1IZNB

Crystal structure of actin filament capping protein capz
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CapZ: structural basis for actin filament barbed end capping
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords CapZ alpha-1 subunit
total genus 88
structure length 270
sequence length 270
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 1iznB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1iznB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 1iznB02
3AAAA 3AA1B 3AAAB 4AKRA 1IZNB 3LK2B 3LK3B 3AAEA 3AA7B 3LK42 5ADXL 5AFUL 1IZNA 3AA6B 3AA7A 3LK41 3AA0B 3LK3A 3AA6A 2KZ7B 5AFUK 5ADXK 4AKRB 2KZ7A 3AA1A 3AAEB 2KXPB 3AA0A 2KXPA 3LK2A
chains in the Genus database with same CATH superfamily
1GW3A 2E75B 5HYAA 4H63H 2ZXEB 3LK2B 3L36A 4H9PC 3IFMA 4ISTA 2BG9B 4C4VA 5JR9B 4BUMX 2XAGB 4UVAB 5AFUL 2D2CB 4I1LA 2XSBA 3GN5A 3I0OA 5JDLA 1I94T 5APSA 4NUVA 1SQXE 4CXWA 4O9BA 1K9MQ 2M6BA 2VL8A 5CFBA 1VF5B 1GL2A 3V4QA 3ZMTB 4GOFA 3A0HE 4IGUA 4YHJA 1FZEA 4WNKA 2W4XA 3TLWA 3PRNA 2E75D 3LDQB 2N1TC 2UWJE 1NHLA 2XE5A 1PP9D 5B66O 2A06E 3RQWA 3N9PA 4P1NA 3LK42 1GMJA 3NJTA 2ZAEB 2RPAA 1W2EA 3RK3E 5AQLB 3IAOA 4A7PA 1OEDA 3AE4C 4TWHA 3HUSB 3UU4A 5TAOA 3NSGA 3H1KG 1HJBA 4B3ST 2OYHB 4CN4A 4IT4A 3GWHA 4P0AA 3PUGA 3NBXX 2YDQA 1X8YA 5LJNA 3F2EA 3T97A 5CCGA 4RJWA 4JPZB 3RBXA 2ODJA 2ACXA 3MZKB 1M7LA 1PGJA 4NPDA 3G06A 1FZCA 3CXHI 1PZQA 3H1LG 1FEWA 2CM0A 1T2KC 2XU6A 2CK3H 3CWZB 4YHHT 3RC3A 2M5AA 4YXWH 3O9XA 4C69X 3A8YC 3CMEP 2ZJSE 3Q5PA 4ZI2C 1P4TA 4O3XB 5LYJE 3TNUA 1P84I 2X0LB 1KYOD 4IDPA 3L75J 3CLQA 3P32A 1OXZA 4U7IA 2Q9QB 1Q82Q 1H88A 2IDOB 2FYUD 1FBMA 3SY7A 3VP9A 2VK9A 1MMNA 1KB9I 1YQ3C 4L76A 5B5EH 5LJMA 3AE6A 2R4OA 3G3ZA 2W8ZA 3RI5A 3PLNA 1DH3A 2LSKA 3M91A 2FXMA 5E0OA 3ONJA 3RK3B 2WP9A 1IK7A 2FJBA 1NU1J 2FJEA 1BE3E 2KDYA 5M1BA 4TUYE 3E0ZA 3HD7A 4O3YA 2W90A 3GG2A 3CCVP 4AYDC 2P2UA 2YMKA 2N9BA 3QK6A 2XTLA 2UXXB 2NTXA 3UQ4A 3AEBC 2ZLDA 1B7TA 3AAAB 2Q1KA 1T8BA 1DU2A 3CX5E 3SS1A 3AAEA 3C8VA 2NZ2A 1BE3D 5GTIH 4TV9E 2FBWA 2O1KA 1AV1A 4MN4C 1RF1B 4FESA 5FXVA 4I4TE 4WB4A 1L0NE 4HE8A 4EAHA 3PQSA 4ILCA 4AQFC 2B87B 1FOSE 2P58A 1LT9C 1E5WA 5GTHH 3L72E 4XBFB 1HX8A 1GFMA 5FVLA 1URQB 3L09A 3KDPB 4FZLA 4F4BA 2V7KA 4O49A 5CCHA 3LIEA 1QX8A 3L74E 3ABVC 2B89A 1W2BO 2K3WA 2JDIH 2V5CA 2E8IA 1U7JA 3AE9C 3PUVF 1JY2P 2XASB 4XAXB 3MZWB 4C90A 1BR4A 4QX8B 1N86A 1E7PA 4EGWA 3WI3A 2QG4A 1ZW0A 4K3CA 5TJHA 2XQAA 1HNXT 1NKZB 3TLUA 4DCKA 4GODA 4YXDC 1HBWA 3JC6D 4DR5T 1GK4A 2V7MA 3ETUA 3AE5A 4E7ZA 4ZI3D 3N9NA 3GP6A 2LM2A 2XDJA 3HA4A 1KNZA 2JMKA 3L74G 4Z1MH 2PRNA 1NU1G 1HGZA 3ZC0A 4U3CA 2E5YA 1L4AB 3KZIO 1KTMA 5L3BB 5L3DB 2VRSA 3CWBG 5C39A 5HWXA 3O4XE 2XE3A 3IF4A 1IC2A 5AQQB 3L37A 2NRGA 1YJWP 1JNRA 3AEDA 5E79O 1RE3A 4C91A 2HN2A 3A0BE 2K9JB 3OW2O 5T5FA 4JI4T 1CHUA 2JWAA 4AYMC 2R88A 4JQ0D 5KKZB 3KFWX 4YSZA 2ZYDA 4JUYA 3BRVB 3PUZF 1D1CA 4YLHA 2UXDT 1JY2N 4G76A 4ZNCA 2LOPA 1N2DC 4DUZT 3CWBE 5KLVK 4GCSA 3RYCE 3H1IE 3L35A 3L71E 4LFBT 3OJAA 1QVGO 3LBXB 3LG7A 4YSYA 5LXTE 3C5OA 1IBLT 3S9OA 5PRNA 3BQLA 1IFDA 1JTHB 3FXEA 1ZKEA 5KLIB 4DV4T 2DHRA 1NWQA 4LF5T 3OPCA 1ZHXA 1YHQP 2IAKA 4D6TE 4XNLA 2NPSC 1L4AD 2KOGA 1A02J 3HOEA 1GZLA 4KHPT 4PAGA 2Z6EA 2LSIA 1H0TB 1Y64B 2IFMA 4OH8B 4IL6X 4AYCA 4DJGA 4GK0E 4N58A 1KEYA 1JM0A 2DWGA 3JAFA 1SQQD 3KYQA 4UR9A 4LMKA 3C98B 2VL0A 4B6XA 3QRAA 2F1TA 1FC2C 2EHOC 1LWUB 4AQRD 4HYTB 1HF9A 3CIRA 4UVCB 4AQYT 2XE1A 2YXQB 1WRGA 5KX5E 1IZNB 1NU1K 2K9YA 2P1JA 2GA1A 3F89A 4KUMB 5IYZE 1GFPA 4KX6A 3T0SA 4ZI7E 1GL2D 1KQFB 1SQPE 1KV4A 3T1YT 4B3MT 2X0HA 4C7NB 4GYSA 2P67A 1Q86Q 3Q2MA 4QHOA 4E1TA 2Y9ZA 1IK9A 3GLMA 1S5LH 4UIGA 3A7MA 4EXTA 1S5LX 4DNDA 2Y0HA 5AQHB 3V2QA 3ZC1A 5CMZA 2NPSD 5BVZA 3FYXA 2HODA 4MALA 3QRCA 3B5ND 2FYUJ 3T8OA 3PV0F 4N74A 1M7KA 4PV1B 1MMDA 2QTKA 2ZFCA 1YIJP 1W5CE 5CCGD 3TKLB 3FBLA 1W9RA 2K48A 3NRYA 4GOUA 2M06A 1H8AA 1SQVK 4Z90A 5AVSB 2JR8A 3KV5A 3II6A 1EZVI 4LF4T 2Z5HA 2KNCA 4D6TG 3V2PA 5LA6E 5C2TA 1VCSA 3ZDMA 1HH0A 1SUMB 1WYCA 3K1SA 4HGAA 1ZR2A 4LFCT 3PUWF 1BCCD 3CMAP 1BDCA 2ZMAA 4PR7A 1IFPA 4GYRA 3POUA 3L75G 4GOEA 4YY3T 4JEHB 1RF1A 4LLHA 1ZHZA 1GD2E 2FY8A 2ZVOB 3A5XA 3VR8A 2CXFA 3RBHA 3VMXA 4DV5T 1S9KD 1G73A 4GDOA 4XZCA 2RMZA 1JY2O 3HW9A 3VRAA 5AQKB 2X27X 4QH1A 2NW8A 3M06A 2WU5A 4FZMA 1YTZT 3H1HJ 1IJDB 2HHHT 2K5BB 4I6MC 4BXLA 3HKDE 4QH4A 5APWA 3CCRP 1EZVE 4AYID 5CCGC 1DIPA 1MIYA 2YNKA 5HWYA 4O4LE 4KR8A 2FYNC 5HCJA 2XNXA 5B66H 4LF6T 1HXUA 1Q9GA 2N9YB 5TISO 3OBVE 2HN1A 2PFVA 2KZ7B 3CQXC 3HD7C 4UB8H 5LGUB 4JI0T 3ESLA 1LT9B 2H8PD 2WT7A 1QVFO 5L3GB 2V7IA 2DI4A 2E74D 3EHZA 1MFZA 2RKLA 5HXCA 1FDMA 2WDRA 1W0BA 2HYNA 3U1AA 2XM1A 5FL1A 3FB2A 2R5BA 3TYYA 4E7SA 2LT3A 1SQPJ 3HR0A 1NTKE 3R4YA 1AJ3A 8PRNA 3KV9A 4EOZB 2QJKB 1DD4A 2Y0KA 2WBLA 4U9CA 3FZKB 3KBUA 3CL3D 1QJ8A 4OGQD 2Q5UA 1SQQK 3SSUA 4JYAT 1NTZK 3RGUA 4XFJA 3H6PA 1YI2P 3P7IA 3T97B 1NENA 3AE8C 2VWAA 2E9XC 1SS1A 2BBJA 5GTIE 5CCHC 4X1YE 3M0AA 5DL8A 2P10A 1BR0A 1T3UA 3EQ2A 5BU8B 3L75E 4OFZA 4ZHQE 2CHOA 2OYOA 2X0YA 4V1Av 2XMXA 4AI6A 2IYOA 3FXDB 3GHGB 1SQBD 2OTLP 5L47A 1WMKA 4U3FE 2LRKA 1RQUA 2WSFJ 2CMRA 3ETVA 4H44B 4LFAT 3PUSA 1U7MA 3MUDA 3VRBA 1BCCJ 4O4IE 2KZJA 4IFMA 4UB6E 1XDOA 2PRRA 4X62T 4FT6A 3SFEA 5B5EE 4FRTA 5AVQB 3CQCB 1PHOA 4IOIH 4OWFA 2N1TD 1P84H 2JMMA 4IDOA 2Q3EA 4O8SA 3MKDA 1Q81Q 1SFCD 1VDFA 1QJ9A 3WUVA 1SQBG 3QUJA 2BCCD 4X5TA 2CXLA 4Z3TA 1QGKB 1S72P 2X51A 5EK4A 3UULA 4H44D 1UCUA 1K8AQ 4DV2T 1RQVA 3PGRA 5BR8T 3E7KA 2M07A 3QOFA 3H37A 2KWIB 2LKMA 5KJ7A 2M5AB 4OK0A 3UPGA 1YXRA 2A06D 1FZCB 1FIOA 2WVRA 2VURA 3FZFB 4JI8T 3K5BA 4EB6E 4O3WA 2NW7A 4HWFA 4FI5A 1UX4A 2JQQA 2WDQA 1OW6A 4WY4B 2IBZG 3CCEP 3FZHB 5FP3A 3UFGA 3N9OA 2WSCJ 1MIWA 3AE7C 2DL1A 5JDHA 2PAJA 2JP3A 1SQBE 1G8XA 2BVMA 4HJGH 4H9QC 2XAJB 2IW5B 4ZKPA 2BASA 4PV1D 4IDQA 2XG6A 2KS1A 5DL6A 3FZMB 2YU2A 3AE8A 2IDBA 2G0UA 3B8EB 2HODB 4N6JA 5AQTB 4QMAA 2LEHA 4DV0T 3GHGC 2LRLA 1GU5A 3RIUC 1Y8AA 3A0HH 4O4JE 4H44C 3JTYA 2WQYA 4COFA 1KFYA 3N2KE 3L71J 1ZV8A 1M1KQ 2KNDA 2IWWA 5G26A 2I8DA 4AKGA 4PJJA 2LE8A 3ZYMA 3Q5DA 2MBGA 3PF1A 1NJIQ 2V6YA 3C4WA 5H6RB 3FZLB 4KMCA 3B5MA 1OIPA 4HEAA 4RJXA 3RGLA 1IFIA 4WY4D 4FQEA 1AQ5A 2XHEB 4YTMA 1M1JA 3B5NA 1VQOP 4L0RA 1SVFA 3O6QA 2Y2XA 2Z4EA 4TX5A 1OVRA 5AQGB 3RHWA 3V6IA 3BQKA 2ZM6T 1H0TA 1M62A 5KAFE 2D2CC 3KBTA 2XTRA 2W00A 1X9VA 3O6QB 4WW0A 4B3RT 4RL9A 5DQVA 4I7ZB 4NPPA 2KC0A 3NMDA 1PFIA 2IHR1 3DZMA 3HTKA 2L91A 1KD1Q 3AEBA 3CX5D 4JYCA 1XMQT 4QQ1A 4TT3H 2H43A 3CK6A 2VKOA 5JDPA 1L0LG 1OFCX 3LW5H 2BCCG 1QL1A 1PIXA 4F8HA 3JC6C 1NTKJ 1SQBK 2MPKA 1SQVD 2LSGA 3HWBA 3G7GA 3WU2E 1N7SA 2JWDA 3HE4A 3LK3B 1DEBA 4H9RC 1QJPA 4DT0A 3RPUA 1FZFA 2LXBA 5H2FH 2R4PA 5CJ4A 2H7VC 3HE4B 3LK3A 4ZS3A 3GHGA 2XQ4A 3IEEA 5AQNB 4EEBA 5BMVE 3PGUA 3VMAA 2KLVA 2Q9IA 5JTGA 1CW5A 2QJPC 3PHLA 4QKNA 3VZTX 3CCQP 4EEDA 1FS0E 2X66A 1FZBA 3CC7P 1FMWA 2D2CD 2WWWA 1Z0PA 4HFIA 3CMLA 3O1JA 1LGHB 2LKGA 2PTFA 5DJUB 1PP9E 4EI2A 2FGQX 3C4XA 4YFSA 1VF5D 4XA4A 2CEAA 3ONLC 1KC8Q 1NTKD 1N36T 4PJ0O 3F57A 4HTEA 2D2SA 4MHCA 1G90A 1NOHA 2KSEA 2I1KA 1E2AA 3V8UA 3O1HA 3I1AA 2KNCB 3ZJ1A 2WCAA 3PU8A 3KV4A 5ABFB 1Z56A 4QXHB 2IWVA 1YJ9P 3P4RA 1FOSF 3B57A 3HE5A 2CCQA 5FXXA 1ZRTD 3PH0A 3L71G 3B4SA 5KAIE 3G9RA 2L8KA 2V7JA 5LMNT 2K88A 2V5DA 2VQET 4TZ4C 5LG4A 1GU4A 1HJ0A 3BK9A 3KINB 3G6EP 4UEMA 1AQTA 2AXTO 1DD3A 1HXTA 2OARA 4QX7B 3P8CE 4KT0J 1RHZB 4I0UA 3WU2O 4Y99C 3D70A 1J5ET 1U4QA 3H1HD 2K3RA 2JPFA 4LSHA 1QL2A 4I50E 3UT5E 3TDKA 2PORA 3N2GE 5ADXL 1N73C 1PPJD 4Y99B 1D0ZA 1SQPG 2OYIB 2XZRA 3CC2P 1YQ4A 4IREA 1TU3F 1GL2C 3V2RA 4ZI3C 2GUVA 1NYHA 1XZYA 1NAFA 4X64T 3TGUG 1RY3A 3K3NA 1MNEA 3Q5EA 1EDIA 1XTGB 3CXHD 4WVZA 4RESB 4DR4T 3FWLA 3SYSA 1VQ8P 3MP7B 2UXNB 2PP6A 1BCCG 3JC22 1URQD 2FGRA 3PTZA 2H7OA 2ODVA 1SQVJ 2E5VA 2QA7A 3H1LE 3P8CD 4GCPA 2O01H 3AE4A 3H3MA 1HS7A 2PBIA 3SY9A 1VQ5P 2I1JA 3HKBE 2R8AA 2I0MA 4G75A 1PL5A 2WPQA 2UUCT 1OX3A 1SQVG 3EFGA 3WAKA 5FMNA 4FMSA 3C4ZA 5H2FO 5LGTB 3DA3A 1AJYA 3EAMA 4L9IA 1ZOYA 1V9DA 4DR3T 