1IZNB

Crystal structure of actin filament capping protein capz
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CapZ alpha-1 subunit
publication title Crystal structure of CapZ: structural basis for actin filament barbed end capping
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 88
structure length 270
sequence length 270
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 1iznB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1iznB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 1iznB02
3AAEA 3AA0A 3AA6B 3LK2A 2KZ7B 3LK3B 3AA7B 4AKRA 3AA0B 3AAEB 3LK41 2KXPA 3LK2B 3AAAA 4AKRB 3AA1A 2KXPB 3LK42 1IZNA 5AFUK 3AAAB 5AFUL 3AA6A 5ADXK 3LK3A 3AA1B 5ADXL 2KZ7A 3AA7A 1IZNB
chains in the Genus database with same CATH superfamily
2LHNA 5AQNB 2QJYB 1K04A 1HTJF 3FXDA 4EIWA 3ABVC 1GTWA 1L0NE 1VQ7P 2FYUD 4EDFA 2UUBT 3O1HA 4JYAT 1VQ8P 3HKCE 3RGLA 2CM0A 3SFDA 2KLQA 2E75C 2V7JA 4AZLA 3G3ZA 4JI8T 2R8AA 3GHGB 1YKEB 5C8YE 3L73E 2AEMA 4YSYA 2EHOC 2M3EA 4UV8B 1L4AD 1X9VA 3FHNA 3T20A 5JRCA 3USSA 2CHNA 1SQBK 3CX5E 3QB5A 4OVNF 4ANJA 4IDNA 2QJPC 4LLHA 2L3LA 4X20E 1ZHXA 1IFDA 4E7ZA 1KYOD 4F8HA 2H89A 4HKZH 3CD6P 2ZLYA 3H1HE 2PBIA 2WJRA 1H89A 2KS1A 1BH3A 1KB9D 2YXQB 2A06E 3HL6A 4IE0A 1JY3O 3H1KG 5CCHD 3ETUA 4GODA 2X68A 4YSZA 3TDKA 1FC2C 2WSEH 3AE2A 1EDKA 5HAXA 2FXOA 2LM2A 4JEUB 1N33T 4LMLA 4MN4C 3RH3A 2XE3A 1E5WA 1J1DC 1S5LE 1NVOA 3BRTB 1PL5A 1LJ2A 1L0NK 4WBOA 2RKLA 2AXTE 2WB5A 1GFMA 4N75A 1G2CA 4EXTA 3ZT6A 2P67A 1SQVE 5H2FE 3LDQB 3SZVA 3AAIA 3L75E 1S5LO 1D0ZA 3RK2C 2GUSA 2BG9C 1GL2D 2NWBA 4IFFA 4MBQA 1LTIC 4ADZA 2W4XA 1NGMB 2AXTO 2KK7A 5APTA 4WVZA 1T8ZA 2FBWC 3FZKB 3ONJA 1SUMB 5H2FO 1ZW0A 4HGAA 3VTPC 3PJAA 3UT5E 2KSRA 1SQPJ 5KAFE 1VOMA 4UF0B 3LK2A 5APXA 4G2AA 5FL0A 3OPCA 5KX5E 5F3JA 4HFVA 4WBAA 1P84E 4HWHA 4AYID 3KDSE 1NH4A 7PRNA 3AEFA 1LTJC 4O2BE 2DLRA 5KAFO 1ZOYA 1R8EA 2YO2A 4HJGH 3GF7A 1T16A 2RPAA 3PGSA 2QRXA 1EQ7A 4XE5B 3JAEA 3WUVA 3TGUG 1FJKA 1NTKJ 2I1JA 3CQGB 4E7SA 3L3PA 1IK7A 3A2AA 1N32T 3LIDA 4WWIA 1JY2N 2YDSA 4HTEA 4U2YA 3GG2A 3FXEA 1EZVD 4U2ZA 1G1IA 1BGYE 4R4MA 1L0ND 1T72A 1MNDA 1J5ET 2XAGB 3BRYA 4JI1T 4E1SA 2GE4A 2MKVA 2IHR1 1NTME 2K1AA 2R6GF 3P4SA 3MUDA 2ZM8A 3HUSB 1OWAA 4EYYQ 1MV8A 3HE5B 1IK9A 2XQ8A 4YTMA 3A3YB 3RKGA 2ZJSE 5AFUK 3D71A 2M5AB 1FDIA 1NAYA 1KILD 3A0HH 5FL1A 3M0AA 3SYBA 4XA4A 4C7RA 3EDUA 4O4HE 1HNXT 1D1BA 3KZIE 3AXJA 5GTHO 3JC22 1PP9J 2Q1KA 1CW5A 5KMGP 3LBXB 2UXNB 5JQGE 3N4XA 3QUJA 2CPTA 2O4VA 3S9OA 1EDJA 3KZIO 3I56P 1KFYA 1H6S1 