 1FNLA 2D03L 1S9VA 3ATBA 2DYPB 4NRYB 5K9JL 1IEHA 3KZIO 5FYKU 1J5CA 4YHIA 2F6AA 2HRPH 3NABL 5HYFA 5DFVC 2EIJB 2VTFA 4JEGB 4N8CL 1DBBH 3MCKB 5CJBA 2QFRA 3MJ9H 1BG9A 5HHXH 1E7UA 2BS8A 3L4YA 2IDTA 2K8QA 4NENA 4OQ1A 4RDQG 1CE6B 2VXUH 3Q8AA 5F96L 5HHME 2QQLH 2OMYB 4NO2A 3CDZA 1ADQL 2A4EA 2I60L 3DYOA 5JHAA 1CXKA 1BXUA 4JANB 1AHKA 1CLVA 1RFDL 5CCKL 2CKBL 5BVPL 5AVTB 3Q3GA 2PMZA 1K72A 1NIAA 1JV5B 2WQAA 1YEIL 4HCRH 3ZTDC 3QI9A 4LLWB 2CIIB 2APFA 2O4EA 4G6JL 4I0PB 4W9LC 5CJOH 1J5OL 2OMTA 4L3CA 2XYBA 4Q89A 2QL1A 1J9QA 4X6DB 2C1PA 3HMXH 2MNWA 4F7TB 4NUJA 2ENPA 4FXGA 1U8PB 1MHPH 2VO8A 2H2SC 2QTVA 3HG0A 3PGDA 4G1EB 3STLA 4I3RL 3V10A 2F54D 2XQ0A 3FS9A 5AAMC 4HXBH 1TTAA 3SPVA 3TH4T 5T3XH 5IT2H 3W2DH 2ZCKH 1XR9A 4B7IA 2WQSA 5H2BA 2XICA 3MLUL 3Q7JA 3QRCA 2JI3A 1F4XL 2VZ3A 3QNZB 3CZUB 1AJ7L 2C3GA 1OD9A 3F7QA 3P2TA 4JRYD 4XAKE 5BV7C 1X7QA 3IU4H 4FA8A 4WU7B 5I1GH 4KZEH 2CDEA 3US9A 3NSJA 4JPWL 3GP6A 1NGQL 5JR1L 2MKWA 3VQMA 1SJEA 3H4FA 3OTTA 1NUNB 3UTPD 2FGWL 4WW2B 4RQQA 3RI5F 4DT2A 1KTJA 2O6CA 4UQ9A 4WFGD 1J1PL 1VLXA 3RUGB 4M1DL 4LPCA 5T1MB 2HMIC 2BNRE 2O6EA 1N5AA 2ARWA 4UQ2A 1V7ML 5LO7A 4Z7VB 4YSCA 4LSSH 2Y1VA 2E74C 2OQJB 4TS6A 5DQDL 3NA9H 4RGNB 2DLTA 1GGTA 3QIUC 4DFIA 2DH2A 2R0LH 3LZPA 3PHSA 4ONOA 1WBYA 1ZD6A 3LH9A 3EHBD 4X9HA 1SHWA 5DHDA 3MRGA 4I7ZC 4FTDA 1KGCD 5CIPB 4LCIH 4PJ8B 4AYNA 2YXWA 5FHAL 4GKZA 3S96A 5GS3A 4P48A 3EGSB 4P46A 2NT0A 1DBJL 2W65B 3MV7B 2JFCA 3EJCA 4NQEA 1PCSA 2JJVA 4ZJ9A 1QBLL 2BVPB 4ZRGA 1QRNE 2FD6L 2O5XH 1WAAE 1IJ9A 4L37A 4XCYB 4OVUA 3FPYA 1CT8A 2GBTA 1MSPA 2DM2A 1QX1A 5HI4C 3MNDA 3RWGA 5ILTL 3V0EA 3FRUA 4I85A 1TETH 1MJ8H 4LLDB 5MEQB 4EN3C 3BO8B 2OX5A 3IETB 4JGMA 2HFFA 1N59A 1FN4B 1TZ8A 4WGWB 2IXQB 1NMCB 1JZJA 5IHBA 1D5MA 1OAJA 1RU9L 4S1RL 5DGQA 3L9RB 5DHYB 2EYTA 5AOKA 1E9OB 2QV4A 1JXKA 5I1JL 3MV9A 5EB9A 1NAMB 1MCEA 3T4AA 4TQPA 4B9KC 5JPMB 5L8LB 2WXLA 5F9OH 4P5SA 1V3JA 4J12A 1B3IA 1A66A 1HSAA 4OZFA 3IJYB 2C4FT 1QNZL 3CN1A 1RMFL 3GKWH 1KZYA 1ZA3A 1QPXA 1T20A 5TISO 3BVNB 3P30H 2OMWA 2WLHA 3DZMA 3T6ZA 4XC1H 2OMNA 1X5YA 3T0DA 2IANE 4D5UA 4J23A 2VLRD 4NWUL 2L8AA 1XX9C 4PCSA 5HDWA 1T03L 3WJMB 5JZ7C 5C07B 4I0PA 2IALB 2IH8A 4DKFL 3ULVL 4E36A 1QLRB 3VSUA 4N2LA 4D3CH 3IVKB 1FAIH 1WAPA 3O2VH 4FXGB 2BIQA 3OB0K 3ULAB 4F58H 4GS7B 1KXQE 5E79O 5CINH 5GGQH 3QA3A 1OK0A 2R0WH 3F62A 2PO6D 2XOTA 1BFOB 4FFWD 2IH3B 2BCMA 3NACH 3VWJA 2IC2A 5DLLA 1CFVH 5C07D 3HAEG 3KYNB 1QYGH 3ML8A 3OLGA 2VLRB 5ALBH 2HT3D 5J9PB 2AKRB 3DVFA 3QCTH 4X0KA 2R1XA 1SF5A 1JI2A 1YJDC 3N91A 4J3OH 2GSIB 5LKNA 1IAMA 1NAML 2ZXWB 4BEIA 1KTDA 5HTSA 4YXKL 2MWCA 3DX3A 2TRHA 4QOKE 2XVKA 1AG0A 4OGYH 4PJHE 4OZGE 1I1AA 1KV7A 1HT6A 4XCFH 4AM0A 2XWTA 1MFMA 4F1SA 1V7NH 2EDWA 2R29A 5C0CE 3ABGA 1Q9WB 5DO2C 1PD6A 4AQ1B 1BM3L 4YBQC 5F1OB 3P3TA 4CMMB 4V1DE 1BF8A 1VPOH 3F64A 4L48A 1TNNA 3EYFB 4NPYA 1OGSA 1I1AC 2IH1A 2WO3B 3EOTH 5E7BA 1DCLA 1LO4H 2C3XA 1PX3A 1BVZA 2IPTL 1SXBA 1AGEB 2A7BA 1OAZH 3BPLC 1BQKA 4WTZG 2QVFB 5CSZA 1WZKA 5CIPA 1RK1A 1S7UA 3POCA 4MVBD 5JPNC 1A1NA 2VM3A 1Z1WA 5F7HA 5TDPA 1KXQA 5D71L 3D0VA 4V11A 1EGJA 1L4IA 1UJTA 3HMWH 4XHJC 1LO4L 4DGUA 1FRGL 4YSSA 3K81A 1G7HA 1KYUA 3L1EA 2ZYSA 4OGAD 4XNXL 4L23A 4L37B 1OTTC 2NY2D 2OI9B 5KSAA 4AE0A 3MV7D 5AZUA 1KUMA 4HCRL 4FNLL 2EDYA 3V6ZA 3ZSTA 5J6GB 3QWOA 3VD0A 2ZSWB 3DECA 4QOKA 1IGJA 2GVYA 3VACA 4YZWA 3TZVC 1NGZB 2BOCA 4I18A 1FDLH 1NCWH 1KGIA 1XH3A 4U1NA 4EIGB 1KB9J 4O02A 4XE5B 5EEYA 4TSCL 2IV9A 