1LTSC 3KVAA 4H63V 1G1JA 1RE4A 4HH2A 2KLUA 5KJ7C 2QE7H 3IHRA 2XAFB 1KILA 2O1JA 1HF8A 1FJGT 2XJ7A 3AEAC 3HTKB 4H0LC 4HB1A 3SFEC 4N3YB 1R8EA 5LHIB 2HG5D 2C9LY 2FUPA 3MA9A 2MJZA 2Z5IA 3W68A 2E5TA 1W0AA 3OYZA 1BGYD 1URQC 4DR7T 4A98A 2OYHC 1T1LA 4OVNF 1X79A 2XSAA 2Q7CA 1QUUA 2VB6A 1XNRT 3I9YA 4EYYQ 4ZKUA 4HFHA 1SQQE 4CZZB 1AA0A 4H9NC 3S1KA 2LJLA 2IZ0A 1HFAA 2KINB 1N73A 3FWNA 3KZIH 3M9HA 2WY2A 1FAVA 5D5DA 3CXHE 3P4WA 5HXHA 5DJTB 1L0VA 1BCCE 2BKOA 2CPBA 4PK4A 2JKVA 1US7B 2JQKA 4B86A 2WS3A 2M67A 3QNUA 1R5SA 4CI3B 2WZIA 5J2TE 5EK3A 3ITKA 3K8PC 4Z91A 2K37A 4ASKA 1BGYJ 1NTMG 1OVUA 5APVA 4NXNT 4DV7T 4H13B 1H6S1 4FZNA 3VKGA 4JF7A 4DV3T 3A0HO 2K1AA 1EZ3A 4HFCA 2YU1A 4DMVA 4HWCA 2BEZF 3JCFA 4FJOA 1LTIC 1R5LA 1BE3J 1LTJA 2R5DA 3H1LD 4OGQC 3L70G 2YKPA 4AKHA 4GHBA 4M3LA 1G2CA 4GKJT 1ZOYC 3H1JD 2HPLA 2FYNB 1HUCA 5FNVE 5HEGA 3RBZA 3RK3D 2YMYA 3L8RA 1JY3P 4QH5A 3ZCIA 1ZLLA 1D0XA 2J4UP 1Q2NA 4LF8T 3VE1A 3VU7H 3PUQA 3L39A 2VKJA 4IL6O 3KZIE 3X1DA 3L72J 1BT9A 2YNYA 4K3AA 3HKEE 3S4RA 4WBOA 3IA3A 4BJMA 5GV0A 1L0NJ 5J1GA 5IWAT 2Q6QA 1YTZI 2PGDA 2K9AA 2NP9A 5AQVB 3TK1A 1Q7YQ 4A56A 3RIAA 4CQIA 3BQIA 2K4TA 1YD8G 2Y6XA 5JREA 2F1CX 1Z8UA 1SHZC 3VN0A 3WUTA 3AEEC 5HEHA 3Q3DA 3PGSA 3D71A 2NTYA 3HRNA 4JI3T 2WSCH 1SA0E 3CPZA 2B76A 2IMLA 3KVBA 1KILB 4A97A 1OWAA 2YDSA 3VZUX 5AQFB 4ILUA 5EZYE 1THQA 1SFCA 2E5LT 3C1LA 2W6JH 2R6GF 1FDIA 4JI7T 1ZXGA 2KLQA 3H32A 2E43A 2XQ7A 2QIWA 1NTME 1L0ND 2D5UA 3PUYF 1H89A 1KMIZ 2QM7A 2BS3A 3RYFE 4BRYA 2O4VA 3LBXA 2WDVA 1M1JB 3B5NB 2D0TA 4NIQA 2R4NA 3I55P 1OVVA 2Q3IA 3N7NA 3C50A 2JRKA 4K0UA 2K9JA 1BSNA 4U7YA 3PU3A 1PP9J 1GFQA 3NTNA 2W80C 4ILBA 3ZEFB 3ZT6A 4YTPA 2P9BA 3CX5I 1ZR4A 3ZLIA 3N9QA 1ZP0C 2V6YB 5JDMA 2WJQA 2B87A 1Y01A 4U31A 3RK2B 2WZHA 2O01N 1KB9D 2XZEA 1D0YA 1LTBC 4I2LC 2WM9A 3JAEA 5CJ5A 5DL5A 4EZ4A 4O4XA 2E9XD 5AVUB 4JI1T 1HG2A 1HWTC 1CI6B 3PE0A 4CXXA 3P50A 1J1JA 2Q9QA 4H9SE 3AA7B 2M0BA 3SWKA 2FYUG 3L73E 2DWKA 2WAUA 3BCCJ 3UUBA 5M4YA 2R3CA 4HWHA 1S35A 4JV5T 2A2FX 2JQ9A 3PURA 4EOTA 2CXDA 2LKHA 2KI7B 4IE5A 5TISH 4J2CA 4AISA 1PV3A 2JEEA 3AE1A 2N9DA 1K05A 3PUAA 3CWBJ 4WZXA 4TNWA 3ZMUB 1IFJA 3HE5B 2KT9A 2VVSA 4AKRA 4AFKA 2WQYC 4WY4A 3AEGC 5DQWA 1SFCC 5E79E 3CX7B 4AQFA 3E22E 1FE6A 3FXDA 4IE4A 5JRCB 2IBZD 3CCJP 2WVPA 4DZOA 1VQNP 3NVOA 3MIWA 3KDSE 1BE3G 1MIVA 2JQYA 3RK2D 2MOZA 1UK5A 2ACZA 2E74B 2YPVA 3C9IA 3NKZA 5CHXA 1KB9E 2MAWA 3AAEB 2F4VT 5E79H 2JIWA 3RQUA 5LHGB 2XTQA 3AAAA 2O01J 4KI0F 1M56D 3GW6A 5AQJB 4X20E 1KF6A 4PJLA 3HUSA 2WPSA 5KTBA 1L2PA 2HLOA 1YW0A 1NTZE 4FSOA 1IBMT 1MM5A 4PV1C 5AW5B 4F6RC 1MNDA 2W63A 5AW3B 4QXCB 4LSEA 2E75C 5AW1B 3P4PA 2A9UA 2YO3A 1SQXJ 4IIJE 2FYZA 5L4EA 3RF1A 2E42A 1YBKA 1KNRA 4GIWA 2UU9T 3U59A 1LKXA 5LBMA 2CRBA 3RKGA 1D1AA 3UU3A 3WI5A 1L0LK 4ZEYA 3KV6A 1VF5C 1ZV4X 2LHRA 3VMYA 3GN5B 4C4VB 2W0GA 4PJ0H 2DCFA 3ZCJA 1J1EC 2WZ7A 3NFQA 2CBIA 3AEAA 3JCUO 1CZQA 3RRWA 2W2UA 1PRNA 1KYOI 1JCCA 1WCRA 2KIKA 1M90Q 1SQPK 3V2NA 1R8IA 1OEDE 2ZFGA 4DR2T 1X22A 4BJNA 3D0TA 4JI5T 2UUAT 3WI4A 5IHYA 5L3CB 3RX6A 4K3BA 1MFTA 2N2MA 4HFBA 2OYHA 3DTOA 4MFRA 3AA0B 2B1EA 2LSJA 3RL0g 5HAXA 2GM4A 2UXCT 2OYIC 5C3JA 1OEDB 3PORA 5APTA 3EDUA 3N9MA 4TV8E 2LXCB 1XNQT 5AFUK 4JYBA 2QGSA 3PRJA 2AXTH 3V5SA 2KZ7A 1FJKA 5LBQB 2ZM0A 4OYJA 2RN0A 4GIFA 3UTKA 2YEVC 1FZCC 4GCQA 2ZT9C 5ETWA 3EVYA 1VQMP 2RA1A 1M57D 3AVSA 1KQGB 2GE4A 3R6NA 2BCCJ 2WPVB 1JY3O 3TGUJ 3VOPA 5F3JA 1KYOH 3GA8A 4C46A 3AEFC 2XQ8A 1HTJF 2MNHA 2YK0A 2FJAA 4P09A 3P4SA 4AUWA 3LK2A 2KWHA 2H3RA 2L9QA 3KVDD 1DX7A 3CI9A 5AVRB 2KZIA 4YPCA 4IDZA 2OV9A 4LSFA 4DIDB 3UAQA 1IZNA 3BCCE 4GT1A 1PPJE 3ONXA 1FZGA 1VQ6P 4ILAA 4OHFA 3RL0C 5FVKA 3CWBD 2K24A 5AW9B 4HWIB 1FZAA 2ITAA 1QSDA 1UUSA 2WMOA 5AQMB 4Y28J 2BBHA 5JH7E 4ZZBA 5FY7A 1L4AA 1Q9FA 3QH9A 2WPRA 1OZHA 1FDOA 4EYYR 4BRYB 5G3AA 1NO4A 3TLSA 4D6TD 4TNVA 2A06G 2V7QH 3NZQA 1LWUA 1JMBA 4UVBB 4N78E 2W62A 3A5TA 1JNMA 2ODUA 4KJMA 5AW7B 5ABEA 2BKNA 2Y9YA 3BATA 2HFED 3NZPA 4NUUA 4UB8O 1LT1A 2E2AA 1KN7A 1EXIA 3N9LA 3H1KE 1VOMA 2WSSH 1G1IA 4H0LD 2OTJP 4DV6T 2ZXXA 4ISSA 2IUBA 3N4XA 1LT9A 3TF5A 5JQGE 2A45G 1EZVD 2J1NA 4X1KE 4NXMT 3A2AA 3VZWX 3T1HT 5LP6E 1ORMA 2I6HA 4E1SA 2GUSA 2Y0DA 2WSFH 3R2PA 2QRXA 1RF0C 4YJ2E 3AXJA 3LJCA 1J2JB 1J1DB 1Q90D 2C5IT 3SZDA 4PFOA 1U5PA 3Q5XA 4UB6H 3RL0D 2HPJA 5JDNA 2QVAA 4YTPC 3AA7A 5BU5A 3CXHH 2KSRA 4MLKA 4FOZA 1BR1A 1YKHB 3HKCE 3EWKA 1VRBA 5JR9C 3CVRA 3BRYA 3TLTA 4YT0A 4DUYT 3U78A 3T24A 1RE4C 2JJLA 1ZMEC 7PRNA 1UIIA 2W27A 3D6ZA 5AQPB 2Q9QD 2LFUA 3AEFA 3Q1MA 3JSVC 1T7SA 3DJBA 3CKDA 2LM9A 3RL0B 3CCUP 2CLYB 4ANJA 1GFNA 1VQKP 1SQQG 1LVFA 3L75D 1G2CB 5FY0A 4WYVA 1YS5A 1MMGA 4KP3C 3S4UA 2LHFA 1VQPP 1BXWA 3A3YB 3LSVA 1L0LE 3EDVA 2WSSV 1X79B 2LHNA 3JADA 3RKOA 1ZP0A 1JTHA 3FXEB 4X65T 4GKKT 1LJ2A 4ZMDA 3MGNA 1YITP 4DBRA 3USSA 4O3ZA 3I0QA 4L73A 4QXBB 4HFVA 2XAHB 3FHNA 2G8YA 4EDFA 5LCYA 1IO4A 1L0NG 1M8OB 4UB8E 2YIUC 4U2ZA 3AB3B 1VL2A 3U1CA 5B66E 2BKPA 3L72D 2Q9QC 4LC1A 1MV8A 2MKVA 3PDYA 2FKWB 1SE7A 3AA1A 2V26A 3RH3A 4N59A 3PJSK 5L4HA 1J1DC 3AE2C 5ABGA 3HD7D 3AECA 3AA0A 3H1KD 3H1JJ 4IL6H 3NRXA 4O4HE 3TLVA 2KMFA 1ZRTE 4H13C 2J1DG 4X1IE 4PJNA 4ZOLE 2VASA 3VTPC 1PGPA 2FFDA 2NPSA 3L4FA 3I9WA 3UUNA 4IE0A 2XY8B 1KQLA 3EUHA 1PGQA 5HXRA 4WWIA 2ZM2A 4TLFA 2YKSA 3PP5A 4PD4D 1D7MA 1KZUB 2C9NY 4EIWA 1NU1D 4JEUB 4AKRB 3B13A 4EZHA 3K3QC 3EABA 2H89C 1QEXA 2M3BA 4UELA 2J58A 3M0DC 5EK2A 3UFEA 4DR6T 2XNDH 1T6AA 3V5BA 2E76B 1EDLA 5IYUA 5CCHD 3QC9A 4TN7B 1LTJC 1KNPA 5HEOA 2QJPB 2XQ9A 3AE3A 3F5HA 2X67A 5KLVD 1KYOE 4D64A 4KHZF 5CA1E 2VKDA 3BS0A 1L0LD 4PJMA 3SRZA 1LTJB 4FRXA 4ASWA 2NOXA 5CB4E 2AEMA 3H1ID 4AKMA 3VHLA 3A2SX 2DW3A 1HTLC 1YJNP 2QJYC 5APXA 4H13D 1JCDA 4PNIA 3EMNX 2AE9A 3P4QA 2W81C 4LSIA 2ZT9B 2X68A 4ZZCA 4N75A 2A72A 3RRCA 2RP4A 2MHLA 5K5GB 3AE7A 2AXTE 2Y7SA 1JB0J 5AVXB 2LOSA 2FBWC 3RYHE 4IFDK 3ZT7A 3O0EA 4G2AA 1BH3A 4AYNA 3HL6A 2FJDA 3Q9DA 2B9BA 4XE5B 2W66A 2W61A 2HPCB 1LTGC 5AW0B 4BWNA 2O3JA 5AW6B 3FX0A 3PTRB 1N7LA 2WB5A 5HEUA 3RIUA 2JQHA 5LMUT 2YXRB 1HX1B 4ADZA 2WMNA 2CLYC 2WT7B 2V1DB 1HVVA 5JRCA 3D6YA 3H32B 3EFFK 1UIXA 1MKMA 5AQIB 5AW2B 2L5GB 5L8RJ 3I5CA 3L74J 5IUXA 2E74C 3B71A 3BASA 3BRZA 1OW8A 1WR6A 2W6AA 2BG9E 4RO0A 3H1KJ 1GL2B 3RIFA 3MHVA 2WJRA 4IE7A 2YN6A 4IFFA 1JY3N 3DWOX 4AKLA 1KFMA 4PFPA 3Q5WA 3ABVA 3UU6A 2BEQD 5FYMA 2CHNA 2IIUA 4JCHA 4NPEA 5KLIC 1XMOT 2F1VA 1S1CX 1KQSO 5LGNB 4UF0A 2C0XA 4K0KT 1RE3C 1L0NK 2WSEJ 3OJAB 3ZN0B 2YOEA 3K3OA 4Z8XA 3RK2C 3TNUB 1QLBA 3MK7C 3KHUA 2ZLYA 3UU2A 4P0BA 3FBZA 3E1IA 3U3IA 4IL4A 2OA5A 2Y48B 1HNWT 1T3JA 4PK6A 3SFDC 1KK7A 3J9X1 2ES0A 4DVDA 4TWDA 1P84D 3L73J 3AE1C 2AXCA 3W15B 3M9BA 2EHOB 1S3JA 4UV8B 2VQFT 1T2KD 3RYIE 2CE7A 5AQUB 3A0BH 1KORA 2MTQA 2K0LA 3O1IA 4WY4C 5AVTB 4ZI2D 4Q25A 5ADXK 4O4UA 4WBAA 4LMLA 1E54A 2M3EA 3ZN1B 2PG8A 3F31A 4GK5E 2KXPA 2CBJA 3ZMVB 1XTCC 3LIDA 1AVOA 4RJTA 4LGDE 2YDRA 3OA7A 3IN6A 3ZMZB 1K73Q 1RF0A 5KLVE 5KAIO 2SPZA 4L75A 3H1IG 3L74D 2IPPA 4CN1A 3BVHA 2KSJA 5JDGA 4CPGA 1CI6A 4G63A 1D1BA 3HI2A 5TISE 2ZYGA 1BR2A 1LTTC 3QB5A 4IHJE 2BCCE 5L3FB 1VQLP 2C0WA 5FVNA 1W09A 1OEDC 3C64A 1USEA 3QB5K 3T20A 2LLYA 2JMHA 4HFEA 4IDNA 1NH4A 1GK6A 1HCIA 1DEEG 4UXNB 5AW4B 3UU8A 1HXXA 2BG9A 1N32T 3AA6B 4A5XA 2H7HA 1GDTA 2PFXA 1NVOA 1MMAA 5H6QB 1YYCA 1VCTA 1A02F 4HKZH 2WSEH 5CJ0A 3GF7A 3GF3A 1FU1A 4HN9A 3ZKRA 1BGYG 1NTMJ 1ZN5A 3MJXA 1WRDA 2OLTA 1S2EA 2JO1A 4AXPA 1XDPA 2FFDB 1MZ9A 4YTNA 1IFMA 4AQGA 1PP9G 1NEKA 2E9XB 4ERRA 4IL6E 5LG3A 4DV1T 3SFDA 1RH5B 1CUNA 2W6BA 3AXJB 4HKAA 1GFOA 1NTKG 3ZMSB 3CC4P 2H88C 2WU2A 1LTAC 5F8PA 3ZSSA 3DWNA 3AE6C 2ZT9D 2QA4P 3MXZA 3NXSA 1ZHWA 4BAYB 2W83C 2X9WA 3E1RA 2A3DA 1LVKA 4YSXA 2MYSA 1BGYE 2XUEA 4B3TT 1P84E 4U3FD 2Y0LA 4ZS2A 1AVYA 4UB6O 2XPKA 4W80A 3AECC 5B5EO 5KLVG 1H7CA 5CGMA 1HNZT 5JDQA 3P8MC 3ZYLA 5G39A 1X0TA 4UF0B 3AEEA 3BCCG 1SQXK 1JMMA 2R3SA 1HR0T 5AQOB 1N7SB 2KS1B 4HFDA 4PD4I 1VPCA 1UURA 4ZXLA 1SLQA 2C0SA 2XQ5A 3WUUA 1RF1C 2VVNA 4AIUA 4CI2B 1EQ7A 3P7KA 1FMVA 2JJ9A 5LOVE 3SOLA 1X9BA 4GF4A 1JO5A 2DNXA 2R4LA 3A0BO 