5TISO

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 46
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5tisO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5tisO02
3KZIO 3JCUO 5TISO 5G38A 4UB6O 4IL6O 4PJ0O 5GTIO 3A0HO 5KAFO 3A0BO 4UB8O 2AXTO 5E79O 5G3AA 1S5LO 3WU2O 5GTHO 5B5EO 5H2FO 5KAIO 5G39A 5B66O
chains in the Genus database with same CATH superfamily
2R4OA 2ERVA 3JCUO 1E54A 1OPFA 3PRNA 1GFQA 1MM5A 1Q9FA 3EMNX 4FZNA 3AA0A 4FUVA 1GFOA 2GE4A 3K19A 2LHFA 3DA4A 5G26A 3T24A 2KDYA 4AKMA 4F4BA 4AYDC 5EE2A 3VE2A 4D64A 3PQUA 4JFBA 3PGUA 1GFMA 4O4XA 4RLBA 2IWVA 3C5OA 2J4UP 4LSHA 1MM4A 3SZDA 1QJ8A 1T16A 2PRNA 4AKRB 4UB8O 2R4PA 1H6S1 2O4VA 2N2MA 4XNLA 3TZGA 4C4VB 3T20A 3UU2A 3POUA 3WU2O 4BUMX 4C00A 5GTHO 2K0LA 3A2SX 1HXXA 4O49A 3NSGA 2XE2A 5KAIO 5FVNA 1QJ9A 3AAAA 4B61A 3AA6B 1ZHXA 2XTRA 5B66O 2W81C 2XMXA 3O0EA 1ZHZA 3VE1A 1BXWA 1T1LA 2YPVA 3DA3A 4N75A 4PR7A 5G38A 4LSIA 3AA0B 2F1CX 3LK2B 2ZFGA 4RJWA 1PHOA 3PGRA 3UAQA 3LK42 3VZTX 2YNKA 3KVDD 4RLCA 1YS5A 2J1NA 2R89A 1GFPA 2Y0KA 4GF4A 4JCHA 1OSMA 4AYMC 1QJPA 7PRNA 3SZVA 4AKRA 3G7GA 3LK3A 3PQSA 3HOEA 1BT9A 3WI5A 1IZNB 5G3AA 4FT6A 1PRNA 3UPGA 2X27X 4LSFA 3SY7A 1S5LO 5T5FA 4C69X 3AA7A 4FZMA 3AAEA 1ORMA 4GCSA 4RL9A 3FYXA 3HOLA 5B5EO 5IYUA 2Y0LA 2R4LA 2XE5A 2Y2XA 4G75A 1P4TA 3AAAB 3SYSA 4K3CA 5D5DA 3SY9A 5GV0A 2FGRA 2F1VA 2R8AA 3AA1B 3POXA 2W80C 3GP6A 2ODJA 4AYNA 1ZHTA 3POQA 4PJ0O 3VZUX 2IWWA 3T0SA 4AZLA 1HXTA 3PGSA 3HW9A 4RJXA 4U9CA 5GTIO 3DWOX 4FESA 4FMSA 4FSOA 6PRNA 2M07A 4N74A 2R88A 5AFUL 4GCPA 3VZWX 4C4VA 3LK3B 2AXTO 2PORA 3AA1A 3V8UA 4FSPA 4E1SA 3SYBA 4AUIA 3AA7B 4FRTA 2R4NA 4D5UA 2KXPA 5H2FO 4N59A 2WJQA 3DWNA 4Z3TA 4O3XB 2JQYA 3BRYA 1Q9GA 3AA6A 8PRNA 3JTYA 4E1TA 2MHLA 3BS0A 5ADXL 2F1TA 4N58A 4O4UA 2KZ7A 3KZIO 4KR8A 4FOZA 4D65A 4K3BA 1MPFA 3QRAA 5PRNA 3LK2A 4FRXA 1BH3A 1GFNA 2JMMA 1ZHWA 2MNHA 2WVPA 2XE3A 4LSEA 4IL6O 4GHBA 2XTQA 4G76A 4KR4A 4O3ZA 4UB6O 4O3YA 1G90A 5JDPA 2N2LA 2WJRA 5AFUK 3NJTA 5DL5A 3A0HO 3PF1A 1HXUA 4FQEA 4PUXA 3RBHA 4AYEC 4CTDA 2OMFA 2M06A 3A0BO 5DL8A 5KAFO 1THQA 3LK41 2FGQX 2K4TA 4FZLA 1IZNA 5DL7A 2XE1A 5E79O 3VY9X 3BRZA 2KC0A 4AFKA 2X9KA 2Y7SA 2LFUA 2QTKA 2KXPB 4KRAA 4QQ1A 4XNKA 3WI4A 3AAEB 2Y0HA 3HWBA 5ADXK 5TISO 3PORA 3QRCA 3VY8X 4GCQA 4O3WA 3DZMA 1ZHYA 2XG6A 5G39A 2ZLDA 5DL6A 4AYID 2KZ7B