5D7IE 4HMCA 2BSTB 4K4KA 5I8KL 1YEDB 2OMUA 2XXGA 4Y4HB 4X4YB 5JW4R 3ARBD 2HWZH 1DYZA 1N8ZA 1CBJA 1RHHA 3PNRB 1ICTA 3MLYH 5DD5L 32C2A 3TO4B 3ILEA 4L4TA 1UT9A 4D8PA 4AENA 5HYEA 4LOUD 2WD0A 2WC7A 1UWXH 4CVXA 2GHZA 3MBED 4N2FA 2QJDA 1HHGB 5T1DH 1JGUL 4FKEA 2CIKA 5IHHA 2WKLA 1KLFB 1TMCB 5KVEH 1XBDA 1OTUD 5AVSB 5AVXB 3ABMB 3L1OH 6PCYA 3FB5A 4P5RA 2AXGB 2GE4A 1KFAL 4Y4KD 5FWQA 3EYQC 4UYPA 1NCBL 1P5UB 4ADGA 1DBAL 3W0WD 3LEYH 4GIAA 2ZD0A 4JFOB 3SBWA 4H0LC 3FYIB 1MFCL 5DYOA 3U7WH 1ND0A 3ZE0F 3JZYA 2AJXH 3ARRA 1JXFA 1CYXA 1GR7A 1W72L 3SY6A 3E0GA 3MCKA 4HZLA 3R4DA 3A67H 3HEIB 5BCAA 4X0KB 1DJIA 3TZGA 1QLEH 2GBUA 4B7LA 3NJNA 4M48L 4UILL 2FECI 3OKEA 4ODBD 4ZOAA 3EBIA 4KAQH 4NGHH 2APSA 3RY6A 4LGSB 1H3PL 4XVUC 5AW8B 3RVUD 3ZPDA 1GFNA 2ZX6A 1ZEAH 1MJ8L 2WBWB 3FTZA 4XMLH 5HDBF 3S37X 2J6EH 4HUUA 4OCNC 4R0LC 4KROB 2YRBA 4ZXBC 4FQXA 1D5ZA 4RLCA 4DGIH 3J8F7 1F86A 2Y0HA 1YG9A 1E27B 4OGXH 2NY4D 4KKQA 4PJ5E 3U1PA 1S3KH 4IRZA 1WG3A 4B9CA 1A02N 3CFUA 3DTXB 3KXFD 1T3FB 1LMKA 1TEFA 1XZ0B 2DTML 3ZQ9A 2CK0H 2W9DL 1E8ZA 4F37K 1A6AB 4AKRB 3HE6C 1Y7VA 1N70A 1FRGH 2JELL 3CDCA 5PCYA 3ZQWA 5E2TL 1G7MA 1BEYL 5FYKD 5ACMA 2HFTA 5D72H 1MXDA 3IKKA 1UEMA 4NHUA 3ZYJA 1L7IH 5AB1A 3K2IA 3UGUA 4KKZA 2P8LB 3CSTA 4BH7B 2VERA 2IWVA 3L5HA 2ITEA 4WQOA 1G7PA 4C56B 4N20A 5DHMC 4XBEL 2Z93A 3LEXA 3V6ZB 4EN3A 5J6GA 1CLOL 2XV6B 1AMYA 1HH6A 3ZN6A 1K6QH 3VTMA 5DFTA 4JM2F 4MAZA 3ETBJ 2R4OA 3C6LD 2WGNB 4FQCH 4L9LA 4A7SA 3QORD 4R0LB 5IVXE 1V10A 1C5DB 3I9IA 1OPFA 4K9EC 3EGSA 4EN2A 5ELIA 3EMNX 5JPNB 1DUZB 4XMUA 5A2KH 4DVBA 2MFNA 2OXHA 4C4KT 4Y1AE 4PS3A 5DRWA 1E4XI 1NQBA 5GSVA 1SPDA 4UQEA 2EDBA 2Y69B 3SQOL 1DJXA 4JO5A 4A7GF 3RA7H 4RDQF 3UYPB 1MFEL 3DX6A 3MLZH 43C9B 1S8DB 1A7PH 2OX5B 3VXRE 1R0AH 2WQWA 4Q9RL 4G42A 1HEJC 5D1QC 5D7LE 3NCXA 4X8CA 2B1OA 2X4PB 3B8SA 3CFDB 4ANKA 3AREC 1TTBA 1Q0YL 3RGBA 2VISB 3T0BA 4JY4B 5ICXA 1MCSA 2RH0A 5BUPA 3U2IA 4DP7X 4ELDA 2Q20A 1MZZA 2HTLC 1KCBA 4P8QA 3LRSB 3TYGL 1M7DB 3DO7B 3KPPB 4RMQA 3C60C 5HYJE 3QHZH 4NKOA 2X0VA 4Y9FA 5LCVA 3P0VH 2F1BA 3QHFL 4PVNA 4GAJH 3NH7H 2AJSH 2GB2A 3GIVB 2WLIA 4NUGL 5K1NA 1YEFH 3O2WL 1OW0A 3PUUA 5C0AE 5TQ0H 3S3CB 5L4JA 2BVEA 4YGVA 2CD0A 4HIJA 2RHEA 2XTRA 5E6IA 3WJJA 3UJTL 1DQTA 1EQWA 2R7EB 5IB3A 3D18A 1FG9C 4ICWA 4ALAC 3NBNA 2MCAA 1A3RH 5IMLA 2VM4A 4YDNA 5JLZA 1MCOH 4YL4A 4PJHF 1IM3D 3UPRA 2CLRA 2ZKHL 1RIUH 4F7CB 4ODHH 3BWZA 1S9XB 3MRJA 1MW1A 1E8WA 2PPCA 3IKCB 4P49A 1HHIA 3WJMA 4B9GA 1A6PA 4BA8A 5PAZA 3AM8C 5J12C 5B39A 3POHA 3K4DA 5EPMB 1D2PA 4L4TD 2FTAA 4IJ3B 3HUJF 5G3AA 4W9KC 5E00A 5IF0A 3TZVB 3QA3B 3AT9A 3EJPA 1G4RA 25C8H 1KIQA 4L8CA 2IH3A 1CN4A 5AL0A 1UASA 4AX3A 1CMOA 1VFUA 3LNDA 3PF1A 1LMIA 2FLRT 3WN6A 5DMIH 4ES8A 4XCEB 5I74B 3ABZA 4Z7VF 5D7JD 5AWNL 3U2SB 1ETZB 1X5GA 5DD0L 2NX5D 5AUMB 4WJ5A 3ILQC 5IHLB 4DF9A 1UKTA 4F3FB 1EFQA 2BNUB 3SZ6A 3WLWD 3FT4A 3X1NA 3SDAD 3GD1C 1BQ5A 3BIKB 3GWJA 4ONGH 1FORL 3C60B 2Z7YA 3TBWA 3QUKA 5GGRB 4G9DA 2R23B 5I1AB 3O4LD 1ZV2A 2VAJA 3ZU8A 1NM4A 5FO7B 3TEWA 2IEPA 3PPEA 3LEVH 4JE4B 5B38A 2P4AB 4U4BA 3IFNL 4KNSA 3KEHA 2LAAA 3U7AA 4WGKA 4PTUB 5EUKB 3CFKB 5I1LB 3DWOX 2HX9A 4XX1G 1M71B 2J6EA 2EKSA 3QHZL 5B3JE 3BH9A 2Q86B 4CNIA 1DQDH 5JXAH 2MQGA 3UC2A 2J8UA 4UIKL 3RJQB 4LOUC 3JTYA 1RI8A 35C8H 5SWQA 1P4LB 1N5YH 3QB7C 4BRJA 1ACCA 1EAQA 1IAIL 2NYYC 3MYJB 3DPBB 3KH3A 5L88L 4NT6B 1A9BB 1M56B 1YYML 3CXFA 4A68A 1FVDA 3KXFE 1HHKA 1MFDL 4YDJB 5HHVH 4HWBH 5BXFB 5GZOC 