2HPCA 3PJAA 2OQQA 4GKGA 3M0DA 2V8SV 5GONE 3R84B 1NKNA 4IL9A 1PPJG 3AE5C 2SPCA 3AE2A 4W7ZA 2BG9C 1N7SD 2OMFA 5AVYB 1ZEEA 1FJPA 3H1JG 1OW7A 1UGOA 3Q5SA 3IF8B 2OGUA 3C51A 1Y9BA 4D65A 2FFDC 5APQA 3AEDC 4OX9T 2ZM8A 3L73D 3IR9A 4YXDA 1JNZA 1EDKA 1AFOA 3L70E 3AA1B 3L3PA 4W7YA 1KILC 2V7QJ 2N2LA 2BS2A 3GMIA 3ZT5A 3ZSTA 5JVDE 4D5UA 2N1TB 2A45I 4LMJA 2IBZE 1EZVG 1GQEA 1L4AC 1N8RQ 4C7RA 4RKUJ 3HOLA 3EI0A 1T98A 3L72G 1SP4A 2N1TA 2H88A 2Y0CA 3H1JE 3CCMP 4M1PA 1URQA 4MBQA 2P7JA 3ZYKA 5KLVJ 2WTYA 5DL7A 3AE3C 2PJQA 2EHOD 2LR2A 5AVWB 1KFNA 3Q5RA 4BA9A 1NU1E 1OPFA 4I55E 2BDEA 1SQXD 1LP1A 1NGMB 4U72A 3VY8X 3Q2YA 1N7SC 4DO0A 3CX6B 3A7OA 5A1LA 4PUXA 5KJ7D 3SWYA 3PQUA 1E1HB 5DJQC 3H3AA 2XQ3A 4B61A 2VKHA 3N5LA 3UIAA 2UXBT 4U2YA 1LNQA 5AVZB 2IX7C 1KILD 1YKEB 2LSYA 1IAPA 4AKIA 2BVLA 3AEGA 3KPEA 4PW8A 2BS4A 3H1HE 2X9XA 2J4GA 5KAFO 2WITA 5AQSB 2IFNA 3H1LJ 1MM4A 3UUXB 1GTWA 1WFDA 3JCUH 5EFWB 2GK9A 5C8YE 5FKYA 4ASVA 3ZJ2A 3RC8A 1OSMA 2NPSB 2KP8A 1NTZG 2QM8A 2KUBA 2J62A 3MTUE 5LNKA 5AVVB 4DR1T 1O3XA 4U3FG 1MPFA 1N33T 4CI1B 1USDA 2R89A 1BSHA 3DP7A 2XQYA 3G4SP 2HR3A 1K04A 4RLCA 2WWUA 1QLED 3OYXA 3CD6P 2YKOA 4CTDA 4JBWF 4H0LB 1ZHCA 3FGAD 3HUSC 3N2OA 2X9YA 4EYUA 4TWFA 2QEXP 4IE6A 2M6IA 1NTMD 5APYA 2QYWA 4RLBA 2A45H 3RLFF 3G71P 1S5LE 5HEJA 3PJAJ 5L2LA 4JLEA 2N2NA 1VQ7P 3TGUE 1S94A 2BZBA 3UQ7A 2KK7A 3KXDA 4L74A 3MD0A 2XAQB 3BRTB 2FYUK 2I59A 2ZYAA 2X9KA 3VE2A 3NWIA 3WMM0 1YQ3A 1OMIA 1CSBA 2D0UA 1VQ9P 3CCSP 5J0ZA 2YIUB 3DA4A 2QJYB 2CA5A 2OYIA 1LRZA 2DLRA 4R4MA 2IYPA 4CN6A 4LF9T 2B88A 1ZHYA 4AYEC 4C7NA 3TZGA 2IC6A 3V4WA 3TGUD 1WT6A 4OYKA 1S9KE 4PJ0E 4UV9B 1YQ4C 5CBNA 4JI2T 1SQPD 1EC5A 3TSIA 4U7JA 1WLXA 5G38A 1KILE 2KYVA 4LF7T 3V5UA 4I7ZC 3H1HG 2FXOA 4X66T 4HWDA 1LP1B 4PD4H 4YJ3E 5ABHA 3L70D 2Y8DA 1JUNA 1IJ5A 2R32A 3ANWB 5KMGP 3ZPOA 4JBZA 4NPFX 3POXA 3L71D 5L3EB 4XNKA 4K35A 5FL0A 4H9OC 5HXSA 3ANWA 5GTHO 2J5UA 2IC9A 3WAJA 4L5GA 2E76C 2NR4A 3AE9A 2ERVA 5LB7B 2KB7P 2R44A 5KDMC 4AZLA 4KHXA 5KAIH 4PD4E 1M1JC 3B5NC 2AEJA 1SFCB 2CWYA 4U74A 2WWVA 5KKZC 3OVUA 1J1EB 1T8ZA 5HXEA 4D6TJ 4OGQB 4JI6T 2XV5A 1MUUA 3AVRA 2HH7A 2J59M 2H89A 1U57A 1JEKA 5ABFA 1S5LO 1KB9H 5GTIO 1N73B 1Y47A 4FUVA 4KR4A 1NTZD 3UU5A 1VQ4P 3VKHA 2RH0A 1J5WA 5LHHB 3M3ZB 3POQA 2QSIA 3OTOT 4O2AE 1E79H 5JDFA 1IBKT 2V4HA 2YO2A 3CQGB 3W67A 5FY1A 3OAKA 3SWHA 2J47A 3CX8B 3VR9A 1HGVA 2D9DA 3J7Yq 4DBQA 2WMMA 5FXZA 2AEFA 2N1GA 2V7LA 4KRAA 3M9QA 3MACA 3AAIA 3VYIA 1XWMA 1EXJA 2CWOA 4DMWA 1BDDA 4EIJA 3AA6A 2E76D 1SQXG 1I6ZA 4R4LA 2CPTA 4PK5A 4FSPA 3GMAA 3QWOC 2IZ1A 2QJKC 3IBPA 3OKQA 2UUBT 5H2FE 4KBMB 1IJ6A 1NWMX 2YINA 1T16A 3LW5J 5HCMA 1LWUC 3PUXF 5DABA 2X9HA 5JR9A 1ZHTA 2XQ6A 3RK3C 1EDJA 2OTKE 2NWBA 3WU2H 2POHA 3M65A 5KXJA 1IFNA 4U3FJ 1HG5A 4CXYA 2AXDS 2FYUE 3L73G 5AQRB 1WYBA 3VY9X 6PRNA 2C5KT 2CPSA 3LK41 2E9XA 3MUDC 2XKMA 1UX5A 5F5WA 4WBNE 3O8ZA 4C00A 2XM2A 1T72A 1SQVE 2Y0EA 5CA0E 1NTMK 5GTHE 1NAYA 1NTZJ 1NTKK 1SQBJ 2V6XA 2YKQA 1N34T 1SQQJ 2C5JA 4O2BE 3JCUE 4U33A 5FXWA 2L3LA 4QWNB 3SZVA 2KXPB 2IBZI 4EV6A 4JFBA 4N78D 3CX5H 3LFMA 5APUA 5KAFH 5AW8B 3H25A 4I43B 4AUIA 1WR0A 2NW9A 1PGOA 3H1IJ 3KQGA 4DOJA 1S4XA 2ZVNB 5J2UE 3SWFA 3HD7B 2EHOA 3UUMA 3SYBA 3VP8A 1L0LJ 1JOCA 2FXPA 2G3AA 3CPWO 3E08A 5EE2A 3CCLP 2XE2A 3VMZA 3K19A 3I56P 3BCCD 1GW4A 2M8RA 2W67A 5CBOA 3L70J
chains in the Genus database with same CATH topology
4PK6A 5HYAA 3PE0A 4CXXA 1KK7A 4H63H 2ES0A 3J9X1 3LK2B 4OK0A 4DVDA 4H9PC 3UPGA 2Q9QA 4ISTA 1FIOA 4H9SE 3AA7B 2DWKA 5JR9B 2WAUA 4BUMX 2XAGB 4UVAB 4EB6E 2NW7A 3W15B 3GN5A 4FI5A 5AFUL 1UX4A 5M4YA 2EHOB 4UV8B 2JQQA 5FP3A 1S35A 3I0OA 5JDLA 3RYIE 2CE7A 3N9OA 1MIWA 2A2FX 3PURA 5JDHA 2CXDA 4IE5A 4NUVA 1G8XA 4J2CA 4CXWA 2BVMA 2VL8A 2MTQA 2N9DA 2K0LA 3O1IA 3PUAA 3ZMTB 4ZI2D 4IGUA 4H9QC 2XAJB 4YHJA 2IW5B 4O4UA 5ADXK 1E54A 4WNKA 3ZMUB 3ZN1B 2KT9A 2PG8A 3F31A 4GK5E 2KXPA 3PRNA 3ZMVB 2XG6A 3LK2A 4AKRA 5DL6A 2XE5A 2YU2A 4AFKA 3ZMZB 2G0UA 3N9PA 5DQWA 3LK42 3CX7B 2LEHA 4AQFA 3E22E 5JRCB 4IE4A 3KDSE 5JDGA 4O4JE 1MIVA 4G63A 3JTYA 2MOZA 1D1BA 3HI2A 5TAOA 3NSGA 3N2KE 2YPVA 1BR2A 3GWHA 4IHJE 5L3FB 4P0AA 3PUGA 2KNDA 5FVNA 3NBXX 3AAEB 3C64A 4AKGA 5G26A 3T20A 4PJJA 2LE8A 5LJNA 3F2EA 4RJWA 2JMHA 3ZYMA 5LHGB 2XTQA 3AAAA 2MBGA 1HCIA 2ODJA 2ACXA 3MZKB 4UXNB 1HXXA 2CM0A 3C4WA 1FEWA 5H6RB 3CWZB 4KMCA 3AA6B 4X20E 3RC3A 4PJLA 3O9XA 4C69X 1MMAA 5H6QB 4HEAA 4RJXA 4ZI2C 1P4TA 4O3XB 5LYJE 1YW0A 4FSOA 2X0LB 2XHEB 1MM5A 4F6RC 1MNDA 2W63A 4HN9A 4QXCB 4LSEA 3MJXA 4L0RA 1WRDA 2Y2XA 1OXZA 4TX5A 2Q9QB 4AXPA 3BQKA 4IIJE 3SY7A 2XTRA 2VK9A 1MMNA 3KBTA 2W00A 4AQGA 5LJMA 2E9XB 4ERRA 4GIWA 1LKXA 4WW0A 5LBMA 4RL9A 1CUNA 5DQVA 2LSKA 1D1AA 4HKAA 5E0OA 3WI5A 1GFOA 2KC0A 3ZMSB 3KV6A 1ZV4X 2KDYA 4TUYE 5F8PA 2LHRA 3E0ZA 3GN5B 4O3YA 4QQ1A 5JDPA 2VKOA 3MXZA 1ZHWA 4AYDC 2W0GA 4BAYB 2DCFA 3ZCJA 2X9WA 2A3DA 1LVKA 3QK6A 2MYSA 3JC6C 3RRWA 1PRNA 2XTLA 2UXXB 2NTXA 2XUEA 2Y0LA 4ZS2A 2LSGA 2ZLDA 1B7TA 3AAAB 3G7GA 3HWBA 2ZFGA 3LK3B 4BJNA 1H7CA 4H9RC 3SS1A 3AAEA 3D0TA 5JDQA 1QJPA 3RPUA 4TV9E 3ZYLA 3WI4A 5IHYA 4UF0B 3RX6A 5L3CB 2N2MA 4FESA 5FXVA 4I4TE 4HE8A 3DTOA 4EAHA 4MFRA 2H7VC 3AA0B 3LK3A 2B1EA 2LSJA 4ZS3A 4AQFC 3PQSA 5HAXA 3IEEA 5BMVE 2C0SA 4XBFB 1HX8A 1GFMA 3PORA 3EDUA 3L09A 3N9MA 4TV8E 4CI2B 2V7KA 4FZLA 4QKNA 4F4BA 3VZTX 4O49A 5AFUK 2X66A 1FMVA 2QGSA 3V5SA 2JJ9A 2KZ7A 1FMWA 5LOVE 1Z0PA 3SOLA 4GF4A 2DNXA 5LBQB 2E8IA 2ZM0A 4OYJA 3CMLA 3O1JA 2XASB 4XAXB 4C90A 1BR4A 2FGQX 4QX8B 3C4XA 5GONE 4YFSA 3R84B 2CEAA 3UTKA 3WI3A 2SPCA 2YEVC 4GCQA 5ETWA 3EVYA 3AVSA 2RA1A 3F57A 2OMFA 3VE1A 1ZEEA 4HTEA 2D2SA 4MHCA 1G90A 2GE4A 3JC6D 3R6NA 2V7MA 3O1HA 3V8UA 3ETUA 3IF8B 3C51A 3GA8A 4E7ZA 3I1AA 3N9NA 4ZI3D 5F3JA 2MNHA 1HTJF 3GP6A 2YK0A 4D65A 3HA4A 3ZJ1A 2JMKA 1KNZA 4P09A 2PRNA 2ZM8A 2KWHA 3KV4A 2H3RA 2L9QA 3PU8A 4QXHB 3ZC0A 3KVDD 3AA1B 3L3PA 3B57A 4IDZA 5L3BB 2CCQA 5L3DB 5FXXA 2N2LA 3GMIA 4LSFA 5HWXA 3O4XE 5JVDE 2XE3A 4D5UA 3UAQA 1IZNA 3ONXA 4OHFA 2L8KA 4C91A 2V7JA 3HOLA 2K24A 4TZ4C 1T98A 5LG4A 5T5FA 1QSDA 2WMOA 3BK9A 3KINB 4M1PA 4MBQA 5JH7E 3ZYKA 4AYMC 4UEMA 5FY7A 3KFWX 1Q9FA 5DL7A 2PJQA 2EHOD 1HXTA 4JUYA 4QX7B 4EYYR 4BA9A 1OPFA 1D1CA 4YLHA 1U4QA 4G76A 4I55E 3NZQA 2BDEA 2LOPA 2JPFA 4LSHA 4I50E 4UVBB 2W62A 4U72A 3UT5E 3VY8X 4GCSA 4DO0A 3RYCE 2PORA 2ODUA 3N2GE 5ADXL 3CX6B 5A1LA 1D0ZA 4PUXA 3OJAA 3LBXB 3LG7A 5LXTE 3C5OA 1E1HB 3NZPA 4NUUA 3H3AA 5DJQC 3PQUA 4B61A 5PRNA 2VKHA 3N9LA 3N5LA 4ZI3C 1VOMA 1NAFA 4ISSA 3BQLA 5JQGE 3K3NA 1ZKEA 1MNEA 2J1NA 4X1KE 3VZWX 2DHRA 5LP6E 1ORMA 4E1SA 1YKEB 2LSYA 4O3WA 1IAPA 3SYSA 4AKIA 2BVLA 2UXNB 4YJ2E 1ZHXA 2IAKA 4PW8A 3LJCA 2C5IT 2X9XA 2H7OA 2ODVA 2FGRA 4XNLA 2QA7A 3SZDA 4PFOA 3HOEA 1U5PA 3Q5XA 3P8CD 2HPJA 4PAGA 5JDNA 2Z6EA 1MM4A 2LSIA 4GCPA 1Y64B 3UUXB 3AA7A 1HS7A 4MLKA 2PBIA 4FOZA 3SY9A 4GK0E 1BR1A 2GK9A 5C8YE 3ZJ2A 3RC8A 1YKHB 1OSMA 4N58A 2DWGA 3HKBE 3HKCE 1VRBA 5JR9C 3CVRA 4G75A 3C98B 4B6XA 3QRAA 5LNKA 3U78A 3T24A 2F1TA 1O3XA 7PRNA 2EHOC 3WAKA 1MPFA 2Q9QD 5FMNA 4UVCB 4FMSA 3C4ZA 2LFUA 4CI1B 5LGTB 2XE1A 3DA3A 3DP7A 2XQYA 4RLCA 4L9IA 2WWUA 1V9DA 5KX5E 3KVAA 4H63V 3OYXA 1IZNB 3DJBA 3CKDA 1ZHCA 2LM9A 4KUMB 3N2OA 2CLYB 5IYZE 3IHRA 4ANJA 2X9YA 1GFPA 2XAFB 1GFNA 3T0SA 1LVFA 4EYUA 4ZI7E 1HF8A 4IE6A 5FY0A 1YS5A 1MMGA 4RLBA 4KP3C 4GYSA 3S4UA 2LHFA 5LHIB 5L2LA 4JLEA 1BXWA 2N2NA 3Q2MA 4QHOA 4E1TA 4UIGA 1S94A 2BZBA 3EDVA 3MA9A 2WSSV 2XAQB 2LHNA 3RKOA 4EXTA 3OYZA 3FXEB 4DNDA 2I59A 2Y0HA 3VE2A 3ZC1A 4DBRA 2D0UA 4O3ZA 3I0QA 4QXBB 3FYXA 4MALA 4HFVA 2XAHB 1X79A 3FHNA 2CA5A 3DA4A 3QRCA 1QUUA 2VB6A 1LRZA 3T8OA 2DLRA 3I9YA 4CZZB 5LCYA 1ZHYA 4AYEC 1MMDA 4H9NC 3TZGA 2LJLA 2IC6A 1HFAA 3AB3B 2KINB 4OYKA 2QTKA 2Q9QC 4UV9B 3TKLB 3FBLA 3PDYA 2K48A 3NRYA 4GOUA 2M06A 5D5DA 3AA1A 2V26A 1WLXA 3RH3A 4N59A 3KV5A 5HXHA 3AA0A 3V5UA 4PK4A 1US7B 3NRXA 5LA6E 4O4HE 2M67A 2KMFA 1WYCA 4HGAA 2J1DG 4X1IE 4YJ3E 4CI3B 4PJNA 4ZOLE 2Y8DA 2VASA 5J2TE 5EK3A 2ZMAA 3K8PC 4GYRA 1IJ5A 3ANWB 5KMGP 4ASKA 3POUA 3I9WA 3UUNA 3ZPOA 4IE0A 4JEHB 1H6S1 3POXA 5L3EB 3EUHA 