2J5UA 2B87B 4O3XB 3GLMA 4JBWF 1QLBA 2OQQA 4EYUA 2QM8A 3H1HD 1XNRT 1MIYA 2MPKA 2Y6XA 2R4OA 4O9BA 1OZHA 2A06D 4C7NB 2JP3A 1HH0A 1L0LD 1HG5A 4NPPA 2YKPA 2A45H 3GMIA 3H1LG 5AQHB 1SQBJ 1VCSA 4H0LD 2OA5A 5F8PA 4AIUA 1K9MQ 4GT1A 2OYIC 3B71A 5L3BB 4PNIA 2KMFA 1JNRA 1LT9A 4KX6A 4BUMX 4DMWA 1JNMA 2BG9E 3Q5EA 2JKVA 5K5GB 1SQVD 1G73A 2VKHA 2XJ7A 1NTMK 2XDJA 5JR9B 1E2AA 2IZ0A 3CL3D 1YKHB 4QHOA 1KN7A 3ZDMA 3KVBA 4D5UA 1O3XA 2YKOA 1HCIA 1YQ4C 1D1AA 4QX8B 1FMWA 1YQ3C 4CI1B 1S72P 3ZYMA 1KQGB 4JBZA 2YEVC 1SFCA 3R84B 4JV5T 1PGPA 2IDBA 3L74E 3ESLA 1DIPA 3LK41 4X5TA 4UVBB 1L0VA 4N3YB 4UB8E 2VB6A 2WQYA 3IA3A 3VY8X 2ZFCA 4DR2T 1FDOA 4ZKUA 2KLVA 2KLUA 3WU2H 3FZMB 5LJNA 3LSVA 2WDRA 3MGNA 3SRZA 5AVXB 3L73J 4UB8O 2L5GB 4YTNA 3CMEP 3CPZA 4BJNA 3VZWX 1JMBA 3EABA 5LG3A 4X1KE 2ZYDA 2QIWA 5LB7B 1H8AA 2UUAT 3N9NA 1URQB 2Q3EA 3H3MA 1HJ0A 1YIJP 3GWHA 1NTMD 2E75D 3ANWB 5HXCA 3EHZA 2W90A 3L72G 2YMKA 3CQXC 5AQTB 1FZCC 2QJKB 5L47A 2K9JA 2EHOD 4M1PA 3PDYA 5FVKA 4AKIA 4U74A 3NVOA 4I50E 5AQIB 4IIJE 3RC8A 3UTKA 3PGRA 2IWWA 2J47A 2W00A 3PU8A 3ZKRA 3H1KE 1JUNA 5AQFB 5FY1A 3RYIE 4EEDA 3SWFA 4BRYB 4HE8A 3M0DA 3VE1A 4NXNT 3L75J 3ZPOA 1KYOH 2V26A 4ISTA 4N78E 3D6YA 3L35A 1HXTA 3HOEA 1VQ5P 1KB9H 2HLOA 1HNWT 1SQPG 4A5XA 1N2DC 2N1TB 1M90Q 2JJLA 4A98A 2RP4A 3P7IA 2E9XA 3C8VA 1MFZA 5DQVA 4EIJA 2KWHA 2KINB 1ZHTA 4XAXB 1LP1B 4XBFB 2ES0A 1IFIA 3TNUA 3LFMA 4ILCA 1FMVA 1BR4A 3MK7C 1YW0A 1LTAC 1K8AQ 4LMJA 3ITKA 1NTKG 3D6ZA 1VQLP 5LNKA 4H9SE 3V2PA 5IUXA 4HN9A 3OYXA 5LG4A 1AV1A 5DJUB 3C5OA 4RLBA 5DQWA 2VKDA 1OEDA 5AVVB 2D9DA 4OFZA 1BGYJ 4DR6T 4FUVA 3MIWA 2CRBA 3FX0A 2HHHT 3L74D 2W61A 1NHLA 1JTHB 4IE5A 3VKHA 1V9DA 2CEAA 5AQOB 3RRCA 2XQ3A 3KXDA 5HEGA 4WY4A 4ZI3D 4IL4A 4JI4T 3HD7C 1UIXA 4U3FG 2XQ9A 3QB5K 5ADXK 3F2EA 5LOVE 5CBNA 2CCQA 1J1EC 4YHJA 3L70E 2WWVA 4GKJT 1HXUA 1PP9G 3KBUA 1ZHYA 1OIPA 1UUSA 1WRDA 3KV9A 1RY3A 2LXCB 2XAJB 1LWUA 5M4YA 4GIWA 2OTJP 2WSSV 4IHJE 4O8SA 4U33A 5GV0A 2LOPA 1GL2A 3CMAP 1VQOP 2WCAA 3AE4A 5AQRB 1RF1B 2K3WA 1SQQE 2C0SA 5EK3A 1LTSC 4X65T 1J5WA 1WYBA 1LTTC 1NTZE 1MIWA 4DV4T 2W62A 1SQBG 3C98B 4C69X 4Q25A 4RKUJ 2FY8A 4EZ4A 5ABFA 4ZNCA 5LHIB 4O4XA 4K0UA 2WMMA 1KQLA 1QSDA 4AQFC 2B88A 2B1EA 3H1KD 5CJ4A 4IFDK 3PV0F 1T1LA 2IX7C 2FXMA 1WLXA 3OVUA 4NPFX 3ZMZB 1J2JB 1YJ9P 4X64T 3CX5H 4X62T 2WDVA 1N73A 3CC4P 2VQFT 1HTLC 3AEBC 2E2AA 3DZMA 2R3CA 2ZFGA 3O4XE 4CN4A 2KZ7A 3RIUC 3A8YC 3ZJ2A 1XNQT 2A45I 4P1NA 2OTKE 2FXPA 2X0YA 3CCRP 3EMNX 5KLVE 2XG6A 3OBVE 1KQFB 5FXZA 2V7QJ 2E74B 2XQAA 3UU4A 3POXA 1JY2O 