3VFWB 3OXRA 1E6OL 4ZSOA 2C7UB 1K8DA 1RUQH 2W5PA 2X7LA 2ZQKA 3FQ4A 2D03H 2VZUA 3UTQA 1AQMA 1QWNA 2XACC 3GSRB 3UYPA 3ZDZE 1BW8A 4JM2C 3HOGA 5F97E 1FNGA 2R4NA 2UWEE 4H2AA 2OP4L 1NOFA 5CLXA 1XB6A 5C2UB 4Z3TA 1XH3B 1KBPA 4LCYA 1HVXA 4WDIA 3MCLH 4Y16D 2GAZA 4CVZB 2XQYA 1SRDA 5KN5A 5HYSA 4YOKA 1IBGL 3CSFA 3KJ4C 4QEGA 5KBKA 5KS9F 2R2BA 2M06A 3S88H 4E41E 2NY5H 2NYZA 2BSTA 2V9TA 2CKBH 2NNCA 3LZNA 3MV8E 3LSOB 1M7DA 1ROCA 5EN3A 2WKOF 5KW9H 2DLFH 4FP8H 4FQXC 4KO9A 2CNYA 4XPTH 2F7RA 3RBHA 1TITA 1WA2X 4F8QA 3QQ9D 5GHWH 3ZT5A 3MTXA 2BO0A 3LQZB 4RA0C 3PABA 2IWGA 2P5WD 2WQRA 5EF1A 3OWEA 1JWUB 3ERXA 3HPJB 3CSGA 1YPZE 1ZVYA 4JW3A 2BNRB 1OCWH 5JLZB 1H15B 1KIUB 3UYOD 5C2BL 2W38A 2AI0L 1KLFA 2HJFB 2E3VA 3H9SD 5CZVH 5T3XE 4HUWA 3B5HA 2YEZB 4WEEA 3KLQA 3RWDB 4ZW7A 1R3JA 1VEOA 3SY0B 4UT6H 2QADD 5F2FA 3U4BL 3EFOB 3IGAB 2XE5A 4GRWH 3WIHA 5EZIL 1G1YA 1U8IB 5EG6C 3IJHB 5EIIB 4Y1SA 2YAFA 5IEKB 1KN2L 4X6CA 3HAEA 2VDNL 5E8NB 5BUAA 4AXWB 3CPUA 2ZF9A 1DQDL 4HYTB 4I8DA 4CU8A 5DJZB 4JFOA 3V6BR 5ENWB 3H42H 4FNTA 3FMGL 3BE1L 1DANT 1MCIA 2Z91A 1EAJA 5GTHO 5D93B 4P2OC 1DO5A 4P2RD 3GHEL 4ZTPH 4O4YH 1HZHH 2CK2A 4GKNA 1VKXB 2EEAA 2YARA 1IE5A 3O6FD 5GGUA 3VXOB 1N6QH 5B8CB 4JPIA 4ANXA 2GC4C 1H3XA 1YECH 3E7JA 2X27X 2JKNA 3I9GH 3FHAA 3TPUB 4KKCD 3OX8A 4N9GA 1SVCP 1M7XA 3LXBA 3APNA 5HDQL 3ISYA 2XE1A 4H26B 2ESVA 1YNLH 3AGWA 4HS3A 5FHAH 4CGUB 1HIMH 3MREB 3QULA 2DQUL 4QLRA 3B2MA 3HC3L 1UACH 1TOXA 3X14A 1D6EA 4AQAA 3O6FA 5J89A 3RVVC 1LE5B 1EEUA 1OWWA 3MLVL 5LGJA 2XQBH 3CFKA 3DNKA 5DC2A 4NBZB 1KJVA 1WHOA 3DX9B 4Z3GA 3QAZB 3QS2A 4Y89A 2AGJL 4AKRA 4Y2DA 1WCBA 5F7YC 3S8WA 4O4UA 2R29L 1QHQA 1YNKL 3GJFA 3GXTA 3VFOA 3QO1B 4NT6A 1A9BA 1T7YA 4G8AC 5I1DB 2KC0A 1V3LA 4UTAA 3X3GL 4OFVA 1GGIL 2VE6B 1RIUL 1TJHL 5K33A 1LE9B 2HJKA 4HSQA 5SWSA 1K8DB 1U41A 3MNZA 5MI0C 1A6WL 5KUMA 1GFMA 4L1TA 1KYAA 4QRPB 1F8TH 4MS8D 5T1LB 4K3GA 4U49A 5TH2B 4DKAA 1XIWD 2EILB 2XCMC 3K5RA 3T6QC 1JNNL 1W8NA 2GABA 2Z9TA 3TTSA 5E4EC 2J71A 4TKWA 1L9NA 1YUHA 3II1A 3VJ6B 3MJ6A 2DQIH 3R0MA 2YA1A 1C5DA 2ESVD 4KKLC 3VXMD 2E7LA 1RZJL 4GSQA 1A6TB 3AY4A 3MRPA 4L1HA 4XZ4A 4AJVA 3BUYB 1JG9A 3GK8L 3LZFL 4LHUD 1E40A 1RIHL 1QUNB 2CDGB 4A6YB 1J1OH 1XXDC 2VXUL 3IBEA 5D70H 4YZFE 3UPGA 3VZWX 4YVNA 5GQBA 1RAMA 2YRPA 1ZHBA 1JNLL 5T5NG 2IF7A 3CZNA 1ZMYA 5EOQL 2BNRA 4YBLC 3W56A 2OCFD 3MAWA 3RIAK 5HJGA 5D7LD 1UGNA 2FBJL 2YEZA 1VCBC 4JY6B 2UZIH 4OZGF 5ICYB 3CVBA 1CURA 1HC1A 2G3XA 2YEQA 3VFTB 2R4LA 1SFHA 1BVLA 2VDLH 4PV9B 5IEKA 4FRXA 2DKUA 1JGDB 3FB8B 1DCEA 4PY7B 5FGCB 2AJXL 4DZ8B 5JIMA 4A6YL 4L05A 5L6YH 3RL2B 1NZRA 2FGZA 2NY2B 4EPSA 4NKOB 4ZMXA 1L6ZA 1I9JH 3L3IB 3BP4B 4PBXA 5MHSE 2BM3A 1JGIA 1O6SA 4GKNB 4B9ZA 5IHZA 2JIXD 2IMMA 5MERB 2XZCH 4N26A 1CCZA 3KBEA 1FJ1A 1QRNA 3AQZA 4ZUSB 3PP4H 3KJ6H 4M62L 5IZ7A 5KVEL 3ARVA 1WISA 4FERA 4GQRA 5MEND 1NCJA 1EZUA 2E86A 3DUSB 5LNEA 3UPRB 5HHQB 1F90H 4PG9A 2BHFA 1MREL 3GS7A 3MRJB 3DUHA 1I7ZA 4AYID 3VSTA 1XIWC 2NX5A 4X8GA 1UOKA 2JLPA 1OCRB 4JS7A 1SXSA 4FI8A 2ZXDA 3SD5A 1WA1X 4H0IA 2XFXA 4YSTA 1H5BB 2YQ3A 4F8OA 3WO4B 4KI5C 3O6FB 3KWXA 4H1LH 2OSXA 2XKNB 5DWPA 5E00B 1BYPA 4P2RB 4Q9QH 2QMKA 4GW4B 1ZVNA 2ZUWA 2ZYIA 3LDBC 3LN4A 3FB7A 1AS7A 2M26A 5CKAA 3D12B 1BBDL 2WQXA 4HUMB 1PLCA 2KLSA 3ZZ1A 1YA5A 3SOBH 3CVHL 1NCWL 1XB8A 2YK1H 4WNSA 4BWUA 3OR7A 3C5ZC 1CS6A 2IAND 4OBRA 5DVNA 2YD5A 1ETA1 1BX2A 4JZJB 4LNRA 4ENED 4ZNCD 2XWCA 4BFEA 2O26U 4GY4A 4ZUVB 1J1PH 2YXMA 3FXIC 3GSNH 