1ZHZA 4FZNA 3A5XA 5HXRA 3VKGA 2ZM2A 4XNKA 2CXFA 4H9OC 3RBHA 5HXSA 3ANWA 1G73A 1EZ3A 4XZCA 2IC9A 3WAJA 4L5GA 2YU1A 4DMVA 4JEUB 4AKRB 3B13A 4FJOA 4EIWA 4EZHA 2ERVA 3K3QC 3HW9A 2X27X 5KDMC 2NW8A 4U74A 4AZLA 2CWYA 4UELA 5EK2A 4FZMA 3UFEA 4AKHA 5IYUA 4GHBA 5HXEA 2HPLA 2K5BB 3QC9A 4TN7B 3HKDE 3AVRA 5FNVE 2HH7A 4AYID 1MIYA 2YNKA 5HWYA 2X67A 3ZCIA 4D64A 4O4LE 1D0XA 5CA1E 2J4UP 4KR8A 4FUVA 1Q9GA 2VKDA 3VU7H 3PUQA 1HXUA 2VKJA 4KR4A 3OBVE 4PJMA 3SRZA 3VKHA 1BT9A 4FRXA 2PFVA 5LHHB 2KZ7B 3CQXC 3POQA 2NOXA 5LGUB 3ESLA 3HKEE 4O2AE 4WBOA 5JDFA 5CB4E 4BJMA 5GV0A 3CQGB 3VHLA 3A2SX 4AKMA 5J1GA 5FY1A 5L3GB 2V7IA 3SWHA 3CX8B 2DI4A 2K9AA 4DBQA 2NP9A 4PNIA 3J7Yq 3EMNX 2W81C 4LSIA 5FXZA 2X68A 2N1GA 2V7LA 4A56A 2A72A 4CQIA 3RRCA 4KRAA 2RP4A 3MACA 5HXCA 2MHLA 3AAIA 3BQIA 2K4TA 1YD8G 2Y6XA 3FB2A 5JREA 4E7SA 2LT3A 2CWOA 1SHZC 3HR0A 2Y7SA 1AJ3A 4DMWA 2LOSA 8PRNA 3KV9A 3RYHE 3O0EA 4EOZB 4G2AA 1BH3A 3AA6A 4AYNA 3HL6A 2Y0KA 2WBLA 4U9CA 2NTYA 3KBUA 1QJ8A 4PK5A 4FSPA 1SA0E 3CPZA 3KVBA 3Q9DA 1OWAA 3OKQA 3IBPA 3VZUX 4KBMB 3P7IA 1IJ6A 1NWMX 2YINA 2VWAA 2E9XC 2W61A 4ILUA 5EZYE 4X1YE 1THQA 5DABA 5DL8A 2X9HA 3PTRB 5JR9A 1ZHTA 2NWBA 3M65A 1BR0A 4CXYA 1HG5A 2KLQA 6PRNA 1WYBA 3VY9X 2C5KT 4OFZA 2E9XA 3LK41 4ADZA 2D5UA 2WMNA 4ZHQE 1UX5A 4WBNE 2CLYC 4V1Av 2V1DB 2XMXA 4AI6A 3FXDB 3RYFE 5JRCA 2O4VA 5CA0E 3LBXA 2CMRA 2C5JA 3ETVA 4O2BE 2D0TA 3PUSA 5FXWA 2L3LA 4QWNB 3SZVA 3C50A 2KXPB 4O4IE 2JRKA 4K0UA 1WR6A 4N78D 3PU3A 4FT6A 4JFBA 1GFQA 2W80C 3ZEFB 3LFMA 2P9BA 4FRTA 3CQCB 1PHOA 4I43B 4IE7A 2JMMA 3ZLIA 4AUIA 2NW9A 3N9QA 4AKLA 4PFPA 3Q5WA 5JDMA 4O8SA 3MKDA 5FYMA 4JCHA 5J2UE 1QJ9A 2F1VA 2EHOA 3UUMA 3SYBA 5LGNB 4UF0A 1D0YA 3QUJA 2CXLA 4Z3TA 2WM9A 2X51A 3E08A 5EK4A 3UULA 5DL5A 3ZN0B 5EE2A 4EZ4A 1UCUA 3K3OA 4Z8XA 4O4XA 2E9XD 3MK7C 2XE2A 3K19A 2M07A 2ZLYA 3UU2A 4P0BA 3FBZA 3U3IA 3H37A 1HG2A 2OA5A 2Y48B 2KWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA A;  3AA1 B;  3AAA B;  4AKR A;  1IZN B;  3LK2 B;  3LK3 B;  3AAE A;  3AA7 B;  3LK4 2;  5ADX L;  5AFU L;  1IZN A;  3AA6 B;  3AA7 A;  3LK4 1;  3AA0 B;  3LK3 A;  3AA6 A;  2KZ7 B;  5AFU K;  5ADX K;  4AKR B;  2KZ7 A;  3AA1 A;  3AAE B;  2KXP B;  3AA0 A;  2KXP A;  3LK2 A; 
#chains in the Genus database with same CATH topology
 1GW3 A;  2E75 B;  5HYA A;  4H63 H;  2ZXE B;  3LK2 B;  3L36 A;  4H9P C;  3IFM A;  4IST A;  2BG9 B;  4C4V A;  5JR9 B;  4BUM X;  2XAG B;  4UVA B;  5AFU L;  2D2C B;  4I1L A;  2XSB A;  3GN5 A;  3I0O A;  5JDL A;  1I94 T;  5APS A;  4NUV A;  1SQX E;  4CXW A;  4O9B A;  1K9M Q;  2M6B A;  2VL8 A;  5CFB A;  1VF5 B;  1GL2 A;  3V4Q A;  3ZMT B;  4GOF A;  3A0H E;  4IGU A;  4YHJ A;  1FZE A;  4WNK A;  2W4X A;  3TLW A;  3PRN A;  2E75 D;  3LDQ B;  2N1T C;  2UWJ E;  1NHL A;  2XE5 A;  1PP9 D;  5B66 O;  2A06 E;  3RQW A;  3N9P A;  4P1N A;  3LK4 2;  1GMJ A;  3NJT A;  2ZAE B;  2RPA A;  1W2E A;  3RK3 E;  5AQL B;  3IAO A;  4A7P A;  1OED A;  3AE4 C;  4TWH A;  3HUS B;  3UU4 A;  5TAO A;  3NSG A;  3H1K G;  1HJB A;  4B3S T;  2OYH B;  4CN4 A;  4IT4 A;  3GWH A;  4P0A A;  3PUG A;  3NBX X;  2YDQ A;  1X8Y A;  5LJN A;  3F2E A;  3T97 A;  5CCG A;  4RJW A;  4JPZ B;  3RBX A;  2ODJ A;  2ACX A;  3MZK B;  1M7L A;  1PGJ A;  4NPD A;  3G06 A;  1FZC A;  3CXH I;  1PZQ A;  3H1L G;  1FEW A;  2CM0 A;  1T2K C;  2XU6 A;  2CK3 H;  3CWZ B;  4YHH T;  3RC3 A;  2M5A A;  4YXW H;  3O9X A;  4C69 X;  3A8Y C;  3CME P;  2ZJS E;  3Q5P A;  4ZI2 C;  1P4T A;  4O3X B;  5LYJ E;  3TNU A;  1P84 I;  2X0L B;  1KYO D;  4IDP A;  3L75 J;  3CLQ A;  3P32 A;  1OXZ A;  4U7I A;  2Q9Q B;  1Q82 Q;  1H88 A;  2IDO B;  2FYU D;  1FBM A;  3SY7 A;  3VP9 A;  2VK9 A;  1MMN A;  1KB9 I;  1YQ3 C;  4L76 A;  5B5E H;  5LJM A;  3AE6 A;  2R4O A;  3G3Z A;  2W8Z A;  3RI5 A;  3PLN A;  1DH3 A;  2LSK A;  3M91 A;  2FXM A;  5E0O A;  3ONJ A;  3RK3 B;  2WP9 A;  1IK7 A;  2FJB A;  1NU1 J;  2FJE A;  1BE3 E;  2KDY A;  5M1B A;  4TUY E;  3E0Z A;  3HD7 A;  4O3Y A;  2W90 A;  3GG2 A;  3CCV P;  4AYD C;  2P2U A;  2YMK A;  2N9B A;  3QK6 A;  2XTL A;  2UXX B;  2NTX A;  3UQ4 A;  3AEB C;  2ZLD A;  1B7T A;  3AAA B;  2Q1K A;  1T8B A;  1DU2 A;  3CX5 E;  3SS1 A;  3AAE A;  3C8V A;  2NZ2 A;  1BE3 D;  5GTI H;  4TV9 E;  2FBW A;  2O1K A;  1AV1 A;  4MN4 C;  1RF1 B;  4FES A;  5FXV A;  4I4T E;  4WB4 A;  1L0N E;  4HE8 A;  4EAH A;  3PQS A;  4ILC A;  4AQF C;  2B87 B;  1FOS E;  2P58 A;  1LT9 C;  1E5W A;  5GTH H;  3L72 E;  4XBF B;  1HX8 A;  1GFM A;  5FVL A;  1URQ B;  3L09 A;  3KDP B;  4FZL A;  4F4B A;  2V7K A;  4O49 A;  5CCH A;  3LIE A;  1QX8 A;  3L74 E;  3ABV C;  2B89 A;  1W2B O;  2K3W A;  2JDI H;  2V5C A;  2E8I A;  1U7J A;  3AE9 C;  3PUV F;  1JY2 P;  2XAS B;  4XAX B;  3MZW B;  4C90 A;  1BR4 A;  4QX8 B;  1N86 A;  1E7P A;  4EGW A;  3WI3 A;  2QG4 A;  1ZW0 A;  4K3C A;  5TJH A;  2XQA A;  1HNX T;  1NKZ B;  3TLU A;  4DCK A;  4GOD A;  4YXD C;  1HBW A;  3JC6 D;  4DR5 T;  1GK4 A;  2V7M A;  3ETU A;  3AE5 A;  4E7Z A;  4ZI3 D;  3N9N A;  3GP6 A;  2LM2 A;  2XDJ A;  3HA4 A;  1KNZ A;  2JMK A;  3L74 G;  4Z1M H;  2PRN A;  1NU1 G;  1HGZ A;  3ZC0 A;  4U3C A;  2E5Y A;  1L4A B;  3KZI O;  1KTM A;  5L3B B;  5L3D B;  2VRS A;  3CWB G;  5C39 A;  5HWX A;  3O4X E;  2XE3 A;  3IF4 A;  1IC2 A;  5AQQ B;  3L37 A;  2NRG A;  1YJW P;  1JNR A;  3AED A;  5E79 O;  1RE3 A;  4C91 A;  2HN2 A;  3A0B E;  2K9J B;  3OW2 O;  5T5F A;  4JI4 T;  1CHU A;  2JWA A;  4AYM C;  2R88 A;  4JQ0 D;  5KKZ B;  3KFW X;  4YSZ A;  2ZYD A;  4JUY A;  3BRV B;  3PUZ F;  1D1C A;  4YLH A;  2UXD T;  1JY2 N;  4G76 A;  4ZNC A;  2LOP A;  1N2D C;  4DUZ T;  3CWB E;  5KLV K;  4GCS A;  3RYC E;  3H1I E;  3L35 A;  3L71 E;  4LFB T;  3OJA A;  1QVG O;  3LBX B;  3LG7 A;  4YSY A;  5LXT E;  3C5O A;  1IBL T;  3S9O A;  5PRN A;  3BQL A;  1IFD A;  1JTH B;  3FXE A;  1ZKE A;  5KLI B;  4DV4 T;  2DHR A;  1NWQ A;  4LF5 T;  3OPC A;  1ZHX A;  1YHQ P;  2IAK A;  4D6T E;  4XNL A;  2NPS C;  1L4A D;  2KOG A;  1A02 J;  3HOE A;  1GZL A;  4KHP T;  4PAG A;  2Z6E A;  2LSI A;  1H0T B;  1Y64 B;  2IFM A;  4OH8 B;  4IL6 X;  4AYC A;  4DJG A;  4GK0 E;  4N58 A;  1KEY A;  1JM0 A;  2DWG A;  3JAF A;  1SQQ D;  3KYQ A;  4UR9 A;  4LMK A;  3C98 B;  2VL0 A;  4B6X A;  3QRA A;  2F1T A;  1FC2 C;  2EHO C;  1LWU B;  4AQR D;  4HYT B;  1HF9 A;  3CIR A;  4UVC B;  4AQY T;  2XE1 A;  2YXQ B;  1WRG A;  5KX5 E;  1IZN B;  1NU1 K;  2K9Y A;  2P1J A;  2GA1 A;  3F89 A;  4KUM B;  5IYZ E;  1GFP A;  4KX6 A;  3T0S A;  4ZI7 E;  1GL2 D;  1KQF B;  1SQP E;  1KV4 A;  3T1Y T;  4B3M T;  2X0H A;  4C7N B;  4GYS A;  2P67 A;  1Q86 Q;  3Q2M A;  4QHO A;  4E1T A;  2Y9Z A;  1IK9 A;  3GLM A;  1S5L H;  4UIG A;  3A7M A;  4EXT A;  1S5L X;  4DND A;  2Y0H A;  5AQH B;  3V2Q A;  3ZC1 A;  5CMZ A;  2NPS D;  5BVZ A;  3FYX A;  2HOD A;  4MAL A;  3QRC A;  3B5N D;  2FYU J;  3T8O A;  3PV0 F;  4N74 A;  1M7K A;  4PV1 B;  1MMD A;  2QTK A;  2ZFC A;  1YIJ P;  1W5C E;  5CCG D;  3TKL B;  3FBL A;  1W9R A;  2K48 A;  3NRY A;  4GOU A;  2M06 A;  1H8A A;  1SQV K;  4Z90 A;  5AVS B;  2JR8 A;  3KV5 A;  3II6 A;  1EZV I;  4LF4 T;  2Z5H A;  2KNC A;  4D6T G;  3V2P A;  5LA6 E;  5C2T A;  1VCS A;  3ZDM A;  1HH0 A;  1SUM B;  1WYC A;  3K1S A;  4HGA A;  1ZR2 A;  4LFC T;  3PUW F;  1BCC D;  3CMA P;  1BDC A;  2ZMA A;  4PR7 A;  1IFP A;  4GYR A;  3POU A;  3L75 G;  4GOE A;  4YY3 T;  4JEH B;  1RF1 A;  4LLH A;  1ZHZ A;  1GD2 E;  2FY8 A;  2ZVO B;  3A5X A;  3VR8 A;  2CXF A;  3RBH A;  3VMX A;  4DV5 T;  1S9K D;  1G73 A;  4GDO A;  4XZC A;  2RMZ A;  1JY2 O;  3HW9 A;  3VRA A;  5AQK B;  2X27 X;  4QH1 A;  2NW8 A;  3M06 A;  2WU5 A;  4FZM A;  1YTZ T;  3H1H J;  1IJD B;  2HHH T;  2K5B B;  4I6M C;  4BXL A;  3HKD E;  4QH4 A;  5APW A;  3CCR P;  1EZV E;  4AYI D;  5CCG C;  1DIP A;  1MIY A;  2YNK A;  5HWY A;  4O4L E;  4KR8 A;  2FYN C;  5HCJ A;  2XNX A;  5B66 H;  4LF6 T;  1HXU A;  1Q9G A;  2N9Y B;  5TIS O;  3OBV E;  2HN1 A;  2PFV A;  2KZ7 B;  3CQX C;  3HD7 C;  4UB8 H;  5LGU B;  4JI0 T;  3ESL A;  1LT9 B;  2H8P D;  2WT7 A;  1QVF