3H32A 1S5LH 2NPSB 2L91A 2AEJA 2E76B 3GF3A 4RJTA 3PGUA 2AXTH 3L73G 2Q7CA 3B5ND 4NPEA 5AW4B 2CXFA 2Y8DA 5H2FH 2XE5A 1UX5A 3V8UA 5AVYB 1W09A 1SQQK 5KJ7C 4I2LC 3D0TA 3TGUD 2QG4A 1M7KA 3O6QA 1NTZK 5ABEA 1OXZA 1GD2E 4ZEYA 1M56D 1XDPA 4PAGA 1KF6A 3B57A 5KAFH 3N2OA 4FJOA 1P84H 5HEJA 2ZM0A 2CWYA 3H1HG 1T8BA 4CXYA 5AW1B 1XMOT 5AQQB 3RIAA 3F31A 2X9HA 3VR8A 2WVRA 2A06G 5KLIB 3UU5A 5CB4E 5L4HA 3H1JJ 4WY4C 1PPJE 1HXXA 2KDYA 3AA6B 1L4AB 2LFUA 2W63A 1YTZT 1E79H 3C4WA 2WY2A 1DEBA 4WW0A 2Q9IA 3VE2A 3P4PA 5KLVK 2J62A 5CBOA 1OEDB 1UX4A 3GHGA 3L75G 4TLFA 1HVVA 2WSSH 1GW3A 5J2UE 3T1HT 2KXPB 5LA6E 3POQA 3X1DA 4GF4A 2GA1A 1RE3A 1E7PA 4DV7T 2FYNC 1VQ9P 2C5JA 4LFAT 5GTHH 1RE4C 2KUBA 3I1AA 4EAHA 4YSXA 5L3GB 2H7HA 3ZMSB 4Y99B 2I1KA 1OW6A 2BS3A 2FFDB 3PORA 2ZYGA 2D2CC 3L8RA 3KDPB 3H1LD 1OW7A 1VQKP 3S1KA 4CQIA 3KZIH 2WMNA 4ZS3A 2X9KA 3ZYKA 3ZMUB 4GK5E 4PK5A 3AA0B 4XNLA 5AVZB 3POUA 5APUA 4JI7T 4JI2T 5DL5A 4CI2B 1UGOA 4TZ4C 5AW9B 2Y2XA 3R6NA 2YO3A 4KR8A 3MD0A 3D70A 1KYOI 2H43A 3BS0A 4EEBA 2V7MA 2BVMA 3N9QA 4YXDA 1NTKE 3KV4A 2WDQA 5L3EB 1KB9I 3PH0A 1BGYG 4N58A 5KAIE 4GOFA 5CCGC 3UUXB 2ZM2A 2LSKA 3CPWO 3BQIA 1NTMG 5F5WA 5ABFB 2Y0HA 5KAIO 2HODA 4XFJA 4IL6E 2Q9QC 3NBXX 4Z91A 2K48A 4AYNA 5FXVA 4LF6T 1GU5A 2JMMA 4LGDE 4FZLA 2YN6A 3L71E 3ZSSA 3PHLA 3AEEA 2MAWA 1HF9A 3T8OA 4UF0A 3OKQA 5CMZA 4IL6O 5IHYA 4OWFA 3EWKA 2F4VT 1N73B 4WBNE 3L70J 1WR6A 3JC6C 5KXJA 3MXZA 2IYOA 2IC6A 1AJYA 4JEHB 4HH2A 2YIUB 5B66E 2W83C 1PP9E 2I6HA 4CZZB 2YXRB 5AW0B 3HD7D 2HG5D 3CCJP 3A2SX 2VASA 2G0UA 5HYAA 2V7QH 4MFRA 4MHCA 2K4TA 5B66O 2C0XA 4UB8H 1ZHCA 2X67A 4PD4H 1LNQA 1SQQJ 2IYPA 4HFEA 1X79B 2WBLA 3H32B 1NTZJ 1QLED 2KOGA 3SYSA 1PIXA 1KILB 2VRSA 2IDOB 4U7IA 3SZDA 1PZQA 2XQ4A 4LMKA 2IMLA 4Z90A 1XZYA 4HFIA 2FGQX 3BQKA 4GKKT 3HA4A 3HUSA 2GUVA 2SPZA 4PK6A 4DR3T 3HE5A 3LW5J 1N7LA 4QH5A 2DWGA 4L75A 5H6RB 1RHZB 3CCUP 3V2QA 1QL2A 2D2SA 2M6IA 3S4RA 5AFUL 3BASA 1S3JA 3U1CA 4HFDA 4CI3B 3LBXA 1S9KD 2IW5B 2N1GA 1NKZB 4NUUA 2XM2A 6PRNA 3CMLA 1SQPD 4GOUA 2B87A 4H0LB 3L74G 1ZEEA 5KLVJ 4EYYR 2V6YA 1HG2A 2DNXA 2XTQA 3A5TA 4DZOA 2WITA 3QK6A 5CFBA 3CX5I 4JCHA 5GTIE 5BMVE 4AKRB 1BE3J 4C7NA 3H25A 4IE6A 2A2FX 4KT0J 1VDFA 3RYCE 4ZKPA 1AJ3A 3UPGA 4CPGA 5FMNA 1U57A 4L0RA 5GTIO 2ACZA 1NTKD 3G6EP 1DD3A 1SE7A 3QNUA 4GCPA 2ODVA 2Y0EA 1YTZI 2MYSA 2KB7P 1H7CA 4KUMB 1ZKEA 2YNKA 3KBTA 1ZHZA 3A5XA 4BA9A 3KFWX 1N7SD 5JR9A 4G75A 3M06A 5AQVB 3GP6A 2LKHA 3WUUA 1M1JB 3CWBJ 2C9LY 1LVKA 5HWXA 3CK6A 4GDOA 3PP5A 3SSUA 3PRJA 5KJ7D 3LK42 2Y0DA 3IFMA 2O3JA 