4DERA 1Q1PA 4KQ4H 3D3VA 1GOGA 4GAYB 4MJ2A 3CG8A 3H9YA 5C9KA 1HI6A 4TUJA 3T0EE 4JY5L 1NMCC 1M2OA 2EADA 4NXSA 3VFVA 1XHHA 3O0RH 3ETSA 4PLKC 4ABVA 1KTRL 2OMBA 3F7LA 4YHIB 1N7MH 3FQWA 3WL9A 1T1XA 2N0MA 3BD5A 4O2EB 2Q86A 3BH9B 4CNIB 1Z3GH 4NBXB 1SMAA 4XMKL 4FQHB 4ELME 5SWQB 4W93A 3RRQA 3KDMB 4FJZA 2CBOA 2WUCL 1W72A 2AJVH 3F83A 1U3NA 3IDGA 1N19A 3CFTA 1X5HA 3I75A 1B2YA 1XSIA 4TLUA 2FO8A 2PETA 4XNUL 5E6ZA 2P1YA 2QT6A 1MFNA 1VF5C 4JANA 2N7AA 2DYPA 3LMJH 4NUMA 4WEBH 3VFWA 5I2IB 3SO3C 1MAML 1UVQA 5SX5K 3WYRA 5DSCA 2P43B 3GYRA 1CD0A 3PE9A 4OFPA 5C3IA 4LQFH 5HHOA 1T66D 2GHWB 3GSRA 1A6VH 4G8FB 3UGXA 1OP5H 1YRKA 3K6NA 2AAVA 3CK0L 1U8PA 4Z7NF 1R19A 2F1AA 4MNQD 3JWOC 4DJMA 4E0RA 4NO2B 1AG6A 1LTXA 3QUZD 4Z7VE 5KANI 2B0SL 5ANMA 2GAZB 4CVZA 2FJGB 3FOMA 1DFBH 1DVFA 3H2QA 3NFPB 3O2DH 3ETTA 1PIGA 3K3QA 2KBGA 3O8XA 4GINA 1JZEA 4YDVB 1FH5L 5GJTL 1NSNH 3QR2A 3H6AA 4EQ2A 2CNZA 2WLJA 4PJAA 3UZVB 3EYSH 4NUJB 5CP3A 5DC4B 4OCMC 4PJ7F 4KV5F 2Z64C 5C0AD 2WZPD 2CRZA 1CC3A 2ZOLB 3ULVD 1KG0A 1J0ZA 4IOFD 3MYZA 3SO3B 1FJ1B 3T3ME 3FN3A 3O4LB 4OAWA 3RUGA 5T1MA 4Q56A 4DEWA 5HHMB 2F7IA 3HPJA 5KS9B 4Y1TA 2HJFA 3F3HA 4HK0A 3B3IA 4JPWH 4I9XA 4MHHG 4LCCA 1QJ8A 2GJZB 2ZE0A 2CDEB 3MDJA 4HCRA 4WU7A 4Z0XA 2I5YL 1X44A 1OT2A 1EMTH 1NCAL 4FQLL 1SJEB 3NTCL 1Y07A 5MENB 2JQMA 4KDVA 2DWSA 2HLAB 1X5KA 4KXAA 5HVFB 4PI0A 1N5AB 3OHMB 3KYAA 2W65A 1YQVH 4Z7VA 1EGJL 3G5WA 3WS6C 5TJWK 3P54A 2W94A 5AFUK 2KZKA 3MLWH 3HW9A 3ULSB 2F61A 1KELL 4Y1AB 1UZ8B 1HIML 3PREA 4X9YA 4FQXD 4JPIB 1DO6A 1WBYB 3H9HB 2SEBA 4N9GB 1IBYA 4NC1E 3RTQA 3MGTA 3GDCA 1YMME 3BAKA 3T5WA 1VGKB 2MTAA 5A2IH 2GKIA 3QORA 2MCG1 4J4PA 4LEXL 2HRGA 2L3BA 4RBPK 4JJOA 1CGSH 3BQUA 5ID0B 1MCHA 4QXUL 1HEZB 4J6RL 5D7LB 3D34A 4XRCB 1AI1H 3LDBB 1JGLL 1R24A 2H3KA 1WS7A 1KJ3L 2DL9A 2HPOA 1UXWB 3QJHB 1QA9A 1HL8A 2Q1EA 1J86A 3NCCB 1E28A 4G11A 3LK42 1YS5A 4AIZA 2C26A 4DTGH 1VEMA 1EVTC 4JHUA 3UH8A 3N43F 1FUNA 3ARGC 5GJSL 2ZXAA 1ZJBA 3S2CA 1GOFA 2QGCA 3C2AL 3OAZK 3BI9X 4M6MH 3QXWA 5CF3A 3FSAA 3UAFA 3QQDB 4GP8B 4Z95H 4Z77B 1JGVH 3GLDA 4UNIA 4NQUA 1SXCA 1WE5A 3ZKXB 1N0XH 4LDEB 3BAWA 4KQ0A 2BP0A 4HHWA 3EO1A 2WANA 4X99B 4LSVL 2DQHL 5ABAA 3ZR5A 4IBZA 3BRFA 1TZIA 2VABA 2NDFA 4DK3A 5DL7A 2O5NA 1RMFH 4K9EH 2WZPA 5JORA 5BZXA 3K0YA 3FL7A 3R7RA 4PG2A 2BMKA 4WTXA 2WVVB 2EH8H 1RUML 4E0RB 4KZDL 1L9MA 4NRYA 4X50A 3H6JA 1NCTA 1S5IL 2DQDL 3PAZA 3UEZA 3KM1A 5EZPA 4HLJA 1EEYB 3AS3A 1FFQA 1SMDA 1M9WA 4X4ZA 2ZKHH 4OSUL 2AK4B 4G8EB 4LU5H 3QUZA 5F70A 3UO1H 4BZ2A 3MRPB 2P52A 3CZLA 4PJAB 4RSYA 3QRAA 2CO6B 1WWBX 5JDSA 3UZVA 2V9RA 4ATWA 1HOCB 5CILH 4U0RC 3SCMB 4PYGA 3VD4A 5J1TC 1WIPA 2WIIA 4TXVB 3B56A 2Y7QB 4NQXB 2WZ5A 1JPTL 3UL4A 3QI9B 5IVZA 3FO0L 5C08D 1BF5A 2R1YA 1J1OL 2OMTB 2F15A 3BOVA 1SYSB 4ODSH 1T4WA 4XTRD 4Q74A 4AQ1A 2J1ZA 3BH4A 2F68X 3FAXA 4YIQA 3R19A 4HK0B 4N85A 4PJFF 4P9MH 3CCHA 1UUNA 1QFWM 3QCVL 3BSHA 1IZJA 1LL1A 2AQ2A 3GZPA 3SPVB 5BRPA 2D2OA 3VXUE 1BAWA 2VB5A 3X17A 5CM1A 2AQPA 4POUB 5KVFE 1W0WA 5I0DA 2HRPL 4P5TB 4DP2X 3RL2A 1HINL 4RNRA 1A1NB 5BNXD 1YN7A 2VDOB 3ULUE 4BKSC 3BCFA 3U9UA 4NNXA 3RFZA 4X4KA 1F3JA 1CXFA 3FO1B 4M5SA 2FB4H 2HVJA 2XHNA 1MWAH 4UDUA 3SYOA 1I3VA 1TTRA 4HK3J 1OAZL 2ID5A 1L5GA 1ZVSA 4KNQA 2YBRB 3L3JB 2F53D 4K3CA 2XZAH 4NDMA 5FUZL 2GIXA 5ESVA 1E4XL 2FGWH 1ZHYA 5DJCA 1T21B 4D0CA 3MGTB 4TVPE 3LN9A 1N6VA 3AA7B 3SDXF 3MZGB 2VUYA 3SCMD 1GCYA 1NGZA 1NH6A 5IESH 1JVOA 1GGBH 4NFBA 2OQJA 3B9DA 2XIIA 4K55A 