5TISO

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 46
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5tisO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5tisO02
5KAFO 4UB6O 5GTHO 3A0BO 1S5LO 4UB8O 4PJ0O 5GTIO 5G38A 4IL6O 3WU2O 5TISO 3JCUO 5B66O 5E79O 5G3AA 5B5EO 3A0HO 3KZIO 2AXTO 5G39A 5H2FO 5KAIO
chains in the Genus database with same CATH superfamily
2K0LA 4KR8A 4N74A 5EE2A 3SY7A 7PRNA 3PGSA 4GF4A 4FRTA 4AYID 2R4OA 2R4NA 2QTKA 2XG6A 3QRAA 4LSFA 4FQEA 4U9CA 3JTYA 2XE5A 4GCQA 3WU2O 2X27X 3PF1A 4FT6A 6PRNA 3DWOX 4K3CA 3BRZA 2KXPA 3RBHA 5TISO 3VY8X 4FZLA 4RLCA 2YNKA 1BXWA 1OPFA 3DA3A 2XE3A 1ORMA 3NSGA 4N59A 4KR4A 4QQ1A 2K4TA 2MHLA 4KRAA 3VZWX 5AFUK 1OSMA 4E1SA 4N75A 3AA6A 3POXA 4FZMA 3UU2A 2KZ7B 3WI4A 3POQA 3UPGA 1ZHZA 4PUXA 1PRNA 1THQA 2WJRA 4Z3TA 4F4BA 3A0HO 3AA1A 4O4XA 3O0EA 2F1VA 4E1TA 4LSIA 4FSOA 2LHFA 5H2FO 4C00A 2XMXA 3AA1B 5D5DA 5JDPA 4UB6O 2N2LA 1HXXA 2F1TA 3EMNX 2R4PA 1QJ8A 2W80C 3PQSA 4AFKA 2ODJA 4C4VA 5T5FA 1GFMA 1BH3A 1PHOA 1GFNA 2R89A 4C4VB 5DL5A 1IZNA 4RJXA 5DL6A 2ZFGA 4RL9A 2OMFA 3LK3A 3PGRA 4C69X 4BUMX 2YPVA 3VZUX 2R88A 4B61A 4FUVA 5AFUL 1G90A 3LK3B 3C5OA 4GHBA 4O3WA 1ZHXA 2KXPB 4O3ZA 2R8AA 4XNKA 2Y7SA 4AKMA 1GFPA 2F1CX 4RLBA 3T0SA 5G3AA 5ADXK 1Q9GA 1ZHYA 2JQYA 3SYBA 3AA6B 1Q9FA 1QJ9A 2ZLDA 3AAAA 3V8UA 1T16A 2WJQA 4FSPA 5GTHO 2JMMA 3AAAB 3A0BO 3A2SX 3DA4A 4FOZA 3POUA 1ZHWA 3TZGA 4D65A 3PQUA 2FGQX 4UB8O 4G75A 4PJ0O 3FYXA 3LK42 4FZNA 2KC0A 4AKRA 2PORA 2XTQA 2J1NA 2M07A 3LK41 3QRCA 5DL7A 3T24A 3SZVA 1H6S1 4AYDC 3AA7A 4XNLA 3BRYA 5G38A 4AKRB 2Y0KA 1P4TA 4N58A 3VY9X 8PRNA 2IWWA 4RJWA 3VE1A 4JFBA 1GFOA 3AA7B 2Y2XA 3JCUO 3PGUA 4GCSA 3T20A 2Y0HA 3SY9A 2W81C 1IZNB 2LFUA 3NJTA 3HW9A 4FRXA 5PRNA 3GP6A 4GCPA 4AUIA 3AAEA 3KVDD 4AYEC 4K3BA 4D5UA 5ADXL 2FGRA 4JCHA 2WVPA 2XTRA 1T1LA 2M06A 3G7GA 3AAEB 3KZIO 2AXTO 5G39A 3WI5A 5KAIO 2ERVA 4LSHA 2N2MA 5KAFO 1GFQA 4AYMC 2R4LA 3LK2A 4D64A 1S5LO 2IWVA 2XE1A 2X9KA 3AA0B 3DZMA 3LK2B 4FMSA 4FESA 5GTIO 4AYNA 1HXUA 3VZTX 2KDYA 1YS5A 2MNHA 2Y0LA 3PORA 5IYUA 4IL6O 1QJPA 3UAQA 4AZLA 3HOEA 5FVNA 1MPFA 2KZ7A 4O4UA 1MM4A 2O4VA 4G76A 3SZDA 3DWNA 4CTDA 5B66O 2J4UP 2PRNA 3HOLA 1HXTA 4O3XB 4O3YA 5E79O 3VE2A 1E54A 4O49A 2XE2A 5G26A 5B5EO 3BS0A 5GV0A 3K19A 3AA0A 1ZHTA 3SYSA 4LSEA 1BT9A 5DL8A 3PRNA 3HWBA 4PR7A 2GE4A 1MM5A