chains in the Genus database with same CATH topology
3KZIO 3JCUO 5TISO 5G38A 4UB6O 4IL6O 4PJ0O 5GTIO 3A0HO 5KAFO 3A0BO 4UB8O 2AXTO 5E79O 5G3AA 1S5LO 3WU2O 5GTHO 5B5EO 5H2FO 5KAIO 5G39A 5B66O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI O;  3JCU O;  5TIS O;  5G38 A;  4UB6 O;  4IL6 O;  4PJ0 O;  5GTI O;  3A0H O;  5KAF O;  3A0B O;  4UB8 O;  2AXT O;  5E79 O;  5G3A A;  1S5L O;  3WU2 O;  5GTH O;  5B5E O;  5H2F O;  5KAI O;  5G39 A;  5B66 O; 
#chains in the Genus database with same CATH topology
 2R4O A;  2ERV A;  3JCU O;  1E54 A;  1OPF A;  3PRN A;  1GFQ A;  1MM5 A;  1Q9F A;  3EMN X;  4FZN A;  3AA0 A;  4FUV A;  1GFO A;  2GE4 A;  3K19 A;  2LHF A;  3DA4 A;  5G26 A;  3T24 A;  2KDY A;  4AKM A;  4F4B A;  4AYD C;  5EE2 A;  3VE2 A;  4D64 A;  3PQU A;  4JFB A;  3PGU A;  1GFM A;  4O4X A;  4RLB A;  2IWV A;  3C5O A;  2J4U P;  4LSH A;  1MM4 A;  3SZD A;  1QJ8 A;  1T16 A;  2PRN A;  4AKR B;  4UB8 O;  2R4P A;  1H6S 1;  2O4V A;  2N2M A;  4XNL A;  3TZG A;  4C4V B;  3T20 A;  3UU2 A;  3POU A;  3WU2 O;  4BUM X;  4C00 A;  5GTH O;  2K0L A;  3A2S X;  1HXX A;  4O49 A;  3NSG A;  2XE2 A;  5KAI O;  5FVN A;  1QJ9 A;  3AAA A;  4B61 A;  3AA6 B;  1ZHX A;  2XTR A;  5B66 O;  2W81 C;  2XMX A;  3O0E A;  1ZHZ A;  3VE1 A;  1BXW A;  1T1L A;  2YPV A;  3DA3 A;  4N75 A;  4PR7 A;  5G38 A;  4LSI A;  3AA0 B;  2F1C X;  3LK2 B;  2ZFG A;  4RJW A;  1PHO A;  3PGR A;  3UAQ A;  3LK4 2;  3VZT X;  2YNK A;  3KVD D;  4RLC A;  1YS5 A;  2J1N A;  2R89 A;  1GFP A;  2Y0K A;  4GF4 A;  4JCH A;  1OSM A;  4AYM C;  1QJP A;  7PRN A;  3SZV A;  4AKR A;  3G7G A;  3LK3 A;  3PQS A;  3HOE A;  1BT9 A;  3WI5 A;  1IZN B;  5G3A A;  4FT6 A;  1PRN A;  3UPG A;  2X27 X;  4LSF A;  3SY7 A;  