4XVTH 3WSQH 3TCXA 4Z7UB 2AQ1A 1HEZA 1ZRUA 2QR0A 4XRCA 5D7LA 1BFVH 2WBJC 1URLA 3E2HB 3NCYS 3P0YH 4HGWA 4PVBA 4ZFQA 4OZIF 2OPCA 4Y16C 2Q87A 3GXUB 4RMRA 2MJWA 5E2UL 4M29A 4LLVB 4YDIL 3ESOA 5FWRA 3VX0A 4P46B 4QRAA 1CE1L 1RHHB 5EOCJ 1IC5H 4NJ9H 3MV7A 1IGJB 1JZ8A 4JFBA 3F05A 1XQ4A 3GJEA 3KPMB 3LOWA 4RAUA 4J7RA 5DD3H 1CLYH 4OUUA 3QQDA 4Z77A 2APVA 1I9RL 3AAZA 3X1FA 1HHGA 3KPLA 3WHXB 3SPCA 4MZ3A 3G5VB 1BX2B 1QR1A 4YK4B 5F6IB 5LN4A 4OZ4A 1ZLDA 3X13A 1FN4A 4D2NA 4XVJL 1FPTH 4N6RA 5FC9A 1F97A 3D3VB 2WXKA 2JIXA 3FQ1A 3VI4E 5JORB 2QSQA 4O2FB 1KY6A 1K9TA 4IRSD 2QPUA 1AGCA 4P2YA 4WFFD 1Z6JT 1E30A 5EBLB 2CWRA 5CZXD 1KCLA 3GZKA 1XFPA 3FQWB 3WL9B 3JV4A 2QSTA 1G9ML 1LP9B 3HE7B 3GRWH 4OT1L 1AYOA 3HNTL 2C9AA 4NPJA 3RVTD 3A6BL 3JTSB 4M7LT 4JQVC 2OAAA 1ZK9A 4XN1A 5BS0E 1IGML 2VGLM 2CRIA 1J0JA 1Y18B 2AI0H 3BGFC 5ADPL 4NQCA 1TO5A 1USZA 2VOTA 2OSLB 4XPGH 4GFXA 1QQDA 5DYOB 4OLYL 2GJPA 1HHHB 5IB5B 4M4RA 4ZUWA 5C07A 1Q72H 1K4DB 2BFVH 2W9EH 4F2MB 5I0YA 1BIHA 1MRFL 1MJ7H 4HZLB 1QLRA 4O3XB 4OW6A 5FUOL 3AB0B 3IVKA 2E6QA 4XPTL 2YMTA 1NC4D 1VGEH 2K1MA 2NY7L 3EOAB 5KBMA 1AZNA 1TFPA 3E9UA 1N67A 1T5KA 3QZLA 3DTXA 1OLLA 1T3FA 4KKNA 4PRIE 3VM5A 5GGSY 3RWHA 2DMKA 1XT5A 2MQ3A 2M2DA 2CM5A 1ASQA 3WFZA 4P59L 2VLRA 2AKRA 2Z8WC 4PRPB 2ENSA 3VMOA 1DJZA 4AQ1C 2EYSB 5D7JB 2Q3ZA 1SBSL 3DJRA 1J8KA 1G7MB 3T2LA 3ENEA 1KTDB 1CBVH 3HC0B 1PL3A 3CX5J 4YSUA 3U0WH 3KM2A 3U9UB 5DMGC 3S0PA 5AYTA 3OJVC 4UDUB 1G9MH 4OT1H 2B39A 1XZ0A 1I9IL 5G26A 1G7PB 3D6GA 2BVOA 5HHNB 1F4AA 2HP4A 3QUZC 4UT9A 2N7SA 7FABL 3VMPA 2OJEA 5JW5A 4NAQA 5D72L 1AVAA 4G9FD 2GUOB 3F7PC 1R33A 4LCCB 4BINA 3E6FA 4FLSA 3TL5A 4U1MB 1DLFH 4HGWB 3QJQB 3L4UA 2WUBH 1KCSH 2X9XA 3OLIA 4N22A 3VXQB 1FLTX 4WLCA 2I7SA 5LBSH 5B7EA 3V0IA 2EVJA 3IN0A 3HI1A 3ULVC 1H6EA 2FSEB 1XBRA 3GSWA 4CN4A 3IMVA 1QLFB 1LDPL 1DE4B 4PB9L 1CVSC 3KPSD 3P73A 5DO8A 5IFHH 1UZ8A 4RA3A 3FHQA 1FNAA 1HHJA 4QHNB 2PPFA 2ZCKL 4KKCC 4NQED 5GJTH 5F3BA 1JVKA 1OP9A 1BVNP 4TLKA 1SYVA 2WYTA 5KSUB 4QOKB 3DBXA 2MIZA 3T4YA 3LX9A 5E9DE 2BHUA 3QRLA 2FQDA 4U1NB 3F7YB 1SY6H 4RAHA 5AYUL 4AC2A 1P7QB 1Q0XL 4LXFA 5FYKH 2HN7B 5G39A 3VM7A 3ZRSA 2WV3A 2QPEB 1OK8A 5FGCE 4JHWL 2R51A 4LAQH 3KPPA 5DZAA 3L9BA 5BZZA 1N8ZB 4MXWH 4JRLA 4W9EC 3IEAA 4JPKH 3INUH 4RLDA 3S5YA 1MWAL 5I30L 5FX3A 5K69A 3AXIA 2VDQH 3GQFA 3CFDA 4HIJB 4AUYA 1KULA 4OGYL 5ANHA 3JTSA 4EO5A 3CNKA 3KL0A 2YA2A 4GH7B 4JY4A 4NFDA 5I73B 4L3AA 3CC5A 4BE5A 2WXRA 1KEMH 3TIDA 4QMEA 3DJSA 3EO1B 3DVIA 4F7CA 1HHHA 5C9JB 1A3LH 5IB5A 2WLIB 2BXZA 5DYFA 4HJJH 1WZLA 5DDHA 3TX4A 1NCCL 1CLZL 4Y2NA 4OCWL 3K8KA 2IPUG 2R7EA 2YXVA 5IOPA 4M6NL 3SKJH 2Y2WA 4C56D 4P9HH 5CFAA 2RCSL 1VACA 4GXFA 3FW6A 5EU6E 2ITDA 1RV6X 3V5KA 3P9LB 4LVHC 2N0KA 2AJZB 5CJ8A 2A73A 1GJUA 4PJ7A 1KTKE 3ARDB 3O6MH 3Q6GL 3SE9H 3BAYA 4M9PA 4NC0B 3TFBA 3FUKA 2AK4A 4G8EA 3ROOB 5GSRA 2XN9B 1AS8A 1XF5A 4ZQKA 5I23A 2D9QB 5IHWA 1UATA 4LU5L 2O93L 5CZKA 2YPVH 3MBEC 4Y5XC 1N3NB 2YFNA 1AXTL 1YEGH 3KXFB 2GCYB 2XG5A 1NCIA 4NP4L 2X6VA 1NFDF 2DM4A 3BSGA 2OV0A 2VZ1A 3JV5A 1LYQA 3CLWA 1L3NA 1UURA 4GO8A 2QV2A 5IVZB 3WD5H 5EU3A 4WWID 1D5ZB 2WJ7A 4R6UA 2WVUA 4HQQL 4QGTA 2QGDA 4XAWH 5AZ2L 3MA7B 4R4FH 5ANME 5FCSH 1SJVA 1GAFL 2V7HA 1LXMA 1DZ0A 1SGKA 8FABB 3RVXC 2FLMA 1D5IH 4HLZH 4M1DH 3CX5K 3PWVB 3O0EA 4MQSB 4BUGA 2I5YH 5FKAA 4RNRB 5E8OA 2R23A 5I1AA 3WGUB 4KK6D 5HYIA 5E6ID 5I5JA 3LS4L 5B38B 5LG6A 3MV8B 3WIFA 3DIDA 4YDJA 4RISH 5HD8C 1F3JB 2KKQA 2X87A 4EIZC 