5TISO

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 46
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5tisO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5tisO02
5GTHO 3A0BO 5KAFO 5H2FO 5GTIO 3WU2O 2AXTO 3A0HO 5B5EO 3KZIO 4UB6O 4PJ0O 1S5LO 5G38A 4IL6O 3JCUO 5E79O 5B66O 5KAIO 5TISO 4UB8O 5G39A 5G3AA
chains in the Genus database with same CATH superfamily
4Z3TA 5GTHO 3RBHA 3AAAA 2R4NA 2KDYA 3LK3B 4N59A 3AA7A 2WJQA 1MPFA 2F1TA 2Y0KA 2Y2XA 2JMMA 5H2FO 4GCQA 2FGQX 5GTIO 7PRNA 3VY8X 4GF4A 3SYSA 2N2MA 3SY9A 4JFBA 4LSEA 3SY7A 4RLBA 2YPVA 3SZVA 2W80C 4F4BA 4FZNA 3AA6A 3PORA 4G75A 3VE2A 4C4VA 2FGRA 5AFUL 3T0SA 2KC0A 2W81C 1ZHTA 4UB6O 3UPGA 3LK41 5DL8A 2J4UP 1GFPA 2KXPB 1ZHXA 2R4PA 4IL6O 5FVNA 4AKMA 3DA3A 1MM4A 4FZMA 4U9CA 4RJWA 4XNKA 2Y0HA 1G90A 1MM5A 2X27X 1GFMA 3AA1A 5TISO 3PRNA 2MHLA 6PRNA 3T20A 4LSFA 2OMFA 4GCPA 2ZFGA 3WI4A 2WJRA 2N2LA 5JDPA 5KAFO 4KRAA 4FRXA 3WI5A 3A2SX 5AFUK 4KR8A 1OSMA 1H6S1 1IZNA 4LSHA 1HXTA 2ERVA 4FZLA 4QQ1A 2F1CX 1E54A 1HXUA 5EE2A 3HW9A 3UU2A 3HOEA 1THQA 2M06A 2ODJA 4AYDC 1BT9A 1YS5A 2KZ7B 1T1LA 2XE2A 3QRCA 3UAQA 8PRNA 1HXXA 4RL9A 1Q9GA 5B5EO 3C5OA 3AA7B 1GFQA 2ZLDA 5PRNA 4FMSA 2XTRA 1PHOA 5T5FA 3LK3A 1ZHYA 4N58A 1BH3A 4E1SA 4O3WA 4O3YA 3AA0B 4FESA 4FSOA 3VY9X 4G76A 1ZHWA 4GHBA 4C4VB 3AA6B 5B66O 4AYMC 4N75A 2XE1A 2R89A 3KVDD 5ADXL 4AUIA 1P4TA 4FSPA 4AYEC 2JQYA 4FRTA 3AAEB 4AYNA 3VE1A 3SZDA 2M07A 2R4LA 2QTKA 3BRYA 1QJ8A 2J1NA 3HWBA 4O4XA 4FT6A 3K19A 4KR4A 5DL5A 4JCHA 1GFOA 4BUMX 3LK2B 2KXPA 3WU2O 4D5UA 4FQEA 1ORMA 4AYID 3TZGA 3VZTX 4K3CA 2AXTO 3PQUA 3A0HO 3V8UA 3AAAB 3G7GA 4AKRA 2XE3A 4K3BA 4PJ0O 1IZNB 5DL7A 3GP6A 3PGRA 3SYBA 5D5DA 3T24A 1PRNA 3JCUO 3DWOX 3DWNA 3JTYA 4PR7A 1T16A 2IWWA 5KAIO 1OPFA 2X9KA 1GFNA 4UB8O 2KZ7A 5G39A 5G3AA 4AFKA 4B61A 5GV0A 5G26A 3FYXA 2R8AA 2XMXA 4RLCA 4LSIA 2YNKA 4XNLA 2MNHA 3PF1A 3AA0A 4D64A 4O3XB 4RJXA 1QJ9A 3BS0A 1BXWA 2PORA 2XTQA 3PGUA 2GE4A 2K0LA 3DA4A 3AA1B 2WVPA 4PUXA 4C69X 3NSGA 2IWVA 2XG6A 3PQSA 4FOZA 4AZLA 2R4OA 3POQA 4C00A 3EMNX 3HOLA 3O0EA 2F1VA 3KZIO 3NJTA 5DL6A 2LHFA 3LK42 5IYUA 4GCSA 3AAEA 4CTDA 3POUA 1QJPA 4E1TA 5ADXK 3DZMA 4O4UA 2PRNA 1S5LO 1ZHZA 2R88A 2Y0LA 4FUVA 4N74A 4O3ZA 5G38A 3LK2A 3POXA 3VZUX 5E79O 4O49A 2O4VA 3PGSA 3VZWX 2Y7SA 3BRZA 4D65A 2K4TA 3QRAA 4AKRB 2XE5A 3A0BO 2LFUA 1Q9FA