O;  5L3G B;  2V7I A;  2DI4 A;  2E74 D;  3EHZ A;  1MFZ A;  2RKL A;  5HXC A;  1FDM A;  2WDR A;  1W0B A;  2HYN A;  3U1A A;  2XM1 A;  5FL1 A;  3FB2 A;  2R5B A;  3TYY A;  4E7S A;  2LT3 A;  1SQP J;  3HR0 A;  1NTK E;  3R4Y A;  1AJ3 A;  8PRN A;  3KV9 A;  4EOZ B;  2QJK B;  1DD4 A;  2Y0K A;  2WBL A;  4U9C A;  3FZK B;  3KBU A;  3CL3 D;  1QJ8 A;  4OGQ D;  2Q5U A;  1SQQ K;  3SSU A;  4JYA T;  1NTZ K;  3RGU A;  4XFJ A;  3H6P A;  1YI2 P;  3P7I A;  3T97 B;  1NEN A;  3AE8 C;  2VWA A;  2E9X C;  1SS1 A;  2BBJ A;  5GTI E;  5CCH C;  4X1Y E;  3M0A A;  5DL8 A;  2P10 A;  1BR0 A;  1T3U A;  3EQ2 A;  5BU8 B;  3L75 E;  4OFZ A;  4ZHQ E;  2CHO A;  2OYO A;  2X0Y A;  4V1A v;  2XMX A;  4AI6 A;  2IYO A;  3FXD B;  3GHG B;  1SQB D;  2OTL P;  5L47 A;  1WMK A;  4U3F E;  2LRK A;  1RQU A;  2WSF J;  2CMR A;  3ETV A;  4H44 B;  4LFA T;  3PUS A;  1U7M A;  3MUD A;  3VRB A;  1BCC J;  4O4I E;  2KZJ A;  4IFM A;  4UB6 E;  1XDO A;  2PRR A;  4X62 T;  4FT6 A;  3SFE A;  5B5E E;  4FRT A;  5AVQ B;  3CQC B;  1PHO A;  4IOI H;  4OWF A;  2N1T D;  1P84 H;  2JMM A;  4IDO A;  2Q3E A;  4O8S A;  3MKD A;  1Q81 Q;  1SFC D;  1VDF A;  1QJ9 A;  3WUV A;  1SQB G;  3QUJ A;  2BCC D;  4X5T A;  2CXL A;  4Z3T A;  1QGK B;  1S72 P;  2X51 A;  5EK4 A;  3UUL A;  4H44 D;  1UCU A;  1K8A Q;  4DV2 T;  1RQV A;  3PGR A;  5BR8 T;  3E7K A;  2M07 A;  3QOF A;  3H37 A;  2KWI B;  2LKM A;  5KJ7 A;  2M5A B;  4OK0 A;  3UPG A;  1YXR A;  2A06 D;  1FZC B;  1FIO A;  2WVR A;  2VUR A;  3FZF B;  4JI8 T;  3K5B A;  4EB6 E;  4O3W A;  2NW7 A;  4HWF A;  4FI5 A;  1UX4 A;  2JQQ A;  2WDQ A;  1OW6 A;  4WY4 B;  2IBZ G;  3CCE P;  3FZH B;  5FP3 A;  3UFG A;  3N9O A;  2WSC J;  1MIW A;  3AE7 C;  2DL1 A;  5JDH A;  2PAJ A;  2JP3 A;  1SQB E;  1G8X A;  2BVM A;  4HJG H;  4H9Q C;  2XAJ B;  2IW5 B;  4ZKP A;  2BAS A;  4PV1 D;  4IDQ A;  2XG6 A;  2KS1 A;  5DL6 A;  3FZM B;  2YU2 A;  3AE8 A;  2IDB A;  2G0U A;  3B8E B;  2HOD B;  4N6J A;  5AQT B;  4QMA A;  2LEH A;  4DV0 T;  3GHG C;  2LRL A;  1GU5 A;  3RIU C;  1Y8A A;  3A0H H;  4O4J E;  4H44 C;  3JTY A;  2WQY A;  4COF A;  1KFY A;  3N2K E;  3L71 J;  1ZV8 A;  1M1K Q;  2KND A;  2IWW A;  5G26 A;  2I8D A;  4AKG A;  4PJJ A;  2LE8 A;  3ZYM A;  3Q5D A;  2MBG A;  3PF1 A;  1NJI Q;  2V6Y A;  3C4W A;  5H6R B;  3FZL B;  4KMC A;  3B5M A;  1OIP A;  4HEA A;  4RJX A;  3RGL A;  1IFI A;  4WY4 D;  4FQE A;  1AQ5 A;  2XHE B;  4YTM A;  1M1J A;  3B5N A;  1VQO P;  4L0R A;  1SVF A;  3O6Q A;  2Y2X A;  2Z4E A;  4TX5 A;  1OVR A;  5AQG B;  3RHW A;  3V6I A;  3BQK A;  2ZM6 T;  1H0T A;  1M62 A;  5KAF E;  2D2C C;  3KBT A;  2XTR A;  2W00 A;  1X9V A;  3O6Q B;  4WW0 A;  4B3R T;  4RL9 A;  5DQV A;  4I7Z B;  4NPP A;  2KC0 A;  3NMD A;  1PFI A;  2IHR 1;  3DZM A;  3HTK A;  2L91 A;  1KD1 Q;  3AEB A;  3CX5 D;  4JYC A;  1XMQ T;  4QQ1 A;  4TT3 H;  2H43 A;  3CK6 A;  2VKO A;  5JDP A;  1L0L G;  1OFC X;  3LW5 H;  2BCC G;  1QL1 A;  1PIX A;  4F8H A;  3JC6 C;  1NTK J;  1SQB K;  2MPK A;  1SQV D;  2LSG A;  3HWB A;  3G7G A;  3WU2 E;  1N7S A;  2JWD A;  3HE4 A;  3LK3 B;  1DEB A;  4H9R C;  1QJP A;  4DT0 A;  3RPU A;  1FZF A;  2LXB A;  5H2F H;  2R4P A;  5CJ4 A;  2H7V C;  3HE4 B;  3LK3 A;  4ZS3 A;  3GHG A;  2XQ4 A;  3IEE A;  5AQN B;  4EEB A;  5BMV E;  3PGU A;  3VMA A;  2KLV A;  2Q9I A;  5JTG A;  1CW5 A;  2QJP C;  3PHL A;  4QKN A;  3VZT X;  3CCQ P;  4EED A;  1FS0 E;  2X66 A;  1FZB A;  3CC7 P;  1FMW A;  2D2C D;  2WWW A;  1Z0P A;  4HFI A;  3CML A;  3O1J A;  1LGH B;  2LKG A;  2PTF A;  5DJU B;  1PP9 E;  4EI2 A;  2FGQ X;  3C4X A;  4YFS A;  1VF5 D;  4XA4 A;  2CEA A;  3ONL C;  1KC8 Q;  1NTK D;  1N36 T;  4PJ0 O;  3F57 A;  4HTE A;  2D2S A;  4MHC A;  1G90 A;  1NOH A;  2KSE A;  2I1K A;  1E2A A;  3V8U A;  3O1H A;  3I1A A;  2KNC B;  3ZJ1 A;  2WCA A;  3PU8 A;  3KV4 A;  5ABF B;  1Z56 A;  4QXH B;  2IWV A;  1YJ9 P;  3P4R A;  1FOS F;  3B57 A;  3HE5 A;  2CCQ A;  5FXX A;  1ZRT D;  3PH0 A;  3L71 G;  3B4S A;  5KAI E;  3G9R A;  2L8K A;  2V7J A;  5LMN T;  2K88 A;  2V5D A;  2VQE T;  4TZ4 C;  5LG4 A;  1GU4 A;  1HJ0 A;  3BK9 A;  3KIN B;  3G6E P;  4UEM A;  1AQT A;  2AXT O;  1DD3 A;  1HXT A;  2OAR A;  4QX7 B;  3P8C E;  4KT0 J;  1RHZ B;  4I0U A;  3WU2 O;  4Y99 C;  3D70 A;  1J5E T;  1U4Q A;  3H1H D;  2K3R A;  2JPF A;  4LSH A;  1QL2 A;  4I50 E;  3UT5 E;  3TDK A;  2POR A;  3N2G E;  5ADX L;  1N73 C;  1PPJ D;  4Y99 B;  1D0Z A;  1SQP G;  2OYI B;  2XZR A;  3CC2 P;  1YQ4 A;  4IRE A;  1TU3 F;  1GL2 C;  3V2R A;  4ZI3 C;  2GUV A;  1NYH A;  1XZY A;  1NAF A;  4X64 T;  3TGU G;  1RY3 A;  3K3N A;  1MNE A;  3Q5E A;  1EDI A;  1XTG B;  3CXH D;  4WVZ A;  4RES B;  4DR4 T;  3FWL A;  3SYS A;  1VQ8 P;  3MP7 B;  2UXN B;  2PP6 A;  1BCC G;  3JC2 2;  1URQ D;  2FGR A;  3PTZ A;  2H7O A;  2ODV A;  1SQV J;  2E5V A;  2QA7 A;  3H1L E;  3P8C D;  4GCP A;  2O01 H;  3AE4 A;  3H3M A;  1HS7 A;  2PBI A;  3SY9 A;  1VQ5 P;  2I1J A;  3HKB E;  2R8A A;  2I0M A;  4G75 A;  1PL5 A;  2WPQ A;  2UUC T;  1OX3 A;  1SQV G;  3EFG A;  3WAK A;  5FMN A;  4FMS A;  3C4Z A;  5H2F O;  5LGT B;  3DA3 A;  1AJY A;  3EAM A;  4L9I A;  1ZOY A;  1V9D A;  4DR3 T;  1LTS C;  3KVA A;  4H63 V;  1G1J A;  1RE4 A;  4HH2 A;  2KLU A;  5KJ7 C;  2QE7 H;  3IHR A;  2XAF B;  1KIL A;  2O1J A;  1HF8 A;  1FJG T;  2XJ7 A;  3AEA C;  3HTK B;  4H0L C;  4HB1 A;  3SFE C;  4N3Y B;  1R8E A;  5LHI B;  2HG5 D;  2C9L Y;  2FUP A;  3MA9 A;  2MJZ A;  2Z5I A;  3W68 A;  2E5T A;  1W0A A;  3OYZ A;  1BGY D;  1URQ C;  4DR7 T;  4A98 A;  2OYH C;  1T1L A;  4OVN F;  1X79 A;  2XSA A;  2Q7C A;  1QUU A;  2VB6 A;  1XNR T;  3I9Y A;  4EYY Q;  4ZKU A;  4HFH A;  1SQQ E;  4CZZ B;  1AA0 A;  4H9N C;  3S1K A;  2LJL A;  2IZ0 A;  1HFA A;  2KIN B;  1N73 A;  3FWN A;  3KZI H;  3M9H A;  2WY2 A;  1FAV A;  5D5D A;  3CXH E;  3P4W A;  5HXH A;  5DJT B;  1L0V A;  1BCC E;  2BKO A;  2CPB A;  4PK4 A;  2JKV A;  1US7 B;  2JQK A;  4B86 A;  2WS3 A;  2M67 A;  3QNU A;  1R5S A;  4CI3 B;  2WZI A;  5J2T E;  5EK3 A;  3ITK A;  3K8P C;  4Z91 A;  2K37 A;  4ASK A;  1BGY J;  1NTM G;  1OVU A;  5APV A;  4NXN T;  4DV7 T;  4H13 B;  1H6S 1;  4FZN A;  3VKG A;  4JF7 A;  4DV3 T;  3A0H O;  2K1A A;  1EZ3 A;  4HFC A;  2YU1 A;  4DMV A;  4HWC A;  2BEZ F;  3JCF A;  4FJO A;  1LTI C;  1R5L A;  1BE3 J;  1LTJ A;  2R5D A;  3H1L D;  4OGQ C;  3L70 G;  2YKP A;  4AKH A;  4GHB A;  4M3L A;  1G2C A;  4GKJ T;  1ZOY C;  3H1J D;  2HPL A;  2FYN B;  1HUC A;  5FNV E;  5HEG A;  3RBZ A;  3RK3 D;  2YMY A;  3L8R A;  1JY3 P;  4QH5 A;  3ZCI A;  1ZLL A;  1D0X A;  2J4U P;  1Q2N A;  4LF8 T;  3VE1 A;  3VU7 H;  3PUQ A;  3L39 A;  2VKJ A;  4IL6 O;  3KZI E;  3X1D A;  3L72 J;  1BT9 A;  2YNY A;  4K3A A;  3HKE E;  3S4R A;  4WBO A;  3IA3 A;  4BJM A;  5GV0 A;  1L0N J;  5J1G A;  5IWA T;  2Q6Q A;  1YTZ I;  2PGD A;  2K9A A;  2NP9 A;  5AQV B;  3TK1 A;  1Q7Y Q;  4A56 A;  3RIA A;  4CQI A;  3BQI A;  2K4T A;  1YD8 G;  2Y6X A;  5JRE A;  2F1C X;  1Z8U A;  1SHZ C;  3VN0 A;  3WUT A;  3AEE C;  5HEH A;  3Q3D A;  3PGS A;  3D71 A;  2NTY A;  3HRN A;  4JI3 T;  2WSC H;  1SA0 E;  3CPZ A;  2B76 A;  2IML A;  3KVB A;  1KIL B;  4A97 A;  1OWA A;  2YDS A;  3VZU X;  5AQF B;  4ILU A;  5EZY E;  1THQ A;  1SFC A;  2E5L T;  3C1L A;  2W6J H;  2R6G F;  1FDI A;  4JI7 T;  1ZXG A;  2KLQ A;  3H32 A;  2E43 A;  2XQ7 A;  2QIW A;  1NTM E;  1L0N D;  2D5U A;  3PUY F;  1H89 A;  1KMI Z;  2QM7 A;  2BS3 A;  3RYF E;  4BRY A;  2O4V A;  3LBX A;  2WDV A;  1M1J B;  3B5N B;  2D0T A;  4NIQ A;  2R4N A;  3I55 P;  1OVV A;  2Q3I A;  3N7N A;  3C50 A;  2JRK A;  4K0U A;  2K9J A;  1BSN A;  4U7Y A;  3PU3 A;  1PP9 J;  1GFQ A;  3NTN A;  2W80 C;  4ILB A;  3ZEF B;  3ZT6 A;  4YTP A;  2P9B A;  3CX5 I;  1ZR4 A;  3ZLI A;  3N9Q A;  1ZP0 C;  2V6Y B;  5JDM A;  2WJQ A;  2B87 A;  1Y01 A;  4U31 A;  3RK2 B;  2WZH A;  2O01 N;  1KB9 D;  2XZE A;  1D0Y A;  1LTB C;  4I2L C;  2WM9 A;  3JAE A;  5CJ5 A;  5DL5 A;  4EZ4 A;  4O4X A;  2E9X D;  5AVU B;  4JI1 T;  1HG2 A;  1HWT C;  1CI6 B;  3PE0 A;  4CXX A;  3P50 A;  1J1J A;  2Q9Q A;  