2AF2A 4XTRC 4ZSOB 1HHJB 1PKQB 3ZE2B 2WXNA 5IMKA 1T0PB 1T22B 4P2QA 3O3AB 3TT3H 1P4BH 3UACA 1ZHNB 4NDMB 3BW9A 3T0ED 2Z93B 4EI0A 3B2VH 1OQOA 4CC4C 3ABKB 2N3JA 1JGLH 3D06A 3IU3B 1FVDB 1YPZB 3A3YB 1HHKB 1RK0B 4XPBH 1QSFA 1JHTB 2ZX8A 5LG1A 1IEAA 1BZDA 4W4OC 1NBZA 4WHTB 1XCQA 15C8L 2J2ZB 3VI4F 1MWOA 1BZ8A 1KCVH 3QJXA 1H3GA 5E94B 4HG4K 2XNAB 2QADC 2YWYA 1OPGL 5LVEA 1PAZA 1UXMA 1TVDA 4IKNA 1AGDB 4PGDA 4M1GL 2A9BA 1FGVH 4U6XB 2IWFA 5DQ9B 5INDB 2JI2A 3G5ZB 3OAUL 4HIEA 3Q5TA 2FX8L 3BAJA 3LIZL 2PP7A 1OB0A 2GI7A 4FN0A 4QRPD 4H1LG 1DQQB 4OCLC 4E9LA 2NY5C 3CSYA 4Y4HD 3O4LE 5C92A 2ZPKL 4YHNA 5IGXH 2GITA 1OAKH 2VLLA 4BZYA 5KYYA 3L54A 4G42B 3F6JA 3PIQB 4XWOD 2C9SA 3IDJB 5C9JA 3HZYA 1ZANH 3DI3B 2YSSA 2X4PA 3QZWA 4QXWA 5F3HB 3SDXE 4RVBA 1I1FA 4NN6B 5ICXB 2HKFL 2JIXB 1WQVT 4MAUH 3ZTEA 3KVDD 4FHBD 4I3RH 4X6CB 5E8NA 3CVIH 4LBEA 3K5SA 2ILLA 4GG8A 4JFDD 2WXGA 4WY7L 3UZEC 3JV0A 3O0RL 3BWSA 2YPKB 1OT4A 2B16A 2JCCF 4O5LL 3KWUA 5I8OH 2EYRB 4A2EA 1XSKA 2Z0UA 3BSZA 3HS0B 4RGOL 3CDYA 3RWJA 3D4CA 1R3JB 2KPWA 4YGVB 1KENH 1RZKH 5LQBH 1SOKA 4M00A 5EORH 1Z9MA 1LLAA 5DVLA 5D55A 4Z3IA 5EIIA 4TTGA 4GG6A 2X4SB 3EYOA 4XMXA 1F42A 4JFXB 4U6YA 3AQXA 2CPUA 2E7HA 2PWFA 4R84A 3SY9A 5ENWA 2JB5H 4PJDE 1IJNA 1WBZA 2WM0A 2GCYA 4PJ5B 4ZUWB 4KDTA 4N8UA 4E5XB 4AMKH 1NKOA 5TPWL 5CZXC 3WNJA 5BZDA 3ECUA 2EEXA 3TN0B 1JSYA 2XWJA 1DVZA 1F4YH 5BZDB 3AAAA 5BV7L 3L2LA 3FKUS 2B9BA 5C8JB 1BM7A 4LSTL 3RNQB 4L8CB 2ESVB 4NUQA 1NGWA 1CGTA 4MJ4A 1DJGA 1FAKT 1XCTA 3MRBB 3C6LA 3EDDA 4P23B 3NCFB 3PGRA 4FRTA 4S1SH 4X98A 4Y5YC 2Q8AH 3UZQB 3IGLA 4YSOA 1MHHB 3ELQA 3FH8A 1FNEA 3NIDF 3RYMA 5I1DA 2E46A 4NIYE 4EZLA 4J3OF 4R97C 2CO4A 3QNXA 3QEQD 2BVYA 3LS5H 4F57L 4NPKA 1SQ2N 5D5DA 5GS0H 1ZHNA 4U2YA 5E8DL 2ZFGA 3D85A 2XWRA 1JOIA 1U8OA 3HRZB 4HCIA 4MMZC 1UEYA 3MROB 3MV8D 3MUUA 3MKKA 4KHXH 5IVOA 4PD4K 4KQ3L 1T0NA 5LGKA 5C1MB 1XGYL 4XNDA 3U0PA 3N42F 4AIEA 1JPST 1OPOA 4U1MA 2DMHA 4JG9A 1YUHB 5HJBA 3GEWB 5E94A 3T77B 4PJ7E 4RBPH 1W0VA 3HOEA 2Y22A 5TE6H 3DPBA 5FLVA 3GMLB 2Q10A 1GGCL 3PLYA 1AGDA 4DETA 2KH2B 1HK6A 1ZHXA 5T1LA 5TH2A 4CJ0A 1C5BL 4RAVA 4XOAA 1QLFA 4IDJH 2G9KA 1C1EL 3TBBA 2PXYC 1PLGH 3OJMB 1SQMA 3P73B 4MZIA 4HCFA 4JZJC 4LPUA 5DQJA 1JNLH 4LE8A 5LDSA 3MBXL 4DP5X 2BCKB 1MNNA 2ADFH 4B9IA 1ZHBB 1QFUH 4N3TA 3GRBA 3HZ3A 1S6NA 4G8IB 1KGJA 4RETB 4EEEA 1CD9B 1WEJH 5AKTA 2E9JA 1A6TA 1AE6L 4IBQA 5CUSH 3KS0J 3KW8A 1ZWIB 3PP3K 4PJIF 1XVSA 3PIQA 4AZUA 4KI5E 4ORZC 1FO0L 5ADOH 3LV3B 1RIVL 5AW7B 3HBGA 3S35L 4AOFA 4WJG3 5E8EB 4HWEH 2UY6B 2YFOA 2AJ3B 1P2CA 3U7YH 5IKCB 1W8OA 4R8WH 4ODWB 1JPFA 1QASA 2X4QA 3ATFA 1Q72L 3OMNB 3T0EA 1GC1L 4PCYA 3M45A 3Q8CA 5DT1H 3UBXB 3W39A 2ODJA 4UOZA 4FXGC 4JGJA 4UCFA 1JK8A 2IAMC 3FQYA 5EORL 4KY1L 3EJUA 3W0WA 2PTTA 4V2CB 1CPUA 1NL0H 5DR5L 3U7YL 4WWKC 2YMXH 5L88H 4PN6A 5D6DC 1KIRA 2MHAA 5FDYA 5B1CA 3NSFA 1W9XA 2KDGA 3QEHA 4IGBD 3POQA 5JDJA 5BMFL 1FYHB 5AAWC 5EBMB 3SBWC 1AY1H 5KJRL 2DIBA 1C5BH 3ZKMC 3L3IA 3K46A 4KTEL 2ROXA 3SPJA 3PRZA 5K93A 1ZK5A 2RJMA 4XGZA 3IGAA 4X7TB 4UDTA 5JIIA 2WP3O 3IJHA 4Y5VC 2L7QA 4PAZA 2WBJB 3DJTA 2VLKE 4AXWA 4DGYH 3OF6A 5HPOA 3S37H 1MJUL 4NOFA 1A7QL 2QGBA 3T3PE 3DUSA 1N0LA 4KV5E 3TA3A 1HAUA 5HDLA 5D96B 5GGUB 1I7ZB 4DPRA 5TQ0L 1R5VA 4Z0BH 1YJDL 4UV4H 5EDSA 5KYNA 3BPOC 1XGYH 4UMGA 4YSDA 3HB3C 4LPXA 3Q9QA 3W5MA 5F9WB 3TPUA 2VERN 1H5BA 4HS8H 4JB9L 4XN5A 4F57H 4QO1A 1ROWA 1F3DJ 1CIUA 4GKZB 3JUYA 4YE4H 4XP4H 3WO4C 3LN4B 4UTBH 