1S5L O;  5T5F A;  4C69 X;  3AA7 A;  4FZM A;  3AAE A;  1ORM A;  4GCS A;  4RL9 A;  3FYX A;  3HOL A;  5B5E O;  5IYU A;  2Y0L A;  2R4L A;  2XE5 A;  2Y2X A;  4G75 A;  1P4T A;  3AAA B;  3SYS A;  4K3C A;  5D5D A;  3SY9 A;  5GV0 A;  2FGR A;  2F1V A;  2R8A A;  3AA1 B;  3POX A;  2W80 C;  3GP6 A;  2ODJ A;  4AYN A;  1ZHT A;  3POQ A;  4PJ0 O;  3VZU X;  2IWW A;  3T0S A;  4AZL A;  1HXT A;  3PGS A;  3HW9 A;  4RJX A;  4U9C A;  5GTI O;  3DWO X;  4FES A;  4FMS A;  4FSO A;  6PRN A;  2M07 A;  4N74 A;  2R88 A;  5AFU L;  4GCP A;  3VZW X;  4C4V A;  3LK3 B;  2AXT O;  2POR A;  3AA1 A;  3V8U A;  4FSP A;  4E1S A;  3SYB A;  4AUI A;  3AA7 B;  4FRT A;  2R4N A;  4D5U A;  2KXP A;  5H2F O;  4N59 A;  2WJQ A;  3DWN A;  4Z3T A;  4O3X B;  2JQY A;  3BRY A;  1Q9G A;  3AA6 A;  8PRN A;  3JTY A;  4E1T A;  2MHL A;  3BS0 A;  5ADX L;  2F1T A;  4N58 A;  4O4U A;  2KZ7 A;  3KZI O;  4KR8 A;  4FOZ A;  4D65 A;  4K3B A;  1MPF A;  3QRA A;  5PRN A;  3LK2 A;  4FRX A;  1BH3 A;  1GFN A;  2JMM A;  1ZHW A;  2MNH A;  2WVP A;  2XE3 A;  4LSE A;  4IL6 O;  4GHB A;  2XTQ A;  4G76 A;  4KR4 A;  4O3Z A;  4UB6 O;  4O3Y A;  1G90 A;  5JDP A;  2N2L A;  2WJR A;  5AFU K;  3NJT A;  5DL5 A;  3A0H O;  3PF1 A;  1HXU A;  4FQE A;  4PUX A;  3RBH A;  4AYE C;  4CTD A;  2OMF A;  2M06 A;  3A0B O;  5DL8 A;  5KAF O;  1THQ A;  3LK4 1;  2FGQ X;  2K4T A;  4FZL A;  1IZN A;  5DL7 A;  2XE1 A;  5E79 O;  3VY9 X;  3BRZ A;  2KC0 A;  4AFK A;  2X9K A;  2Y7S A;  2LFU A;  2QTK A;  2KXP B;  4KRA A;  4QQ1 A;  4XNK A;  3WI4 A;  3AAE B;  2Y0H A;  3HWB A;  5ADX K;  5TIS O;  3POR A;  3QRC A;  3VY8 X;  4GCQ A;  4O3W A;  3DZM A;  1ZHY A;  2XG6 A;  5G39 A;  2ZLD A;  5DL6 A;  4AYI D;  2KZ7 B; 
#chains in the Genus database with same CATH homology
 3KZI O;  3JCU O;  5TIS O;  5G38 A;  4UB6 O;  4IL6 O;  4PJ0 O;  5GTI O;  3A0H O;  5KAF O;  3A0B O;  4UB8 O;  2AXT O;  5E79 O;  5G3A A;  1S5L O;  3WU2 O;  5GTH O;  5B5E O;  5H2F O;  5KAI O;  5G39 A;  5B66 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...