chains in the Genus database with same CATH topology
5KAFO 4UB6O 5GTHO 3A0BO 1S5LO 4UB8O 4PJ0O 5GTIO 5G38A 4IL6O 3WU2O 5TISO 3JCUO 5B66O 5E79O 5G3AA 5B5EO 3A0HO 3KZIO 2AXTO 5G39A 5H2FO 5KAIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF O;  4UB6 O;  5GTH O;  3A0B O;  1S5L O;  4UB8 O;  4PJ0 O;  5GTI O;  5G38 A;  4IL6 O;  3WU2 O;  5TIS O;  3JCU O;  5B66 O;  5E79 O;  5G3A A;  5B5E O;  3A0H O;  3KZI O;  2AXT O;  5G39 A;  5H2F O;  5KAI O; 
#chains in the Genus database with same CATH topology
 2K0L A;  4KR8 A;  4N74 A;  5EE2 A;  3SY7 A;  7PRN A;  3PGS A;  4GF4 A;  4FRT A;  4AYI D;  2R4O A;  2R4N A;  2QTK A;  2XG6 A;  3QRA A;  4LSF A;  4FQE A;  4U9C A;  3JTY A;  2XE5 A;  4GCQ A;  3WU2 O;  2X27 X;  3PF1 A;  4FT6 A;  6PRN A;  3DWO X;  4K3C A;  3BRZ A;  2KXP A;  3RBH A;  5TIS O;  3VY8 X;  4FZL A;  4RLC A;  2YNK A;  1BXW A;  1OPF A;  3DA3 A;  2XE3 A;  1ORM A;  3NSG A;  4N59 A;  4KR4 A;  4QQ1 A;  2K4T A;  2MHL A;  4KRA A;  3VZW X;  5AFU K;  1OSM A;  4E1S A;  4N75 A;  3AA6 A;  3POX A;  4FZM A;  3UU2 A;  2KZ7 B;  3WI4 A;  3POQ A;  3UPG A;  1ZHZ A;  4PUX A;  1PRN A;  1THQ A;  2WJR A;  4Z3T A;  4F4B A;  3A0H O;  3AA1 A;  4O4X A;  3O0E A;  2F1V A;  4E1T A;  4LSI A;  4FSO A;  2LHF A;  5H2F O;  4C00 A;  2XMX A;  3AA1 B;  5D5D A;  5JDP A;  4UB6 O;  2N2L A;  1HXX A;  2F1T A;  3EMN X;  2R4P A;  1QJ8 A;  2W80 C;  3PQS A;  4AFK A;  2ODJ A;  4C4V A;  5T5F A;  1GFM A;  1BH3 A;  1PHO A;  1GFN A;  2R89 A;  4C4V B;  5DL5 A;  1IZN A;  4RJX A;  5DL6 A;  2ZFG A;  4RL9 A;  2OMF A;  3LK3 A;  3PGR A;  4C69 X;  4BUM X;  2YPV A;  3VZU X;  2R88 A;  4B61 A;  4FUV A;  5AFU L;  1G90 A;  3LK3 B;  3C5O A;  4GHB A;  4O3W A;  1ZHX A;  2KXP B;  