4QQ1A 3DJBA 4U3FD 3NRYA 5E0OA 3J7Yq 2HPJA 5HXRA 2XTRA 2HFED 2V6XA 1GFPA 1T2KC 2W6AA 1PP9D 1FZGA 5IYZE 4ILAA 5AW6B 3VMXA 4GKGA 4B61A 2OTLP 1M57D 3K8PC 1XDOA 1P84I 3HRNA 4IOIH 2E75B 4AUIA 1ZP0A 1QX8A 2G8YA 1EDIA 3AE7C 2DI4A 3IN6A 2WAUA 4NIQA 3ZN0B 3DA3A 3P8CD 4ASWA 2H3RA 2HN1A 2XUEA 2WZ7A 2ZT9C 2EHOB 4U9CA 1FJPA 4KBMB 1IC2A 1NU1J 2HODB 2RH0A 2BBJA 4LF8T 1RF0A 2VK9A 2XQYA 1URQA 4H9NC 4LFCT 2J58A 4PV1C 2UU9T 4K35A 1SQBD 5L8RJ 4UVCB 2HR3A 3ANWA 1ZLLA 3PUVF 4QWNB 4LF7T 3A0BE 2QJPB 3VU7H 1N86A 2JQ9A 1HS7A 2JJ9A 1ZR4A 2QTKA 3O0EA 4I7ZC 4WB4A 3B5NA 2R4NA 1UK5A 2WMOA 4PJMA 3A0BO 5AVUB 2WPQA 3K3NA 2BEQD 4B86A 2N2LA 3GA8A 2D2CD 5CHXA 3HW9A 4OGQD 1IAPA 1A02F 5G3AA 4H9QC 1LTBC 2N9BA 3K3OA 2W0GA 3PUZF 1FZFA 3B8EB 5LHHB 4UV9B 4ZMDA 5AQJB 1J1DB 5AVQB 4BRYA 1U5PA 2X51A 2Z4EA 4YJ2E 2BKOA 3EFGA 4H44C 2QEXP 3L39A 1WMKA 2A3DA 2CWOA 3R4YA 5KKZC 2C5KT 2XPKA 4PUXA 1K73Q 2BG9B 3BQLA 3L71J 3N9LA 2NTXA 3UQ4A 2N1TA 2GM4A 5GTHE 4AKLA 3L70G 3L73D 3DWNA 5TAOA 3RL0g 3V5UA 1GQEA 3WI3A 1ZV4X 4M3LA 3EVYA 1IBLT 1LP1A 1NYHA 1SQXK 3SFDC 4U72A 2HH7A 5ETWA 1P4TA 2ACXA 5EZYE 2Q9QD 3ONXA 3TLVA 3CX5D 4H9PC 2P9BA 2VQET 4FOZA 4LFBT 1SQQG 2E5YA 5LMUT 2V6YB 5JDNA 1AVYA 2XU6A 3ZN1B 1NTZG 1LT1A 3JC6D 1D0XA 2SPCA 1JY3P 3ZMTB 2KIKA 2WWUA 1UCUA 4XNKA 1YJWP 2VL0A 4GHBA 2YU1A 2H89C 4E1TA 2BKPA 1JTHA 4QH1A 1Q9FA 2KZIA 3E7KA 4ZI2C 4D65A 3BCCJ 1NENA 5D5DA 3N2KE 1S35A 5HEHA 1JO5A 4J2CA 2X9YA 3Q3DA 3E22E 4WNKA 3PRNA 3AEDA 2X9XA 2LT3A 4EV6A 3AE2C 5HWYA 3RPUA 4ZZBA 4F4BA 4MALA 3L75D 1BDCA 1BR1A 3HR0A 3O1JA 2XV5A 5BU5A 4NPDA 5TJHA 4EOTA 3BVHA 5ADXL 4UB6E 1MMDA 2LKGA 2N2NA 2M0BA 5LBMA 1M62A 5C39A 3IEEA 2BASA 5KLVG 4OHFA 1KFMA 1QJ9A 2JIWA 3AA7B 3HE4A 2J4UP 4UB6O 2CPBA 2XZEA 1P84D 1XTGB 1RF1A 3BRVB 4D6TE 1URQC 5L3FB 1W2BO 3SWKA 4H13C 1BE3G 1BDDA 3VY9X 4PD4E 2M07A 3HKDE 4JLEA 3QC9A 5CA1E 4DCKA 3RBXA 1ZXGA 3AEFC 1KEYA 1ZOYC 1PFIA 1OSMA 3HWBA 2FJBA 1BGYD 4U7YA 5APYA 2N2MA 4YJ3E 2RN0A 1AA0A 1JEKA 1SA0E 3P7KA 2XQ5A 3AECA 3CWBG 3RK3C 1YXRA 2R88A 3PUAA 3CI9A 5LMNT 4LF9T 2X27X 1HGZA 3FZHB 4TNWA 1FEWA 2LEHA 3B5NB 3AEAA 3G71P 1PPJG 2Y9YA 2AE9A 5L4EA 2WTYA 1JCDA 2XY8B 4CXWA 3MUDC 2OGUA 5H6QB 3H1JE 4FRXA 4P0AA 2NPSA 5KTBA 5KAIH 3M91A 3G9RA 1Q9GA 3F57A 2CXLA 3L4FA 1XMQT 2WU5A 2BCCJ 3NFQA 3AE1A 3ZT5A 3ZLIA 1DEEG 3CCMP 4IL6H 3WAKA 2WSFJ 4G63A 1YBKA 5ABHA 3CCEP 2IIUA 4IT4A 3UFEA 2UUCT 4QXBB 4QH4A 2H7OA 1SQXJ 4W7ZA 3AAEA 3M9BA 1H0TB 1HNZT 2C5IT 2Q6QA 1Q86Q 3NWIA 5APVA 1T7SA 3MHVA 3V6IA 1FOSF 5B66H 1M7LA 4AFKA 1FZCB 2X66A 3P4RA 