chains in the Genus database with same CATH topology
5GTHO 3A0BO 5KAFO 5H2FO 5GTIO 3WU2O 2AXTO 3A0HO 5B5EO 3KZIO 4UB6O 4PJ0O 1S5LO 5G38A 4IL6O 3JCUO 5E79O 5B66O 5KAIO 5TISO 4UB8O 5G39A 5G3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  3A0B O;  5KAF O;  5H2F O;  5GTI O;  3WU2 O;  2AXT O;  3A0H O;  5B5E O;  3KZI O;  4UB6 O;  4PJ0 O;  1S5L O;  5G38 A;  4IL6 O;  3JCU O;  5E79 O;  5B66 O;  5KAI O;  5TIS O;  4UB8 O;  5G39 A;  5G3A A; 
#chains in the Genus database with same CATH topology
 4Z3T A;  5GTH O;  3RBH A;  3AAA A;  2R4N A;  2KDY A;  3LK3 B;  4N59 A;  3AA7 A;  2WJQ A;  1MPF A;  2F1T A;  2Y0K A;  2Y2X A;  2JMM A;  5H2F O;  4GCQ A;  2FGQ X;  5GTI O;  7PRN A;  3VY8 X;  4GF4 A;  3SYS A;  2N2M A;  3SY9 A;  4JFB A;  4LSE A;  3SY7 A;  4RLB A;  2YPV A;  3SZV A;  2W80 C;  4F4B A;  4FZN A;  3AA6 A;  3POR A;  4G75 A;  3VE2 A;  4C4V A;  2FGR A;  5AFU L;  3T0S A;  2KC0 A;  2W81 C;  1ZHT A;  4UB6 O;  3UPG A;  3LK4 1;  5DL8 A;  2J4U P;  1GFP A;  2KXP B;  1ZHX A;  2R4P A;  4IL6 O;  5FVN A;  4AKM A;  3DA3 A;  1MM4 A;  4FZM A;  4U9C A;  4RJW A;  4XNK A;  2Y0H A;  1G90 A;  1MM5 A;  2X27 X;  1GFM A;  3AA1 A;  5TIS O;  3PRN A;  2MHL A;  6PRN A;  3T20 A;  4LSF A;  2OMF A;  4GCP A;  2ZFG A;  3WI4 A;  2WJR A;  2N2L A;  5JDP A;  5KAF O;  4KRA A;  4FRX A;  3WI5 A;  3A2S X;  5AFU K;  4KR8 A;  1OSM A;  1H6S 1;  1IZN A;  4LSH A;  1HXT A;  2ERV A;  4FZL A;  4QQ1 A;  2F1C X;  1E54 A;  1HXU A;  5EE2 A;  3HW9 A;  3UU2 A;  3HOE A;  1THQ A;  2M06 A;  2ODJ A;  4AYD C;  1BT9 A;  1YS5 A;  2KZ7 B;  1T1L A;  2XE2 A;  3QRC A;  3UAQ A;  8PRN A;  1HXX A;  4RL9 A;  1Q9G A;  5B5E O;  3C5O A;  3AA7 B;  1GFQ A;  2ZLD A;  5PRN A;  4FMS A;  2XTR