4H9S E;  3AA7 B;  2M0B A;  3SWK A;  2FYU G;  3L73 E;  2DWK A;  2WAU A;  3BCC J;  3UUB A;  5M4Y A;  2R3C A;  4HWH A;  1S35 A;  4JV5 T;  2A2F X;  2JQ9 A;  3PUR A;  4EOT A;  2CXD A;  2LKH A;  2KI7 B;  4IE5 A;  5TIS H;  4J2C A;  4AIS A;  1PV3 A;  2JEE A;  3AE1 A;  2N9D A;  1K05 A;  3PUA A;  3CWB J;  4WZX A;  4TNW A;  3ZMU B;  1IFJ A;  3HE5 B;  2KT9 A;  2VVS A;  4AKR A;  4AFK A;  2WQY C;  4WY4 A;  3AEG C;  5DQW A;  1SFC C;  5E79 E;  3CX7 B;  4AQF A;  3E22 E;  1FE6 A;  3FXD A;  4IE4 A;  5JRC B;  2IBZ D;  3CCJ P;  2WVP A;  4DZO A;  1VQN P;  3NVO A;  3MIW A;  3KDS E;  1BE3 G;  1MIV A;  2JQY A;  3RK2 D;  2MOZ A;  1UK5 A;  2ACZ A;  2E74 B;  2YPV A;  3C9I A;  3NKZ A;  5CHX A;  1KB9 E;  2MAW A;  3AAE B;  2F4V T;  5E79 H;  2JIW A;  3RQU A;  5LHG B;  2XTQ A;  3AAA A;  2O01 J;  4KI0 F;  1M56 D;  3GW6 A;  5AQJ B;  4X20 E;  1KF6 A;  4PJL A;  3HUS A;  2WPS A;  5KTB A;  1L2P A;  2HLO A;  1YW0 A;  1NTZ E;  4FSO A;  1IBM T;  1MM5 A;  4PV1 C;  5AW5 B;  4F6R C;  1MND A;  2W63 A;  5AW3 B;  4QXC B;  4LSE A;  2E75 C;  5AW1 B;  3P4P A;  2A9U A;  2YO3 A;  1SQX J;  4IIJ E;  2FYZ A;  5L4E A;  3RF1 A;  2E42 A;  1YBK A;  1KNR A;  4GIW A;  2UU9 T;  3U59 A;  1LKX A;  5LBM A;  2CRB A;  3RKG A;  1D1A A;  3UU3 A;  3WI5 A;  1L0L K;  4ZEY A;  3KV6 A;  1VF5 C;  1ZV4 X;  2LHR A;  3VMY A;  3GN5 B;  4C4V B;  2W0G A;  4PJ0 H;  2DCF A;  3ZCJ A;  1J1E C;  2WZ7 A;  3NFQ A;  2CBI A;  3AEA A;  3JCU O;  1CZQ A;  3RRW A;  2W2U A;  1PRN A;  1KYO I;  1JCC A;  1WCR A;  2KIK A;  1M90 Q;  1SQP K;  3V2N A;  1R8I A;  1OED E;  2ZFG A;  4DR2 T;  1X22 A;  4BJN A;  3D0T A;  4JI5 T;  2UUA T;  3WI4 A;  5IHY A;  5L3C B;  3RX6 A;  4K3B A;  1MFT A;  2N2M A;  4HFB A;  2OYH A;  3DTO A;  4MFR A;  3AA0 B;  2B1E A;  2LSJ A;  3RL0 g;  5HAX A;  2GM4 A;  2UXC T;  2OYI C;  5C3J A;  1OED B;  3POR A;  5APT A;  3EDU A;  3N9M A;  4TV8 E;  2LXC B;  1XNQ T;  5AFU K;  4JYB A;  2QGS A;  3PRJ A;  2AXT H;  3V5S A;  2KZ7 A;  1FJK A;  5LBQ B;  2ZM0 A;  4OYJ A;  2RN0 A;  4GIF A;  3UTK A;  2YEV C;  1FZC C;  4GCQ A;  2ZT9 C;  5ETW A;  3EVY A;  1VQM P;  2RA1 A;  1M57 D;  3AVS A;  1KQG B;  2GE4 A;  3R6N A;  2BCC J;  2WPV B;  1JY3 O;  3TGU J;  3VOP A;  5F3J A;  1KYO H;  3GA8 A;  4C46 A;  3AEF C;  2XQ8 A;  1HTJ F;  2MNH A;  2YK0 A;  2FJA A;  4P09 A;  3P4S A;  4AUW A;  3LK2 A;  2KWH A;  2H3R A;  2L9Q A;  3KVD D;  1DX7 A;  3CI9 A;  5AVR B;  2KZI A;  4YPC A;  4IDZ A;  2OV9 A;  4LSF A;  4DID B;  3UAQ A;  1IZN A;  3BCC E;  4GT1 A;  1PPJ E;  3ONX A;  1FZG A;  1VQ6 P;  4ILA A;  4OHF A;  3RL0 C;  5FVK A;  3CWB D;  2K24 A;  5AW9 B;  4HWI B;  1FZA A;  2ITA A;  1QSD A;  1UUS A;  2WMO A;  5AQM B;  4Y28 J;  2BBH A;  5JH7 E;  4ZZB A;  5FY7 A;  1L4A A;  1Q9F A;  3QH9 A;  2WPR A;  1OZH A;  1FDO A;  4EYY R;  4BRY B;  5G3A A;  1NO4 A;  3TLS A;  4D6T D;  4TNV A;  2A06 G;  2V7Q H;  3NZQ A;  1LWU A;  1JMB A;  4UVB B;  4N78 E;  2W62 A;  3A5T A;  1JNM A;  2ODU A;  4KJM A;  5AW7 B;  5ABE A;  2BKN A;  2Y9Y A;  3BAT A;  2HFE D;  3NZP A;  4NUU A;  4UB8 O;  1LT1 A;  2E2A A;  1KN7 A;  1EXI A;  3N9L A;  3H1K E;  1VOM A;  2WSS H;  1G1I A;  4H0L D;  2OTJ P;  4DV6 T;  2ZXX A;  4ISS A;  2IUB A;  3N4X A;  1LT9 A;  3TF5 A;  5JQG E;  2A45 G;  1EZV D;  2J1N A;  4X1K E;  4NXM T;  3A2A A;  3VZW X;  3T1H T;  5LP6 E;  1ORM A;  2I6H A;  4E1S A;  2GUS A;  2Y0D A;  2WSF H;  3R2P A;  2QRX A;  1RF0 C;  4YJ2 E;  3AXJ A;  3LJC A;  1J2J B;  1J1D B;  1Q90 D;  2C5I T;  3SZD A;  4PFO A;  1U5P A;  3Q5X A;  4UB6 H;  3RL0 D;  2HPJ A;  5JDN A;  2QVA A;  4YTP C;  3AA7 A;  5BU5 A;  3CXH H;  2KSR A;  4MLK A;  4FOZ A;  1BR1 A;  1YKH B;  3HKC E;  3EWK A;  1VRB A;  5JR9 C;  3CVR A;  3BRY A;  3TLT A;  4YT0 A;  4DUY T;  3U78 A;  3T24 A;  1RE4 C;  2JJL A;  1ZME C;  7PRN A;  1UII A;  2W27 A;  3D6Z A;  5AQP B;  2Q9Q D;  2LFU A;  3AEF A;  3Q1M A;  3JSV C;  1T7S A;  3DJB A;  3CKD A;  2LM9 A;  3RL0 B;  3CCU P;  2CLY B;  4ANJ A;  1GFN A;  1VQK P;  1SQQ G;  1LVF A;  3L75 D;  1G2C B;  5FY0 A;  4WYV A;  1YS5 A;  1MMG A;  4KP3 C;  3S4U A;  2LHF A;  1VQP P;  1BXW A;  3A3Y B;  3LSV A;  1L0L E;  3EDV A;  2WSS V;  1X79 B;  2LHN A;  3JAD A;  3RKO A;  1ZP0 A;  1JTH A;  3FXE B;  4X65 T;  4GKK T;  1LJ2 A;  4ZMD A;  3MGN A;  1YIT P;  4DBR A;  3USS A;  4O3Z A;  3I0Q A;  4L73 A;  4QXB B;  4HFV A;  2XAH B;  3FHN A;  2G8Y A;  4EDF A;  5LCY A;  1IO4 A;  1L0N G;  1M8O B;  4UB8 E;  2YIU C;  4U2Z A;  3AB3 B;  1VL2 A;  3U1C A;  5B66 E;  2BKP A;  3L72 D;  2Q9Q C;  4LC1 A;  1MV8 A;  2MKV A;  3PDY A;  2FKW B;  1SE7 A;  3AA1 A;  2V26 A;  3RH3 A;  4N59 A;  3PJS K;  5L4H A;  1J1D C;  3AE2 C;  5ABG A;  3HD7 D;  3AEC A;  3AA0 A;  3H1K D;  3H1J J;  4IL6 H;  3NRX A;  4O4H E;  3TLV A;  2KMF A;  1ZRT E;  4H13 C;  2J1D G;  4X1I E;  4PJN A;  4ZOL E;  2VAS A;  3VTP C;  1PGP A;  2FFD A;  2NPS A;  3L4F A;  3I9W A;  3UUN A;  4IE0 A;  2XY8 B;  1KQL A;  3EUH A;  1PGQ A;  5HXR A;  4WWI A;  2ZM2 A;  4TLF A;  2YKS A;  3PP5 A;  4PD4 D;  1D7M A;  1KZU B;  2C9N Y;  4EIW A;  1NU1 D;  4JEU B;  4AKR B;  3B13 A;  4EZH A;  3K3Q C;  3EAB A;  2H89 C;  1QEX A;  2M3B A;  4UEL A;  2J58 A;  3M0D C;  5EK2 A;  3UFE A;  4DR6 T;  2XND H;  1T6A A;  3V5B A;  2E76 B;  1EDL A;  5IYU A;  5CCH D;  3QC9 A;  4TN7 B;  1LTJ C;  1KNP A;  5HEO A;  2QJP B;  2XQ9 A;  3AE3 A;  3F5H A;  2X67 A;  5KLV D;  1KYO E;  4D64 A;  4KHZ F;  5CA1 E;  2VKD A;  3BS0 A;  1L0L D;  4PJM A;  3SRZ A;  1LTJ B;  4FRX A;  4ASW A;  2NOX A;  5CB4 E;  2AEM A;  3H1I D;  4AKM A;  3VHL A;  3A2S X;  2DW3 A;  1HTL C;  1YJN P;  2QJY C;  5APX A;  4H13 D;  1JCD A;  4PNI A;  3EMN X;  2AE9 A;  3P4Q A;  2W81 C;  4LSI A;  2ZT9 B;  2X68 A;  4ZZC A;  4N75 A;  2A72 A;  3RRC A;  2RP4 A;  2MHL A;  5K5G B;  3AE7 A;  2AXT E;  2Y7S A;  1JB0 J;  5AVX B;  2LOS A;  2FBW C;  3RYH E;  4IFD K;  3ZT7 A;  3O0E A;  4G2A A;  1BH3 A;  4AYN A;  3HL6 A;  2FJD A;  3Q9D A;  2B9B A;  4XE5 B;  2W66 A;  2W61 A;  2HPC B;  1LTG C;  5AW0 B;  4BWN A;  2O3J A;  5AW6 B;  3FX0 A;  3PTR B;  1N7L A;  2WB5 A;  5HEU A;  3RIU A;  2JQH A;  5LMU T;  2YXR B;  1HX1 B;  4ADZ A;  2WMN A;  2CLY C;  2WT7 B;  2V1D B;  1HVV A;  5JRC A;  3D6Y A;  3H32 B;  3EFF K;  1UIX A;  1MKM A;  5AQI B;  5AW2 B;  2L5G B;  5L8R J;  3I5C A;  3L74 J;  5IUX A;  2E74 C;  3B71 A;  3BAS A;  3BRZ A;  1OW8 A;  1WR6 A;  2W6A A;  2BG9 E;  4RO0 A;  3H1K J;  1GL2 B;  3RIF A;  3MHV A;  2WJR A;  4IE7 A;  2YN6 A;  4IFF A;  1JY3 N;  3DWO X;  4AKL A;  1KFM A;  4PFP A;  3Q5W A;  3ABV A;  3UU6 A;  2BEQ D;  5FYM A;  2CHN A;  2IIU A;  4JCH A;  4NPE A;  5KLI C;  1XMO T;  2F1V A;  1S1C X;  1KQS O;  5LGN B;  4UF0 A;  2C0X A;  4K0K T;  1RE3 C;  1L0N K;  2WSE J;  3OJA B;  3ZN0 B;  2YOE A;  3K3O A;  4Z8X A;  3RK2 C;  3TNU B;  1QLB A;  3MK7 C;  3KHU A;  2ZLY A;  3UU2 A;  4P0B A;  3FBZ A;  3E1I A;  3U3I A;  4IL4 A;  2OA5 A;  2Y48 B;  1HNW T;  1T3J A;  4PK6 A;  3SFD C;  1KK7 A;  3J9X 1;  2ES0 A;  4DVD A;  4TWD A;  1P84 D;  3L73 J;  3AE1 C;  2AXC A;  3W15 B;  3M9B A;  2EHO B;  1S3J A;  4UV8 B;  2VQF T;  1T2K D;  3RYI E;  2CE7 A;  5AQU B;  3A0B H;  1KOR A;  2MTQ A;  2K0L A;  3O1I A;  4WY4 C;  5AVT B;  4ZI2 D;  4Q25 A;  5ADX K;  4O4U A;  4WBA A;  4LML A;  1E54 A;  2M3E A;  3ZN1 B;  2PG8 A;  3F31 A;  4GK5 E;  2KXP A;  2CBJ A;  3ZMV B;  1XTC C;  3LID A;  1AVO A;  4RJT A;  4LGD E;  2YDR A;  3OA7 A;  3IN6 A;  3ZMZ B;  1K73 Q;  1RF0 A;  5KLV E;  5KAI O;  2SPZ A;  4L75 A;  3H1I G;  3L74 D;  2IPP A;  4CN1 A;  3BVH A;  2KSJ A;  5JDG A;  4CPG A;  1CI6 A;  4G63 A;  1D1B A;  3HI2 A;  5TIS E;  2ZYG A;  1BR2 A;  1LTT C;  3QB5 A;  4IHJ E;  2BCC E;  5L3F B;  1VQL P;  2C0W A;  5FVN A;  1W09 A;  1OED C;  3C64 A;  1USE A;  3QB5 K;  3T20 A;  2LLY A;  2JMH A;  4HFE A;  4IDN A;  1NH4 A;  1GK6 A;  1HCI A;  1DEE G;  4UXN B;  5AW4 B;  3UU8 A;  1HXX A;  2BG9 A;  1N32 T;  3AA6 B;  4A5X A;  2H7H A;  1GDT A;  2PFX A;  1NVO A;  1MMA A;  5H6Q B;  1YYC A;  1VCT A;  1A02 