4GCQA 4A97A 5JREA 4TWFA 2JWDA 2X0HA 3RK2D 5AW5B 3Q5WA 5AVTB 5JH7E 1OW8A 3AE9A 3NKZA 4PV1D 4HWDA 3NRXA 3G7GA 2KP8A 2WS3A 4MLKA 2J4GA 1JOCA 3CXHE 1MIVA 3AA6A 1L4AA 1N8RQ 1LT9C 2R5BA 1MMGA 2B89A 2AXCA 1JMMA 2QA7A 3VP8A 3RQUA 5HXEA 4H9RC 1GDTA 3B4SA 3UIAA 1Z0PA 2QSIA 2LOSA 4YT0A 2KXPA 4JI5T 3A7MA 3Q5XA 2IFMA 4PD4D 2N9YB 3AE5A 3L71G 4DV2T 3CKDA 2JEEA 2QM7A 3OW2O 1MMAA 4I6MC 4EOZB 5HCMA 1RQVA 4AYDC 3SOLA 2FFDA 1SFCC 2FJEA 5FY7A 1GFQA 5CCHA 1AFOA 1R5LA 2KSEA 2V1DB 4RL9A 1USEA 4AYCA 2WQYC 4H44D 3AA0A 2ZYAA 1SS1A 2Y0CA 3RK3E 4ZXLA 2PTFA 2NW9A 5APWA 2IFNA 3VN0A 2MJZA 5C3JA 4AUWA 4IDPA 1BR0A 3H37A 2W27A 2KWIB 2V5DA 2OLTA 3L09A 3HE4B 4LC1A 3AE3A 3V5BA 4UELA 5GTIH 2O01N 1HBWA 1BSHA 2JWAA 2W8ZA 4LSIA 1OPFA 5CA0E 2O1KA 3WAJA 2CE7A 1QJPA 2R3SA 4X1IE 1LKXA 1HUCA 1PHOA 2NZ2A 5AVSB 3UUMA 4YLHA 3H1JD 5LCYA 2ZXEB 3BCCG 2KZJA 4X1YE 3ZCIA 4GCSA 3AEAC 2ODJA 4AXPA 2OV9A 1CHUA 2YDQA 1HFAA 3PTRB 3N7NA 2L9QA 3HD7B 1HJBA 4TV9E 5FXWA 1BR2A 1VQ6P 3IR9A 4GK0E 3CVRA 3TLTA 2D5UA 4PJNA 2V4HA 3RL0C 4N78D 1J1EB 3L37A 3W15B 3K5BA 1JCCA 3V4QA 3PUXF 5C2TA 3AA1B 3SFEA 2WJQA 4ZI2D 3M0DC 1T3JA 5LHGB 5ABGA 1PGQA 4HEAA 3RYFE 3PQUA 1BT9A 4O3YA 1VF5C 1OX3A 5BVZA 3QRCA 4D6TJ 4K0KT 1EXIA 4I0UA 1X79A 1IJ5A 3JCUE 4WYVA 1QGKB 4DO0A 1BXWA 1BE3E 1KILA 3GW6A 2E9XC 4AKGA 4EI2A 3DWOX 3FWLA 1FBMA 3VRAA 5DL8A 3LK3A 2WSFH 3JCUO 1UURA 1L2PA 3PUSA 5KDMC 3RLFF 5HXHA 5LGTB 1KNPA 2K3RA 4H13D 4AI6A 5E79E 3NJTA 4FI5A 1YS5A 1L4AC 2JQKA 3A0BH 3AAEB 3W68A 2LJLA 2Y48B 4DUYT 1EXJA 3DA4A 3AVRA 3RBZA 2ODUA 1CZQA 1HX1B 3QWOC 4PFOA 5E79O 3CWBE 1OEDC 2C9NY 3V5SA 3DTOA 2POHA 2K9AA 4U3CA 4C91A 4O2AE 1VQ4P 1DU2A 2P10A 4CTDA 4OYJA 3L70D 3AE8A 3H1IE 3RK3D 2NP9A 4Y99C 5LGUB 3TLSA 1LRZA 4AKRA 5BR8T 1ZN5A 2XQ6A 4C46A 2ZXXA 2XZRA 1T6AA 1N7SB 1ZR2A 3C64A 3IF4A 4JYBA 4HYTB 3OJAB 2W67A 1SQQD 2HPCB 2Q3IA 2AXDS 2H88A 4DR1T 1LWUC 1SQXG 2J59M 1NTZD 1ZRTE 1NU1E 4Z8XA 1BCCE 1IZNB 1GW4A 2E5TA 1AQ5A 5AQSB 3KPEA 2NOXA 1GL2C 4G76A 3AE4C 2P58A 3M9QA 1M1JA 3NZQA 4KP3C 4TWDA 4HFBA 1QUUA 2VVNA 1NAFA 2FGRA 3ZEFB 3AEGA 1X22A 3CX6B 4B3RT 2I0MA 2KT9A 4IDQA 1MPFA 4X66T 3VZTX 3Q5RA 3ABVA 3I9YA 5AQPB 4PK4A 1MM5A 2PGDA 2LSYA 2JQHA 4COFA 1E1HB 2YU2A 4BWNA 4DV5T 3HI2A 1N73C 4QXCB 1LTGC 1JY2P 5KLVD 1VQPP 2B76A 3PJAJ 4FT6A 1VQNP 3B13A 5AQLB 2FYUE 2E5LT 4B3ST 2Y0KA 2EHOA 3UUBA 5T5FA 2L8KA 4DV0T 2JQYA 3CLQA 2FYNB 1BE3D 5AW7B 2V5CA 2BVLA 3LG7A 5EK2A 5L3DB 5JDPA 2IPPA 2UWJE 1G90A 4P09A 5APSA 3O8ZA 2D2CB 2HYNA 3VKGA 3Q2MA 3M65A 2WT7B 3NTNA 4OGQB 4UB6H 3BK9A 1KILC 