A;  1PHO A;  5T5F A;  3LK3 A;  1ZHY A;  4N58 A;  1BH3 A;  4E1S A;  4O3W A;  4O3Y A;  3AA0 B;  4FES A;  4FSO A;  3VY9 X;  4G76 A;  1ZHW A;  4GHB A;  4C4V B;  3AA6 B;  5B66 O;  4AYM C;  4N75 A;  2XE1 A;  2R89 A;  3KVD D;  5ADX L;  4AUI A;  1P4T A;  4FSP A;  4AYE C;  2JQY A;  4FRT A;  3AAE B;  4AYN A;  3VE1 A;  3SZD A;  2M07 A;  2R4L A;  2QTK A;  3BRY A;  1QJ8 A;  2J1N A;  3HWB A;  4O4X A;  4FT6 A;  3K19 A;  4KR4 A;  5DL5 A;  4JCH A;  1GFO A;  4BUM X;  3LK2 B;  2KXP A;  3WU2 O;  4D5U A;  4FQE A;  1ORM A;  4AYI D;  3TZG A;  3VZT X;  4K3C A;  2AXT O;  3PQU A;  3A0H O;  3V8U A;  3AAA B;  3G7G A;  4AKR A;  2XE3 A;  4K3B A;  4PJ0 O;  1IZN B;  5DL7 A;  3GP6 A;  3PGR A;  3SYB A;  5D5D A;  3T24 A;  1PRN A;  3JCU O;  3DWO X;  3DWN A;  3JTY A;  4PR7 A;  1T16 A;  2IWW A;  5KAI O;  1OPF A;  2X9K A;  1GFN A;  4UB8 O;  2KZ7 A;  5G39 A;  5G3A A;  4AFK A;  4B61 A;  5GV0 A;  5G26 A;  3FYX A;  2R8A A;  2XMX A;  4RLC A;  4LSI A;  2YNK A;  4XNL A;  2MNH A;  3PF1 A;  3AA0 A;  4D64 A;  4O3X B;  4RJX A;  1QJ9 A;  3BS0 A;  1BXW A;  2POR A;  2XTQ A;  3PGU A;  2GE4 A;  2K0L A;  3DA4 A;  3AA1 B;  2WVP A;  4PUX A;  4C69 X;  3NSG A;  2IWV A;  2XG6 A;  3PQS A;  4FOZ A;  4AZL A;  2R4O A;  3POQ A;  4C00 A;  3EMN X;  3HOL A;  3O0E A;  2F1V A;  3KZI O;  3NJT A;  5DL6 A;  2LHF A;  3LK4 2;  5IYU A;  4GCS A;  3AAE A;  4CTD A;  3POU A;  1QJP A;  4E1T A;  5ADX K;  3DZM A;  4O4U A;  2PRN A;  1S5L O;  1ZHZ A;  2R88 A;  2Y0L A;  4FUV A;  4N74 A;  4O3Z A;  5G38 A;  3LK2 A;  3POX A;  3VZU X;  5E79 O;  4O49 A;  2O4V A;  3PGS A;  3VZW X;  2Y7S A;  3BRZ A;  4D65 A;  2K4T A;  3QRA A;  4AKR B;  2XE5 A;  3A0B O;  2LFU A;  1Q9F A; 
#chains in the Genus database with same CATH homology
 5GTH O;  3A0B O;  5KAF O;  5H2F O;  5GTI O;  3WU2 O;  2AXT O;  3A0H O;  5B5E O;  3KZI O;  4UB6 O;  4PJ0 O;  1S5L O;  5G38 A;  4IL6 O;  3JCU O;  5E79 O;  5B66 O;  5KAI O;  5TIS O;  4UB8 O;  5G39 A;  5G3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...