3FB7B 4PJCA 4NQEB 1MKFA 5KBPA 4NZRH 1JERA 3MREA 3QULB 2O5XL 3GI9H 4KUZL 3VGBA 4M7LL 4IRZH 3IJ7A 1GMEA 1F8TL 3L3OB 3VFVB 1GKEA 3IGKA 4I0PD 2JQZA 5EO1A 1WO2A 1YZZA 4ZTEA 3MA7A 1GY2A 1J8RA 3TNNB 2R88A 3BO8A 2V7HB 3FU0A 4LNRB 5E6YA 4R96A 2K9FB 3DX9A 2RMNA 2XZAL 4APQD 1B2WH 4P5MB 2CHXA 4U1HA 2AERT 4GAYA 1TYJA 1W0VB 4FQ2H 2NXYC 4FMKA 4XNMA 3HR5A 4XNBA 3MRDB 2YAHA 2P5WE 5CFHA 2XN9E 5CGBA 2MPAL 2R29H 3T2QA 3EO0A 2L7EA 2XX0A 3GDBA 3ZYIA 3T09A 3DA4A 3OLDA 5SWSB 4DH2A 4A66A 3P0VL 1PKQA 4WO4D 3EF7A 3LHPH 3PP3H 3GZOA 1J1XL 4BFIA 3IFPA 1AQKH 3BQVA 4U7KA 5AYQA 1U8QA 3OAYK 4KRPD 2BIMA 5I8OL 1EZVX 1SUHA 3I75B 4LSUH 5L9DH 1CDCA 4EXKA 1RK0A 1CU4L 4LAQL 4JFEE 5ANMB 4MCZA 2IADB 1YAZA 2IQ9H 3I6LD 3ORJA 1HOEA 2PYFA 3FBQA 1SLVA 2FHFA 3RA7L 2QQQA 3LIUA 2PO6A 4FL4C 1UZGA 5EC2B 3V55A 3DETC 1G1CA 1UKQA 1WFIA 2VDRL 5I1EH 3NCJL 2VR3A 5IROD 4UBDD 1N6QL 4FG6D 3V52H 3J7HA 5HHPA 4KK6C 4JCLA 2ZOLA 3ILQD 5ETUB 3AU1B 2XBDA 3VWJB 3FOMB 1U33A 3EYVA 4OLWH 3UDWC 3HAEH 2G3NA 1GS7A 1KDIA 2Z1KA 5IQNA 3WELA 4ZX4A 3QPQC 2E9GA 4YDVA 5J9PA 3BMVA 5D2NE 3FH5A 1FH2A 3NJLA 4LIQL 2NY1C 2G5BB 1CLZH 3WV0A 4YX2H 4OF6A 4X6CF 5KYXA 3TBYB 3IDJA 4AGNA 1ZGLB 1EXGA 6PAZA 4UT6L 1WFOA 3GHBL 1RUAH 1I1FB 3FUNA 4EIBA 4KI1A 3UBHA 4WCYH 2XWTB 1LWJA 3FB8A 4PY7A 4TVPH 3L3HA 2EEFA 1RCYA 4URTB 4HFUL 1PX8A 3B7SA 1EUTA 3QFDA 4K9JA 3F7KA 3V8OA 1CL7H 1DQLH 1G4MA 3UMTA 2L7UA 1ZHTA 3V9CA 1MPAL 1N0LB 3FQNB 3HS0A 4EOWL 1OSYA 1KCVL 2NY4B 3LKNA 3M88A 3LZLA 3OM3B 4IEFB 4AQ8A 3RILA 4JRYA 4RESB 3K6SA 4DKEL 2Y5TB 1OGTA 2A9NL 5C08E 1NFDA 2FH8A 2Y07L 4MA1C 1NLBL 3UO8B 2AHIA 1YEKH 3BFOA 2HG5A 3KPOA 1U2CA 4U1JB 4GAAA 1X9LA 5MHSD 4MB1A 2DBLH 1L0QA 4FNQA 5AYUH 4XMWA 3F12A 3B4NA 1INEL 3DXAE 4N2HA 4E5XA 1KJ3H 4RFOH 2BC4A 3SDXB 5CLYA 3ZMNA 3M17A 1R24B 4M5ZH 4G7YL 4MMXA 5FUCC 5CSGA 4M93C 4IDJL 4DP6X 3HIZA 3JWNG 4UTAH 4P46D 1WSST 4NQSB 4LOFA 4FFVD 1BGXL 3TPKA 4WFED 3QORB 2WINB 3MGOB 4JCMA 5EUOF 1F1GA 3EF4A 4K5MA 4UI2A 5ID0A 3W38A 5E03A 4BUQA 4XPFL 1NEPA 1KN4L 1QA9B 4QR7A 3ARTA 3D48R 3SDCA 2XJLA 12E8H 4JZJA 3DGDA 4X99A 1AZCA 32C2B 5FCUH 3T71A 3TO4A 2X89A 4LSIA 1G1KA 1TZIB 2VABB 5DFWH 2GIMA 1DBAH 3WENA 5C0RL 1OSPL 5EF0A 1BBJA 2ZWNA 1WGVA 3ZE1F 1MPFA 3ARQA 4X4ME 3R8QA 4AH2A 4HIXH 1U58B 4JK0D 3BUPA 4RJWA 4HIIB 3ZT6A 4OQTH 4HAFA 5BRZD 1K4CA 4P5TD 3NVQA 3U0PB 3TYGH 1MCKA 2HTKD 5HY9B 2NTSP 3F2LA 2PYFB 3QG7H 2E9WA 4HCGA 4FFWC 4G71B 4JG1H 4LPTA 3MN8A 3IAGC 2VO5A 3VFRB 2YD2A 4KRMB 4NRZB 3POUA 1TCRA 1YDPA 5EC2A 3JWNH 1OGAD 2BMKB 3O9WC 4LLUA 4AYFA 3I9AA 3QIBC 4JFVA 1MHCB 3BDYH 4F4BA 5I2IA 4EF3A 4CRPA 3OKLA 2BNQE 4DTGL 4R8WL 3APDA 5F9WC 1TG8A 5HGDB 4G8FA 5GHWL 1B0RA 5ESQA 1WTLA 2WTOA 4LSUL 3UADA 2E7MA 1CFSB 2DEWX 4KKBC 5DJYA 1CDJA 5M94B 5BW7C 3TBYA 2W9EL 2VQUA 3LV3A 1HOCA 5E24E 4LKCB 1KGYE 1MCWM 4GO9A 5DUML 3IS1X 2FJGA 3NFPA 1DVFB 3AT8A 1EO7A 4B9JA 4FQCL 3AUVA 2M83A 4HUUB 3T0EB 4LIQE 1W0WB 4MD5A 4J3XA 4S2SA 3RP1A 4GBXB 3NSDA 4OTXH 1K6QL 3FUDA 4HD9A 5LN8A 2PYED 1MCFA 1BAFH 2PR4H 3KPRA 4WRLA 4OB5H 1VIWA 3CVIL 5BO0D 1EGJH 3CCHB 4I89A 3S3PA 5I6PA 3BZEA 2XJKA 3O4LA 1M53A 1QVOA 1B4JL 1OGTB 2E76C 2YBRA 3L3JA 4FG0A 4ODVL 1E6OH 1OCOB 4R90L 3VD5A 1I85C 4D0CB 2HG5B 3KPOB 3WIAA 4A38A 4AZLA 1DJYA 4J3OG 1PNDA 1OSPH 3E8VA 4U1LB 5K39B 4B3EA 2XTLA 3RUGF 2I26N 1E54A 1Q0EA 4NHUB 4ODTL 2WZ0A 3VDBA 3A47A 4Q97A 3FO1A 2HVJB 3NSGA 4QXUH 2OMXB 3BAEH 3E3QE 3EJTA 1BJMA 1ZVSB 3CAFA 5D1QE 2NY3D 2Q8BL 4YHKH 4YHOL 3JQOB 