1NU1K 1THQA 5HEUA 5HEOA 1UIIA 4KI0F 2MTQA 5LYJE 4HWCA 4OH8B 1OEDE 4CN1A 1H88A 3IHRA 3F5HA 4N59A 1SFCD 1Q90D 4KR4A 3CWBD 2YINA 3EDVA 2IUBA 2QGSA 2XNDH 1J1JA 1WCRA 4KRAA 3AAAB 4ASKA 4GYSA 3KV5A 4FSOA 1S5LX 3T97B 1PPJD 2V8SV 3RI5A 1DD4A 4H9OC 4H63V 3LK3B 1Q2NA 2NTYA 5CJ0A 2QJYC 2BG9A 2Q9QB 3BCCE 4I1LA 3KINB 2FBWA 1Q82Q 1JNZA 2IC9A 2FYUK 2N9DA 3LIEA 3UU2A 3CX7B 2WWWA 2NRGA 5FVNA 1ZRTD 4QKNA 5JDGA 3H6PA 1NU1D 3TK1A 1GZLA 2PAJA 1LTJA 3O1IA 4YPCA 3GHGC 3H1LJ 3CC2P 4L9IA 2M3BA 1PGOA 4D6TG 3PUWF 1HF8A 1RE3C 2K37A 5AQGB 1ZHWA 4QMAA 2JRKA 4FZNA 3RL0D 2XE1A 3M9HA 3KQGA 2DCFA 1Y47A 3CCSP 2F1TA 3UU3A 1PGJA 1M1JC 2G3AA 2K9YA 1VRBA 3CQCB 3ZJ1A 2W80C 4C4VA 2E42A 3I9WA 3ZMVB 1VF5D 3AEGC 4DV1T 3TKLB 1MFTA 2XSAA 2X0LB 2XHEB 4ISSA 1EZVE 5L3CB 1VPCA 4JYCA 2X9WA 3VP9A 2XQ7A 4A7PA 1G1JA 2WPSA 5G26A 4AKHA 1MMNA 2K88A 1YYCA 2E9XD 1BSNA 2C0WA 4YXDC 2W6BA 1N34T 3KV6A 3B5MA 3CIRA 2DHRA 2Y9ZA 3L71D 2IBZE 2CLYB 2OYHB 3WI5A 1Q7YQ 4YFSA 1GFOA 1KILE 3CXHH 4TV8E 3AA7A 3H1JG 1ZMEC 4N74A 4AKMA 3H1IJ 3LJCA 3FYXA 1GMJA 3TSIA 2WSCJ 1KNZA 1FAVA 4AYEC 3I0QA 3SS1A 1CI6B 2YNYA 3HOLA 4HFHA 3AEEC 3T24A 3P8MC 2WP9A 2H8PD 2BEZF 4GIFA 3ZSTA 3OAKA 2BCCE 1CSBA 4TT3H 3L72J 4K3AA 2M67A 3C51A 2OYIA 4UIGA 2LSGA 4WY4D 2D0TA 2M8RA 4N6JA 1L0LE 3MZKB 1BCCJ 1LGHB 1SQXE 2YKSA 5J0ZA 4DR7T 1EDLA 2YOEA 2BS2A 1I94T 3BCCD 4H63H 1WYCA 4AQGA 1YQ4A 3T1YT 2XMXA 1YQ3A 1YITP 3PU3A 2MBGA 2Z6EA 4OK0A 4DBRA 4JFBA 3CC7P 5EE2A 5FVLA 1WT6A 3Q5PA 3HUSC 1B7TA 3KVDD 1W2EA 5FKYA 3O9XA 5AW8B 4IFMA 3UQ7A 4PJ0E 1YD8G 2PORA 1WR0A 3MA9A 1VCTA 4C90A 1IFJA 3VOPA 4IDZA 3JAFA 1Y64B 2V7LA 2BS4A 2KNCB 4FMSA 3RHWA 4I4TE 4PR7A 5AVWB 2XKMA 2UXDT 4PJ0O 1FZAA 5HXSA 2ZVOB 2FYUJ 1ORMA 3RIFA 3C4ZA 2BKNA 4IREA 2ZT9B 2R4LA 4CXXA 2PFVA 3II6A 2UXXB 3RK2B 4QXHB 3LW5H 5CGMA 3U1AA 5FXXA 4EGWA 1H0TA 4PV1B 1EZ3A 1IBMT 5LXTE 4B6XA 3RKOA 4ZI3C 2LM9A 3PUQA 2I8DA 3H3AA 5CCGD 2KYVA 3GMAA 5M1BA 1L0LK 3NSGA 1FZCA 4I7ZB 4ZHQE 1WRGA 2LRKA 3Q1MA 4L5GA 4KJMA 4ILBA 5TISE 1LTJB 2DWKA 3FB2A 3SWHA 2JQQA 4RESB 4YTPA 3SY9A 2JMKA 5LJMA 1T3UA 1WFDA 5TISO 3JCUH 4Z3TA 1IBKT 2IBZD 1S1CX 1SQVK 4U3FJ 2JDIH 1FDMA 3ZC1A 4DV3T 4RJWA 2LSIA 5JR9C 2YDRA 3QH9A 4PW8A 2LHFA 3P4WA 2UXBT 4H44B 3J9X1 4C4VB 2E8IA 3RC3A 2XE2A 3MTUE 5B5EE 5E79H 1FIOA 2NW8A 5AW2B 1RQUA 5KKZB 5L2LA 2ZLDA 2YKQA 5EFWB 3FXDB 1KTMA 4QX7B 2YMYA 4OX9T 2BCCD 5DL6A 2M06A 2LRLA 5B5EO 2WM9A 4PD4I 5DJTB 1NEKA 2W6JH 1I6ZA 4C00A 2LSJA 5DABA 3NZPA 3FWNA 1FU1A 1T98A 4O3WA 1SQXD 2ZM6T 1ZP0C 1U7MA 3KVAA 4HWFA 2O1JA 2PRNA 4RLCA 2WSCH 