4O3Z A;  2R8A A;  4XNK A;  2Y7S A;  4AKM A;  1GFP A;  2F1C X;  4RLB A;  3T0S A;  5G3A A;  5ADX K;  1Q9G A;  1ZHY A;  2JQY A;  3SYB A;  3AA6 B;  1Q9F A;  1QJ9 A;  2ZLD A;  3AAA A;  3V8U A;  1T16 A;  2WJQ A;  4FSP A;  5GTH O;  2JMM A;  3AAA B;  3A0B O;  3A2S X;  3DA4 A;  4FOZ A;  3POU A;  1ZHW A;  3TZG A;  4D65 A;  3PQU A;  2FGQ X;  4UB8 O;  4G75 A;  4PJ0 O;  3FYX A;  3LK4 2;  4FZN A;  2KC0 A;  4AKR A;  2POR A;  2XTQ A;  2J1N A;  2M07 A;  3LK4 1;  3QRC A;  5DL7 A;  3T24 A;  3SZV A;  1H6S 1;  4AYD C;  3AA7 A;  4XNL A;  3BRY A;  5G38 A;  4AKR B;  2Y0K A;  1P4T A;  4N58 A;  3VY9 X;  8PRN A;  2IWW A;  4RJW A;  3VE1 A;  4JFB A;  1GFO A;  3AA7 B;  2Y2X A;  3JCU O;  3PGU A;  4GCS A;  3T20 A;  2Y0H A;  3SY9 A;  2W81 C;  1IZN B;  2LFU A;  3NJT A;  3HW9 A;  4FRX A;  5PRN A;  3GP6 A;  4GCP A;  4AUI A;  3AAE A;  3KVD D;  4AYE C;  4K3B A;  4D5U A;  5ADX L;  2FGR A;  4JCH A;  2WVP A;  2XTR A;  1T1L A;  2M06 A;  3G7G A;  3AAE B;  3KZI O;  2AXT O;  5G39 A;  3WI5 A;  5KAI O;  2ERV A;  4LSH A;  2N2M A;  5KAF O;  1GFQ A;  4AYM C;  2R4L A;  3LK2 A;  4D64 A;  1S5L O;  2IWV A;  2XE1 A;  2X9K A;  3AA0 B;  3DZM A;  3LK2 B;  4FMS A;  4FES A;  5GTI O;  4AYN A;  1HXU A;  3VZT X;  2KDY A;  1YS5 A;  2MNH A;  2Y0L A;  3POR A;  5IYU A;  4IL6 O;  1QJP A;  3UAQ A;  4AZL A;  3HOE A;  5FVN A;  1MPF A;  2KZ7 A;  4O4U A;  1MM4 A;  2O4V A;  4G76 A;  3SZD A;  3DWN A;  4CTD A;  5B66 O;  2J4U P;  2PRN A;  3HOL A;  1HXT A;  4O3X B;  4O3Y A;  5E79 O;  3VE2 A;  1E54 A;  4O49 A;  2XE2 A;  5G26 A;  5B5E O;  3BS0 A;  5GV0 A;  3K19 A;  3AA0 A;  1ZHT A;  3SYS A;  4LSE A;  1BT9 A;  5DL8 A;  3PRN A;  3HWB A;  4PR7 A;  2GE4 A;  1MM5 A; 
#chains in the Genus database with same CATH homology
 5KAF O;  4UB6 O;  5GTH O;  3A0B O;  1S5L O;  4UB8 O;  4PJ0 O;  5GTI O;  5G38 A;  4IL6 O;  3WU2 O;  5TIS O;  3JCU O;  5B66 O;  5E79 O;  5G3A A;  5B5E O;  3A0H O;  3KZI O;  2AXT O;  5G39 A;  5H2F O;  5KAI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...