4GAFB 2X5PA 4XCFL 3RI5K 3VG0L 3ALPA 4POZC 4LPWA 2W9LA 1UB6A 1ZDSA 3F04A 5DJXA 2KL6A 3DX0A 5DZLA 43CAA 1KPUB 3NT0A 4J3TA 3I2CH 1KIPB 3P4NA 4BWWA 4HU8A 3L95A 5KVGE 3ZK0A 3CN3A 1XGPB 4NC1C 3VFPA 2OK0L 2NR6A 3ARUA 2GTWA 1FFOB 4W9IC 3GKZA 4YPJA 4ONHA 5DRNA 3SDCB 4HKZA 3VDAA 3QWRD 4PIRF 4CDGC 1TQTA 5JPNA 1X6NA 1UWGL 3X13B 3NJMA 3V6OE 4WI2A 1SBBA 2K8MA 5DK3A 5DA0B 4Y1AD 3EGDB 1BJ1H 1A64A 3FTGB 1DBKH 4O2FA 4F9LC 4P4KA 2NCMA 1UADC 4TV3A 5JHLL 1ZE3C 1XD0A 5J6HB 2QBWA 4OJYA 4M3JA 3RVXD 3G9VA 2V4LA 2ZX7A 1K4CB 3LH2L 4N87A 3S35X 1RVFL 2QLVB 4WTQA 2JMMA 4NYLA 4Q6IA 4TNFA 4CSPA 4NCDA 1MCPH 5JHLA 2GEEA 1JL8A 5DUMH 1Z2KA 2R1WB 3QYCA 2Z8RA 1TNMA 2YSTA 4BZ2H 3QDJD 2ZCHH 1EERB 4NQCB 4TL4A 1JFQL 4IJ3C 4OIIL 4OJFL 4N90D 5DTFB 2NY4C 2FNBA 3GIVA 3WIIH 3MFGB 2WBXA 5T5FA 4GRLA 4S0TD 4I77H 4PJFE 1DVFC 4NP4H 3AMLA 4BFIB 3QP3A 2HT4D 1MRDH 2ARJQ 5ESQB 2Z7WA 4MA1B 4PGZA 4OR1A 3K7UA 3D18B 5INDA 3T1WA 1CFSA 1J0HA 4HOZA 2VR4A 5IEHA 1YNTB 4LKCA 2H1XA 2V2XB 2YPLE 2CLRB 2NY3C 2EEDA 1BZ7A 3VGEA 3V4LA 1S9XA 5IWLC 2WCPA 1A6UL 1EEYA 4OFKA 3O6LH 3AA0A 1H3PH 4ANWA 1QTPA 1HZLA 3ZXAC 4L3CB 2PO6B 2EYSA 4PV8A 1R3LA 2CO7B 1NFIA 3HG1D 1JYNA 3LNIA 2WYZA 1RY7B 3AUWB 3KPRB 4N0FA 4YSEA 5CEXA 4M1GH 4MQ7A 2MCPL 1XGQB 3V5HA 2GBVA 4WKZA 3BDXA 3LKPB 3TS8A 3MACL 4ZPVB 3ROLB 4NM4H 2C9XA 4A2DA 4XPAH 1ORQB 1TKWA 1GZQA 3ZY7A 1SOXA 1ERNA 1E5AA 1AIFA 1T04B 2ICWI 3PY9A 3ZKNC 2G5BA 2ZCHL 1ETZA 1CGVA 4JM2A 4HWNA 2VN5A 3EG9B 4RMTA 1XGTB 3BHBA 2Q6WA 3PDDA 4UV7H 4PJFA 4OFQA 3FRPG 3WTUA 3R06A 4DP9X 2OMXA 4MAYB 4FT6A 4RGMB 3C60A 4M7JL 1IC0A 1JGUH 1CTMA 2BVOB 5HHNA 2EEBA 2FJUB 2FSEA 3W0WE 1PZ3A 3LCYA 3MV11 3U6XA 2LT9A 4JUTA 4E1SA 4JL2A 3CU1A 3D08A 5DJXB 1AR2A 3WXWL 4ZMNA 4EZKA 4OCXH 43CAB 4QHNA 3K6SB 3T6VA 1NPNA 3L95B 2BW5A 5F3BB 3QJTB 1IFHH 5B1AB 1AH1A 2ZUVA 3BT2L 3EO9L 4R4ND 5I8KH 5KTEL 4HC1A 4Q9QL 5DL8A 1DVFD 1S2EA 3AA7A 4M7LH 2C4XA 3N1GC 4QAMB 2LHAA 4S0HA 3HNSL 1BPLB 5D1ZC 2ZJSL 3F7YA 2ED7A 5HI3D 1L0YA 2WSKA 5F1SA 2IIJA 2PCXA 5BXFA 3VFUB 4Z76B 3MFFB 3EGDA 1XF4A 1VFOA 4I5BB 1I75A 2HKAA 3NPZB 4JDTH 4LSSL 4E9QA 3EDKA 1JWSA 1IGIL 4N2KA 5KBNC 2ICES 3FRUB 1OSMA 3MKGA 2HTLD 4UU9B 3CZKA 2IH9A 2NW2B 1RZFL 1D6VH 1FNGB 4U3CA 4Z0BL 3GJEB 3KPMA 2HFFB 3KLHD 3T4YB 3BUIA 1U8LA 4QXTB 1UA6H 1OGAB 5EBGA 3A4DA 2ZNWA 1FNSH 1PZ5A 3FN0H 3HMWL 2TRYA 3IYLW 2R1WA 4YPGA 2J43A 2V8MA 4K7PY 2EXSA 4DPBX 1QFPA 2OL3B 3OKNA 3DO4A 1ZLVK 4H8WL 1BOGA 5GGVL 4HV8A 2WVPA 2YLHA 4WI8A 3VB9A 4G6AD 2CDFA 5J6SA 1QR1B 1CDUA 3AU0A 1E9OA 2F5AH 1G0DA 2J1WA 2P42B 2NOYA 2CZNA 3U48A 4OCXL 4MB5A 3ZKMD 1I8AA 3WFBL 5HGHB 3L3KB 5EC1A 1MVFA 3QIWC 3VSVA 4IHOB 5F9DC 2D7TH 2Q7YA 4OB5L 4WSKA 3PORA 1I7RA 3P9MA 4G75A 2VXTL 2EE9A 2ITDB 2AXFB 3QDHA 2VH5H 3G6DH 1A2YB 4OLZH 3NIFE 4DOHB 3V4UH 1L9QA 1S7WA 1YEIH 2AAAA 2AJZA 2PCPA 3CZEA 4OJEH 4PYHA 3IMRA 4MASA 4W9JC 5J7CC 4FYRA 4ISVB 5DDHB 1YNKH 1TCRB 1YDPB 1A8ZA 2XN9A 3OAUH 5I0WA 4HBQA 4ZQKB 5M7QA 3MX0A 4LRIC 4OH2A 5ALBL 2OSLA 2X6AA 3EFDL 1QQDB 4FP8L 2DYRB 5FECA 2TSAA 4XP6L 4ZUTB 2Y2XA 1XMEB 1O7SA 1ORQA 5F7EH 4XN2A 1T2XA 3K2UH 2MOVA 2E8YA 3VXOA 1KTLA 3AQYA 1JNNH 1T04A 5HI3C 5GSRB 3MUGB 5ICZA 1AGFA 2JLLA 1XTMA 4CC4A 4KMQA 3C5ZA 4N74A 1K85A 4RH4A 4K8RL 3VD2A 3SYAA 4GQ9L 1ZTXL 2LW3A 4AM0B 4HS3B 2H47C 3VXME 1YPZF 2IWWA 4XNUH 5JA9A 5C6TL 4KVNH 2DQMA 4JKPH 2NTFA 3BD4A 1IZNA 3EYFA 4NPYB 3E9TA 4IRZL 1Z3RA 3IJ8A 4CVWA 3FMGH 4L8DA 4C4BA 3QDGE 4KKBD 5FDWB 2LTQC 3C8HA 1JPEA 4ONFL