5FP3A 4B3TT 1FJGT 3E1IA 2OMFA 5JVDE 4LSFA 5G39A 1RF0C 1VQMP 3U78A 2BZBA 4FQEA 1ZV8A 1IO4A 1GU4A 4ILUA 5JRCB 1IFNA 3RX6A 4NXMT 3UU6A 1R8IA 2MNHA 1KFNA 1Z56A 2E5VA 2QVAA 3OYZA 2VL8A 3G4SP 2J1DG 4DR5T 3C1LA 4ZS2A 3PLNA 1IJDB 1XTCC 2QJKC 4FZMA 1XWMA 3B5NC 3EQ2A 4L76A 3F89A 2KS1B 4ZOLE 3MKDA 2OYIB 1FZEA 2Z5IA 3TLWA 1KZUB 4UR9A 1L0NJ 3HD7A 4TUYE 5APQA 2FJAA 5DJQC 3G06A 3OA7A 1OMIA 5IYUA 3AA1A 2A45G 5FYMA 2CXDA 2O01J 5AW3B 2WZHA 1X9BA 4HKAA 2XAHB 1G2CB 3Q5SA 3N5LA 2KSJA 3H1IG 1U4QA 1E54A 2FYZA 3CCVP 2R44A 4EZHA 4PFPA 1MKMA 2CBJA 4H13B 2N1TC 3VMYA 4JUYA 4DMVA 1Y8AA 2W81C 4KMCA 1S4XA 2K0LA 1NO4A 4DOJA 3P4QA 4AYMC 3FBZA 3LK2B 4JPZB 4AQFA 1N36T 3H1HJ 1G8XA 2B9BA 1NU1G 4KHXA 3EUHA 4DUZT 4DNDA 1BCCG 1NKNA 1L0LJ 3FBLA 5G38A 3IF8B 2ITAA 1T2KD 3CXHI 4YTPC 3HKBE 4B3MT 2ERVA 4F6RC 3RK3B 1W9RA 2K5BB 4HFCA 3AEBA 4LSHA 2P7JA 4CN6A 2OYOA 5JDMA 4DT0A 3RIUA 3FXEB 3I5CA 3UFGA 3C9IA 2XNXA 2ZT9D 5CJ5A 3AVSA 1SQVJ 3TYYA 1CUNA 2WU2A 4PJLA 4DJGA 4GOEA 1USDA 2FKWB 5PRNA 3L36A 4JI6T 4YHHT 2R32A 2RA1A 4IL9A 3JCFA 3QRAA 2PG8A 2MOZA 5HCJA 4XZCA 1NJIQ 2ZVNB 3CWZB 3AEDC 1N7SA 2LE8A 2PP6A 2LR2A 2FYUG 2CA5A 3K1SA 2R4PA 1HWTC 1MNEA 3OJAA 4D6TD 1D0YA 3AE6A 3AXJB 2UXCT 2Y0LA 2HPCA 5KJ7A 3FGAD 1KNRA 2NR4A 3P50A 2ZAEB 1NWMX 1HR0T 1DX7A 2PJQA 3UU8A 3VMAA 1KV4A 1IZNA 2K24A 3JSVC 3MZWB 1RH5B 2M6BA 1GK4A 5JDLA 3K3QC 4P0BA 1RF1C 1PRNA 3R2PA 1AQTA 1QVFO 3WMM0 3TGUE 5LBQB 1IFMA 1QL1A 3VZUX 3BATA 4TX5A 3K19A 2LLYA 5AQUB 3BRZA 2QYWA 2A9UA 2QE7H 2FUPA 1NTMJ 1SP4A 2A72A 4AQYT 3CCLP 4IE7A 4YY3T 2DW3A 3IAOA 4LF5T 4I55E 1US7B 1LT9B 2I59A 2FJDA 4NUVA 3RQWA 4BAYB 1Y9BA 3AECC 2CHOA 1QEXA 3PQSA 1KQSO 4JF7A 2BBHA 5IWAT 2WPVB 2DL1A 3RF1A 1JM0A 4YXWH 4I43B 2IZ1A 4UXNB 1S2EA 3QOFA 5FY0A 1RE4A 2AEFA 4DVDA 1SFCB 2KC0A 3E0ZA 2CK3H 4TNVA 2E74C 1JY3N 4RO0A 2WT7A 2NPSC 2O01H 2E76C 1FOSE 1R5SA 2W2UA 1FZBA 2QA4P 5AQMB 5EK4A 5LP6E 2J1NA 3AE1C 3ZYLA 2VKJA 2CMRA 3H1LE 5A1LA 4GYRA 3HTKA 3VR9A 4K3BA 3UUNA 2IAKA 1PV3A 2YK0A 1A02J 2H7VC 3RGUA 3GN5A 3EAMA 4AISA 2P1JA 3AAAA 4HB1A 3I55P 5CCGA 4JI3T 4L73A 3A0HE 3T97A 3CXHD 1JB0J 1YI2P 5KLIC 1GK6A 1EZVG 2K9JB 1Q81Q 3W67A 3S4UA 2Q9QA 1L0NG 3Q9DA 3A0HO 1URQD 3EFFK 3P32A 3AE9C 1S94A 2VURA 2F1CX 4IL6X 4ZZCA 3L74J 1D1CA 3N9MA 2XM1A 1DH3A 5J1GA 3U59A 4PJJA 3NMDA 1NOHA 3RL0B 1YJNP 3I0OA 2IBZG 2HPLA 1SHZC 1N7SC 2WZIA 2CPSA 3PTZA 4WZXA 1SVFA 4DBQA 2Y7SA 2JR8A 3RYHE 4ERRA 4Y28J 3ETVA 3U3IA 3AE6C 3EI0A 5J2TE 5JDFA 4DR4T 4KHPT 2XTLA 3T0SA 4LF4T 3SY7A 3C50A 3AE5C 1VF5B 4PJ0H 3PUGA 4IDOA 2Q5UA 