F;  4HKZ H;  2WSE H;  5CJ0 A;  3GF7 A;  3GF3 A;  1FU1 A;  4HN9 A;  3ZKR A;  1BGY G;  1NTM J;  1ZN5 A;  3MJX A;  1WRD A;  2OLT A;  1S2E A;  2JO1 A;  4AXP A;  1XDP A;  2FFD B;  1MZ9 A;  4YTN A;  1IFM A;  4AQG A;  1PP9 G;  1NEK A;  2E9X B;  4ERR A;  4IL6 E;  5LG3 A;  4DV1 T;  3SFD A;  1RH5 B;  1CUN A;  2W6B A;  3AXJ B;  4HKA A;  1GFO A;  1NTK G;  3ZMS B;  3CC4 P;  2H88 C;  2WU2 A;  1LTA C;  5F8P A;  3ZSS A;  3DWN A;  3AE6 C;  2ZT9 D;  2QA4 P;  3MXZ A;  3NXS A;  1ZHW A;  4BAY B;  2W83 C;  2X9W A;  3E1R A;  2A3D A;  1LVK A;  4YSX A;  2MYS A;  1BGY E;  2XUE A;  4B3T T;  1P84 E;  4U3F D;  2Y0L A;  4ZS2 A;  1AVY A;  4UB6 O;  2XPK A;  4W80 A;  3AEC C;  5B5E O;  5KLV G;  1H7C A;  5CGM A;  1HNZ T;  5JDQ A;  3P8M C;  3ZYL A;  5G39 A;  1X0T A;  4UF0 B;  3AEE A;  3BCC G;  1SQX K;  1JMM A;  2R3S A;  1HR0 T;  5AQO B;  1N7S B;  2KS1 B;  4HFD A;  4PD4 I;  1VPC A;  1UUR A;  4ZXL A;  1SLQ A;  2C0S A;  2XQ5 A;  3WUU A;  1RF1 C;  2VVN A;  4AIU A;  4CI2 B;  1EQ7 A;  3P7K A;  1FMV A;  2JJ9 A;  5LOV E;  3SOL A;  1X9B A;  4GF4 A;  1JO5 A;  2DNX A;  2R4L A;  3A0B O;  2HPC A;  3PJA A;  2OQQ A;  4GKG A;  3M0D A;  2V8S V;  5GON E;  3R84 B;  1NKN A;  4IL9 A;  1PPJ G;  3AE5 C;  2SPC A;  3AE2 A;  4W7Z A;  2BG9 C;  1N7S D;  2OMF A;  5AVY B;  1ZEE A;  1FJP A;  3H1J G;  1OW7 A;  1UGO A;  3Q5S A;  3IF8 B;  2OGU A;  3C51 A;  1Y9B A;  4D65 A;  2FFD C;  5APQ A;  3AED C;  4OX9 T;  2ZM8 A;  3L73 D;  3IR9 A;  4YXD A;  1JNZ A;  1EDK A;  1AFO A;  3L70 E;  3AA1 B;  3L3P A;  4W7Y A;  1KIL C;  2V7Q J;  2N2L A;  2BS2 A;  3GMI A;  3ZT5 A;  3ZST A;  5JVD E;  4D5U A;  2N1T B;  2A45 I;  4LMJ A;  2IBZ E;  1EZV G;  1GQE A;  1L4A C;  1N8R Q;  4C7R A;  4RKU J;  3HOL A;  3EI0 A;  1T98 A;  3L72 G;  1SP4 A;  2N1T A;  2H88 A;  2Y0C A;  3H1J E;  3CCM P;  4M1P A;  1URQ A;  4MBQ A;  2P7J A;  3ZYK A;  5KLV J;  2WTY A;  5DL7 A;  3AE3 C;  2PJQ A;  2EHO D;  2LR2 A;  5AVW B;  1KFN A;  3Q5R A;  4BA9 A;  1NU1 E;  1OPF A;  4I55 E;  2BDE A;  1SQX D;  1LP1 A;  1NGM B;  4U72 A;  3VY8 X;  3Q2Y A;  1N7S C;  4DO0 A;  3CX6 B;  3A7O A;  5A1L A;  4PUX A;  5KJ7 D;  3SWY A;  3PQU A;  1E1H B;  5DJQ C;  3H3A A;  2XQ3 A;  4B61 A;  2VKH A;  3N5L A;  3UIA A;  2UXB T;  4U2Y A;  1LNQ A;  5AVZ B;  2IX7 C;  1KIL D;  1YKE B;  2LSY A;  1IAP A;  4AKI A;  2BVL A;  3AEG A;  3KPE A;  4PW8 A;  2BS4 A;  3H1H E;  2X9X A;  2J4G A;  5KAF O;  2WIT A;  5AQS B;  2IFN A;  3H1L J;  1MM4 A;  3UUX B;  1GTW A;  1WFD A;  3JCU H;  5EFW B;  2GK9 A;  5C8Y E;  5FKY A;  4ASV A;  3ZJ2 A;  3RC8 A;  1OSM A;  2NPS B;  2KP8 A;  1NTZ G;  2QM8 A;  2KUB A;  2J62 A;  3MTU E;  5LNK A;  5AVV B;  4DR1 T;  1O3X A;  4U3F G;  1MPF A;  1N33 T;  4CI1 B;  1USD A;  2R89 A;  1BSH A;  3DP7 A;  2XQY A;  3G4S P;  2HR3 A;  1K04 A;  4RLC A;  2WWU A;  1QLE D;  3OYX A;  3CD6 P;  2YKO A;  4CTD A;  4JBW F;  4H0L B;  1ZHC A;  3FGA D;  3HUS C;  3N2O A;  2X9Y A;  4EYU A;  4TWF A;  2QEX P;  4IE6 A;  2M6I A;  1NTM D;  5APY A;  2QYW A;  4RLB A;  2A45 H;  3RLF F;  3G71 P;  1S5L E;  5HEJ A;  3PJA J;  5L2L A;  4JLE A;  2N2N A;  1VQ7 P;  3TGU E;  1S94 A;  2BZB A;  3UQ7 A;  2KK7 A;  3KXD A;  4L74 A;  3MD0 A;  2XAQ B;  3BRT B;  2FYU K;  2I59 A;  2ZYA A;  2X9K A;  3VE2 A;  3NWI A;  3WMM 0;  1YQ3 A;  1OMI A;  1CSB A;  2D0U A;  1VQ9 P;  3CCS P;  5J0Z A;  2YIU B;  3DA4 A;  2QJY B;  2CA5 A;  2OYI A;  1LRZ A;  2DLR A;  4R4M A;  2IYP A;  4CN6 A;  4LF9 T;  2B88 A;  1ZHY A;  4AYE C;  4C7N A;  3TZG A;  2IC6 A;  3V4W A;  3TGU D;  1WT6 A;  4OYK A;  1S9K E;  4PJ0 E;  4UV9 B;  1YQ4 C;  5CBN A;  4JI2 T;  1SQP D;  1EC5 A;  3TSI A;  4U7J A;  1WLX A;  5G38 A;  1KIL E;  2KYV A;  4LF7 T;  3V5U A;  4I7Z C;  3H1H G;  2FXO A;  4X66 T;  4HWD A;  1LP1 B;  4PD4 H;  4YJ3 E;  5ABH A;  3L70 D;  2Y8D A;  1JUN A;  1IJ5 A;  2R32 A;  3ANW B;  5KMG P;  3ZPO A;  4JBZ A;  4NPF X;  3POX A;  3L71 D;  5L3E B;  4XNK A;  4K35 A;  5FL0 A;  4H9O C;  5HXS A;  3ANW A;  5GTH O;  2J5U A;  2IC9 A;  3WAJ A;  4L5G A;  2E76 C;  2NR4 A;  3AE9 A;  2ERV A;  5LB7 B;  2KB7 P;  2R44 A;  5KDM C;  4AZL A;  4KHX A;  5KAI H;  4PD4 E;  1M1J C;  3B5N C;  2AEJ A;  1SFC B;  2CWY A;  4U74 A;  2WWV A;  5KKZ C;  3OVU A;  1J1E B;  1T8Z A;  5HXE A;  4D6T J;  4OGQ B;  4JI6 T;  2XV5 A;  1MUU A;  3AVR A;  2HH7 A;  2J59 M;  2H89 A;  1U57 A;  1JEK A;  5ABF A;  1S5L O;  1KB9 H;  5GTI O;  1N73 B;  1Y47 A;  4FUV A;  4KR4 A;  1NTZ D;  3UU5 A;  1VQ4 P;  3VKH A;  2RH0 A;  1J5W A;  5LHH B;  3M3Z B;  3POQ A;  2QSI A;  3OTO T;  4O2A E;  1E79 H;  5JDF A;  1IBK T;  2V4H A;  2YO2 A;  3CQG B;  3W67 A;  5FY1 A;  3OAK A;  3SWH A;  2J47 A;  3CX8 B;  3VR9 A;  1HGV A;  2D9D A;  3J7Y q;  4DBQ A;  2WMM A;  5FXZ A;  2AEF A;  2N1G A;  2V7L A;  4KRA A;  3M9Q A;  3MAC A;  3AAI A;  3VYI A;  1XWM A;  1EXJ A;  2CWO A;  4DMW A;  1BDD A;  4EIJ A;  3AA6 A;  2E76 D;  1SQX G;  1I6Z A;  4R4L A;  2CPT A;  4PK5 A;  4FSP A;  3GMA A;  3QWO C;  2IZ1 A;  2QJK C;  3IBP A;  3OKQ A;  2UUB T;  5H2F E;  4KBM B;  1IJ6 A;  1NWM X;  2YIN A;  1T16 A;  3LW5 J;  5HCM A;  1LWU C;  3PUX F;  5DAB A;  2X9H A;  5JR9 A;  1ZHT A;  2XQ6 A;  3RK3 C;  1EDJ A;  2OTK E;  2NWB A;  3WU2 H;  2POH A;  3M65 A;  5KXJ A;  1IFN A;  4U3F J;  1HG5 A;  4CXY A;  2AXD S;  2FYU E;  3L73 G;  5AQR B;  1WYB A;  3VY9 X;  6PRN A;  2C5K T;  2CPS A;  3LK4 1;  2E9X A;  3MUD C;  2XKM A;  1UX5 A;  5F5W A;  4WBN E;  3O8Z A;  4C00 A;  2XM2 A;  1T72 A;  1SQV E;  2Y0E A;  5CA0 E;  1NTM K;  5GTH E;  1NAY A;  1NTZ J;  1NTK K;  1SQB J;  2V6X A;  2YKQ A;  1N34 T;  1SQQ J;  2C5J A;  4O2B E;  3JCU E;  4U33 A;  5FXW A;  2L3L A;  4QWN B;  3SZV A;  2KXP B;  2IBZ I;  4EV6 A;  4JFB A;  4N78 D;  3CX5 H;  3LFM A;  5APU A;  5KAF H;  5AW8 B;  3H25 A;  4I43 B;  4AUI A;  1WR0 A;  2NW9 A;  1PGO A;  3H1I J;  3KQG A;  4DOJ A;  1S4X A;  2ZVN B;  5J2U E;  3SWF A;  3HD7 B;  2EHO A;  3UUM A;  3SYB A;  3VP8 A;  1L0L J;  1JOC A;  2FXP A;  2G3A A;  3CPW O;  3E08 A;  5EE2 A;  3CCL P;  2XE2 A;  3VMZ A;  3K19 A;  3I56 P;  3BCC D;  1GW4 A;  2M8R A;  2W67 A;  5CBO A;  3L70 J; 
#chains in the Genus database with same CATH homology
 4PK6 A;  5HYA A;  3PE0 A;  4CXX A;  1KK7 A;  4H63 H;  2ES0 A;  3J9X 1;  3LK2 B;  4OK0 A;  4DVD A;  4H9P C;  3UPG A;  2Q9Q A;  4IST A;  1FIO A;  4H9S E;  3AA7 B;  2DWK A;  5JR9 B;  2WAU A;  4BUM X;  2XAG B;  4UVA B;  4EB6 E;  2NW7 A;  3W15 B;  3GN5 A;  4FI5 A;  5AFU L;  1UX4 A;  5M4Y A;  2EHO B;  4UV8 B;  2JQQ A;  5FP3 A;  1S35 A;  3I0O A;  5JDL A;  3RYI E;  2CE7 A;  3N9O A;  1MIW A;  2A2F X;  3PUR A;  5JDH A;  2CXD A;  4IE5 A;  4NUV A;  1G8X A;  4J2C A;  4CXW A;  2BVM A;  2VL8 A;  2MTQ A;  2N9D A;  2K0L A;  3O1I A;  3PUA A;  3ZMT B;  4ZI2 D;  4IGU A;  4H9Q C;  2XAJ B;  4YHJ A;  2IW5 B;  4O4U A;  5ADX K;  1E54 A;  4WNK A;  3ZMU B;  3ZN1 B;  2KT9 A;  2PG8 A;  3F31 A;  4GK5 E;  2KXP A;  3PRN A;  3ZMV B;  2XG6 A;  3LK2 A;  4AKR A;  5DL6 A;  2XE5 A;  2YU2 A;  4AFK A;  3ZMZ B;  2G0U A;  3N9P A;  5DQW A;  3LK4 2;  3CX7 B;  2LEH A;  4AQF A;  3E22 E;  5JRC B;  4IE4 A;  3KDS E;  5JDG A;  4O4J E;  1MIV A;  4G63 A;  3JTY A;  2MOZ A;  1D1B A;  3HI2 A;  5TAO A;  3NSG A;  3N2K E;  2YPV A;  1BR2 A;  3GWH A;  4IHJ E;  5L3F B;  4P0A A;  3PUG A;  2KND A;  5FVN A;  3NBX X;  3AAE B;  3C64 A;  4AKG A;  5G26 A;  3T20 A;  4PJJ A;  2LE8 A;  5LJN A;  3F2E A;  4RJW A;  2JMH A;  3ZYM A;  5LHG B;  2XTQ A;  3AAA A;  2MBG A;  1HCI A;  2ODJ A;  2ACX A;  3MZK B;  4UXN B;  1HXX A;  2CM0 A;  3C4W A;  1FEW A;  5H6R B;  3CWZ B;  4KMC A;  3AA6 B;  4X20 E;  3RC3 A;  4PJL A;  3O9X A;  4C69 X;  1MMA A;  5H6Q B;  4HEA A;  4RJX A;  4ZI2 C;  1P4T A;  4O3X B;  5LYJ E;  1YW0 A;  4FSO A;  2X0L B;  2XHE B;  1MM5 A;  4F6R C;  1MND A;  2W63 A;  4HN9 A;  4QXC B;  4LSE A;  3MJX A;  4L0R A;  1WRD A;  2Y2X A;  1OXZ A;  4TX5 A;  2Q9Q B;  4AXP A;  3BQK A;  4IIJ E;  3SY7 A;  2XTR A;  2VK9 A;  1MMN A;  3KBT A;  2W00 A;  4AQG A;  5LJM A;  2E9X B;  4ERR A;  4GIW A;  1LKX A;  4WW0 A;  5LBM A;  4RL9 A;  1CUN A;  5DQV A;  2LSK A;  1D1A A;  4HKA A;  5E0O A;  3WI5 A;  1GFO A;  2KC0 A;  3ZMS B;  3KV6 A;  1ZV4 X;  2KDY A;  4TUY E;  5F8P A;  2LHR A;  3E0Z A;  3GN5 B;  4O3Y A;  4QQ1 A;  5JDP A;  2VKO A;  3MXZ A;  1ZHW A;  4AYD C;  2W0G A;  4BAY B;  2DCF A;  3ZCJ A;  2X9W A;  2A3D A;  1LVK A;  3QK6 A;  2MYS A;  3JC6 C;  3RRW A;  1PRN A;  2XTL A;  2UXX B;  2NTX A;  2XUE A;  2Y0L A;  4ZS2 A;  2LSG A;  2ZLD A;  1B7T A;  3AAA B;  3G7G A;  3HWB A;  2ZFG A;  3LK3 B;  4BJN A;  1H7C A;  4H9R C;  3SS1 A;  3AAE A;  3D0T A;  5JDQ A;  1QJP A;  3RPU A;  4TV9 E;  3ZYL A;  3WI4 A;  5IHY A;  4UF0 B;  3RX6 A;  5L3C B;  2N2M A;  4FES A;  5FXV A;  4I4T E;  4HE8 A;  3DTO A;  4EAH A;  4MFR A;  2H7V C;  3AA0 B;  3LK3 A;  2B1E A;  2LSJ A;  4ZS3 A;  4AQF C;  3PQS A;  5HAX A;  3IEE A;  5BMV E;  2C0S A;  4XBF B;  1HX8 A;  1GFM A;  3POR A;  3EDU A;  3L09 A;  3N9M A;  4TV8 E;  4CI2 B;  2V7K A;  4FZL A;  4QKN A;  4F4B A;  3VZT X;  4O49 A;  5AFU K;  2X66 A;  1FMV A;  2QGS A;  3V5S A;  2JJ9 A;  2KZ7 A;  1FMW A;  5LOV E;  1Z0P A;  3SOL A;  4GF4 A;  2DNX A;  5LBQ B;  2E8I A;  2ZM0 A;  4OYJ A;  3CML A;  3O1J A;  2XAS B;  4XAX B;  4C90 A;  1BR4 A;  2FGQ X;  4QX8 B;  3C4X A;  5GON E;  4YFS A;  3R84 B;  2CEA A;  3UTK A;  3WI3 A;  2SPC A;  2YEV C;  4GCQ A;  5ETW A;  3EVY A;  3AVS A;  2RA1 A;  3F57 A;  2OMF A;  3VE1 A;  1ZEE A;  4HTE A;  2D2S A;  4MHC A;  1G90 A;  2GE4 A;  3JC6 D;  3R6N A;  2V7M A;  3O1H A;  3V8U A;  3ETU A;  3IF8 B;  3C51 A;  3GA8 A;  4E7Z A;  3I1A A;  3N9N A;  4ZI3 D;  5F3J A;  2MNH A;  1HTJ F;  3GP6 A;  2YK0 A;  4D65 A;  3HA4 A;  3ZJ1 A;  2JMK A;  1KNZ A;  4P09 A;  2PRN A;  2ZM8 A;  2KWH A;  3KV4 A;  2H3R A;  2L9Q A;  3PU8 A;  4QXH B;  3ZC0 A;  3KVD D;  3AA1 B;  3L3P A;  3B57 A;  4IDZ A;  5L3B B;  2CCQ A;  5L3D B;  5FXX A;  2N2L A;  3GMI A;  4LSF A;  5HWX A;  3O4X E;  5JVD E;  2XE3 A;  4D5U A;  3UAQ A;  1IZN A;  3ONX A;  4OHF A;  2L8K A;  4C91 A;  2V7J A;  3HOL A;  2K24 A;  4TZ4 C;  1T98 A;  5LG4 A;  5T5F A;  1QSD A;  2WMO A;  3BK9 A;  3KIN B;  4M1P A;  4MBQ A;  5JH7 E;  3ZYK A;  4AYM C;  4UEM A;  5FY7 A;  3KFW X;  1Q9F A;  5DL7 A;  2PJQ A;  2EHO D;  1HXT A;  4JUY A;  4QX7 B;  4EYY R;  4BA9 A;  1OPF A;  1D1C A;  4YLH A;  1U4Q A;  4G76 A;  4I55 E;  3NZQ A;  2BDE A;  2LOP A;  2JPF A;  4LSH A;  4I50 E;  4UVB B;  2W62 A;  4U72 A;  3UT5 E;  3VY8 X;  4GCS A;  4DO0 A;  3RYC E;  2POR A;  2ODU A;  3N2G E;  5ADX L;  3CX6 B;  5A1L A;  1D0Z A;  4PUX A;  3OJA A;  3LBX B;  3LG7 A;  5LXT E;  3C5O A;  1E1H B;  3NZP A;  4NUU A;  3H3A A;  5DJQ C;  3PQU A;  4B61 A;  5PRN A;  2VKH A;  3N9L A;  3N5L A;  4ZI3 C;  1VOM A;  1NAF A;  4ISS A;  3BQL A;  5JQG E;  3K3N A;  1ZKE A;  1MNE A;  2J1N A;  4X1K E;  3VZW X;  2DHR A;  5LP6 E;  1ORM A;  4E1S A;  1YKE B;  2LSY A;  4O3W A;  1IAP A;  3SYS A;  4AKI A;  2BVL A;  2UXN B;  4YJ2 E;  1ZHX A;  2IAK A;  4PW8 A;  3LJC A;  2C5I T;  2X9X A;  2H7O A;  2ODV A;  2FGR A;  4XNL A;  2QA7 A;  3SZD A;  4PFO A;  3HOE A;  1U5P A;  3Q5X A;  3P8C D;  2HPJ A;  4PAG A;  5JDN A;  2Z6E A;  1MM4 A;  2LSI A;  4GCP A;  1Y64 B;  3UUX B;  3AA7 A;  1HS7 A;  4MLK A;  2PBI A;  4FOZ A;  3SY9 A;  4GK0 E;  1BR1 A;  2GK9 A;  5C8Y E;  3ZJ2 A;  3RC8 A;  1YKH B;  1OSM A;  4N58 A;  2DWG A;  3HKB E;  3HKC E;  1VRB A;  5JR9 C;  3CVR A;  4G75 A;  3C98 B;  4B6X A;  3QRA A;  5LNK A;  3U78 A;  3T24 A;  2F1T A;  1O3X A;  7PRN A;  2EHO C;  3WAK A;  1MPF A;  2Q9Q D;  5FMN A;  4UVC B;  4FMS A;  3C4Z A;  2LFU A;  4CI1 B;  5LGT B;  2XE1 A;  3DA3 A;  3DP7 A;  2XQY A;  4RLC A;  4L9I A;  2WWU A;  1V9D A;  5KX5 E;  3KVA A;  4H63 V;  3OYX A;  1IZN B;  3DJB A;  3CKD A;  1ZHC A;  2LM9 A;  4KUM B;  3N2O A;  2CLY B;  5IYZ E;  3IHR A;  4ANJ A;  2X9Y A;  1GFP A;  2XAF B;  1GFN A;  3T0S A;  1LVF A;  4EYU A;  4ZI7 E;  1HF8 A;  4IE6 A;  5FY0 A;  1YS5 A;  1MMG A;  4RLB A;  4KP3 C;  4GYS A;  3S4U A;  2LHF A;  5LHI B;  5L2L A;  4JLE A;  1BXW A;  2N2N A;  3Q2M A;  4QHO A;  4E1T A;  4UIG A;  1S94 A;  2BZB A;  3EDV A;  3MA9 A;  2WSS V;  2XAQ B;  2LHN A;  3RKO A;  4EXT A;  3OYZ A;  3FXE B;  4DND A;  2I59 A;  2Y0H A;  3VE2 A;  3ZC1 A;  4DBR A;  2D0U A;  4O3Z A;  3I0Q A;  4QXB B;  3FYX A;  4MAL A;  4HFV A;  2XAH B;  1X79 A;  3FHN A;  2CA5 A;  3DA4 A;  3QRC A;  1QUU A;  2VB6 A;  1LRZ A;  3T8O A;  2DLR A;  3I9Y A;  4CZZ B;  5LCY A;  1ZHY A;  4AYE C;  1MMD A;  4H9N C;  3TZG A;  2LJL A;  2IC6 A;  1HFA A;  3AB3 B;  2KIN B;  4OYK A;  2QTK A;  2Q9Q C;  4UV9 B;  3TKL B;  3FBL A;  3PDY A;  2K48 A;  3NRY A;  4GOU A;  2M06 A;  5D5D A;  3AA1 A;  2V26 A;  1WLX A;  3RH3 A;  4N59 A;  3KV5 A;  5HXH A;  3AA0 A;  3V5U A;  4PK4 A;  1US7 B;  3NRX A;  5LA6 E;  4O4H E;  2M67 A;  2KMF A;  1WYC A;  4HGA A;  2J1D G;  4X1I E;  4YJ3 E;  4CI3 B;  4PJN A;  4ZOL E;  2Y8D A;  2VAS A;  5J2T E;  5EK3 A;  2ZMA A;  3K8P C;  4GYR A;  1IJ5 A;  3ANW B;  5KMG P;  4ASK A;  3POU A;  3I9W A;  3UUN A;  3ZPO A;  4IE0 A;  4JEH B;  1H6S 1;  3POX A;  5L3E B;  3EUH A;  1ZHZ A;  4FZN A;  3A5X A;  5HXR A;  3VKG A;  2ZM2 A;  4XNK A;  2CXF A;  4H9O C;  3RBH A;  5HXS A;  3ANW A;  1G73 A;  1EZ3 A;  4XZC A;  2IC9 A;  3WAJ A;  4L5G A;  2YU1 A;  4DMV A;  4JEU B;  4AKR B;  3B13 A;  4FJO A;  4EIW A;  4EZH A;  2ERV A;  3K3Q C;  3HW9 A;  2X27 X;  5KDM C;  2NW8 A;  4U74 A;  4AZL A;  2CWY A;  4UEL A;  5EK2 A;  4FZM A;  3UFE A;  4AKH A;  5IYU A;  4GHB A;  5HXE A;  2HPL A;  2K5B B;  3QC9 A;  4TN7 B;  3HKD E;  3AVR A;  5FNV E;  2HH7 A;  4AYI D;  1MIY A;  2YNK A;  5HWY A;  2X67 A;  3ZCI A;  4D64 A;  4O4L E;  1D0X A;  5CA1 E;  2J4U P;  4KR8 A;  4FUV A;  1Q9G A;  2VKD A;  3VU7 H;  3PUQ A;  1HXU A;  2VKJ A;  4KR4 A;  3OBV E;  4PJM A;  3SRZ A;  3VKH A;  1BT9 A;  4FRX A;  2PFV A;  5LHH B;  2KZ7 B;  3CQX C;  3POQ A;  2NOX A;  5LGU B;  3ESL A;  3HKE E;  4O2A E;  4WBO A;  5JDF A;  5CB4 E;  4BJM A;  5GV0 A;  3CQG B;  3VHL A;  3A2S X;  4AKM A;  5J1G A;  5FY1 A;  5L3G B;  2V7I A;  3SWH A;  3CX8 B;  2DI4 A;  2K9A A;  4DBQ A;  2NP9 A;  4PNI A;  3J7Y q;  3EMN X;  2W81 C;  4LSI A;  5FXZ A;  2X68 A;  2N1G A;  2V7L A;  4A56 A;  2A72 A;  4CQI A;  3RRC A;  4KRA A;  2RP4 A;  3MAC A;  5HXC A;  2MHL A;  3AAI A;  3BQI A;  2K4T A;  1YD8 G;  2Y6X A;  3FB2 A;  5JRE A;  4E7S A;  2LT3 A;  2CWO A;  1SHZ C;  3HR0 A;  2Y7S A;  1AJ3 A;  4DMW A;  2LOS A;  8PRN A;  3KV9 A;  3RYH E;  3O0E A;  4EOZ B;  4G2A A;  1BH3 A;  3AA6 A;  4AYN A;  3HL6 A;  2Y0K A;  2WBL A;  4U9C A;  2NTY A;  3KBU A;  1QJ8 A;  4PK5 A;  4FSP A;  1SA0 E;  3CPZ A;  3KVB A;  3Q9D A;  1OWA A;  3OKQ A;  3IBP A;  3VZU X;  4KBM B;  3P7I A;  1IJ6 A;  1NWM X;  2YIN A;  2VWA A;  2E9X C;  2W61 A;  4ILU A;  5EZY E;  4X1Y E;  1THQ A;  5DAB A;  5DL8 A;  2X9H A;  3PTR B;  5JR9 A;  1ZHT A;  2NWB A;  3M65 A;  1BR0 A;  4CXY A;  1HG5 A;  2KLQ A;  6PRN A;  1WYB A;  3VY9 X;  2C5K T;  4OFZ A;  2E9X A;  3LK4 1;  4ADZ A;  2D5U A;  2WMN A;  4ZHQ E;  1UX5 A;  4WBN E;  2CLY C;  4V1A v;  2V1D B;  2XMX A;  4AI6 A;  3FXD B;  3RYF E;  5JRC A;  2O4V A;  5CA0 E;  3LBX A;  2CMR A;  2C5J A;  3ETV A;  4O2B E;  2D0T A;  3PUS A;  5FXW A;  2L3L A;  4QWN B;  3SZV A;  3C50 A;  2KXP B;  4O4I E;  2JRK A;  4K0U A;  1WR6 A;  4N78 D;  3PU3 A;  4FT6 A;  4JFB A;  1GFQ A;  2W80 C;  3ZEF B;  3LFM A;  2P9B A;  4FRT A;  3CQC B;  1PHO A;  4I43 B;  4IE7 A;  2JMM A;  3ZLI A;  4AUI A;  2NW9 A;  3N9Q A;  4AKL A;  4PFP A;  3Q5W A;  5JDM A;  4O8S A;  3MKD A;  5FYM A;  4JCH A;  5J2U E;  1QJ9 A;  2F1V A;  2EHO A;  3UUM A;  3SYB A;  5LGN B;  4UF0 A;  1D0Y A;  3QUJ A;  2CXL A;  4Z3T A;  2WM9 A;  2X51 A;  3E08 A;  5EK4 A;  3UUL A;  5DL5 A;  3ZN0 B;  5EE2 A;  4EZ4 A;  1UCU A;  3K3O A;  4Z8X A;  4O4X A;  2E9X D;  3MK7 C;  2XE2 A;  3K19 A;  2M07 A;  2ZLY A;  3UU2 A;  4P0B A;  3FBZ A;  3U3I A;  3H37 A;  1HG2 A;  2OA5 A;  2Y48 B;  2KWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...