2FFDC 3TLUA 2CBIA 4UVAB 5CCHC 4V1Av 1MUUA 2BCCG 1VL2A 2WVPA 1D7MA 2E9XB 4TWHA 1QJ8A 3HKEE 3VRBA 2F1VA 2MHLA 3V2NA 5AVRB 3L72E 1L0LG 4L74A 4O4JE 1MM4A 2P2UA 3TNUB 2D0UA 4K3CA 3N9PA 1OVRA 3PUYF 2N1TD 8PRNA 2ZMAA 3N9OA 3AE3C 4W7YA 3H1KJ 1FE6A 5AQKB 4FESA 2Z5HA 1U7JA 1YHQP 3A7OA 4A56A 5TISH 1HX8A 1SQVG 2OYHA 3VMZA 3WU2E 2LXBA 4Z1MH 4U31A 2XSBA 4IE4A 1OVVA 4HWIB 5JTGA 5GONE 4TN7B 3WU2O 4WY4B 1CI6A 1QVGO 1LVFA 1S9KE 1KC8Q 2PRRA 2VWAA 3TZGA 4OGQC 1SQPE 1MZ9A 2V7KA 2KNDA 2NW7A 2GK9A 3C4XA 2YIUC 4BJMA 4O4UA 5B5EH 1SLQA 3SFEC 1IJ6A 3MACA 3UAQA 3WUTA 3E1RA 3DP7A 2XAFB 1X8YA 1LWUB 2R5DA 4ZI7E 2XASB 3FZLB 3M3ZB 1OVUA 3NXSA 3PE0A 4FSPA 1GL2B 3E08A 4LSEA 4KHZF 3TGUJ 2WSEJ 3VYIA 1KMIZ 4W80A 1KD1Q 3ZC0A 3Q5DA 2JO1A 2XAQB 4O4LE 4O49A 2JMHA 2HN2A 1HGVA 1K05A 5FNVE 3MP7B 3VHLA 2LHRA 1TU3F 4U7JA 2RMZA 2YPVA 1KK7A 3HTKB 1Y01A 1KORA 2OARA 4D64A 1KYOE 1GFNA 3PURA 4UEMA 1X0TA 4RJXA 1KB9E 3PJSK 3GN5B 3ZT7A 4U3FE 4EB6E 3JTYA 1W0AA 2KNCA 3CX8B 5LGNB 4JQ0D 3N2GE 3H1ID 4AQRD 3AE7A 3RRWA 2KZ7B 5DL7A 3JADA 4R4LA 2VKOA 2JPFA 3TF5A 3ONLC 4DV6T 1SQPK 2IWVA 2W66A 4O3ZA 2KI7B 4OYKA 4H0LC 1NWQA 2E43A 3UULA 2VVSA 3AE8C 3ZCJA 3P8CE 3L72D 1EC5A 5JDHA 3CCQP 3KYQA 1W5CE 1OFCX 3PF1A 4DIDB 1FS0E 1AVOA 1BCCD 3V2RA 2WPRA 3SWYA 2V7IA 1SQBE 1IFPA 1NTKK 4ASVA 3OTOT 1M8OB 3MJXA 4JI0T 1M1KQ 3IBPA 2H88C 5BU8B 2R89A 1EZVI 3O6QB 2E74D 4BXLA 2M5AA 2NPSD 4FRTA 2E76D 3FZFB 2LKMA 2PFXA 1Z8UA 4O4IE 3V4WA 3AB3B 3Q2YA 3KHUA 1W0BA 5JDQA 3RBHA 3WI4A 2BDEA 2CLYC 4IGUA 2OYHC 2IBZI
chains in the Genus database with same CATH topology
2LHNA 4PW8A 2QA7A 5HXEA 2LHFA 1HXXA 2KDYA 3AA6B 1HTJF 3J9X1 4EIWA 4H9RC 2LFUA 2W63A 1Z0PA 2E8IA 3RC3A 3C4WA 2XE2A 4WW0A 2NW8A 1FIOA 2LOSA 5L2LA 2KXPA 2ZLDA 3VE2A 3FXDB 3Q5XA 1UX4A 4QX7B 3O1HA 2M06A 5DL6A 3CKDA 3HKCE 5J2UE 3POQA 2KXPB 1MMAA 2CM0A 2WM9A 5LA6E 4EOZB 4GF4A 2KLQA 4AYDC 3SOLA 2V7JA 4AZLA 5FY7A 1GFQA 2C5JA 1YKEB 2LSJA 5DABA 3NZPA 5C8YE 2V1DB 1T98A 3I1AA 4EAHA 5L3GB 4O3WA 4RL9A 2EHOC 3ZMSB 4UV8B 3AA0A 3PORA 2PRNA 3KVAA 4RLCA 3FHNA 2NW9A 3T20A 4CQIA 5JRCA 2WMNA 4ZS3A 3ZYKA 3ZMUB 4GK5E 5FP3A 4PK5A 3AA0B 4XNLA 2OMFA 5JVDE 4LSFA 4ANJA 3POUA 3U78A 2BZBA 1BR0A 3H37A 2L3LA 2KWIB 4ILUA 4X20E 5JRCB 1ZHXA 4E7ZA 3RX6A 3L09A 5DL5A 2MNHA 4UELA 4CI2B 4TZ4C 2ZLYA 2Y2XA 3R6NA 2PBIA 1OPFA 4KR8A 4LSIA 3OYZA 2VL8A 2J1DG 1BH3A 4ZS2A 5CA0E 3WAJA 2CE7A 2V7MA 4FZMA 1QJPA 4X1IE 2BVMA 3HL6A 3N9QA 1LKXA 3KV4A 4IE0A 1PHOA 5L3EB 3UUMA 4YLHA 3ETUA 4ZOLE 3MKDA 5LCYA 4N58A 2X68A 5HAXA 4JEUB 4X1YE 3UUXB 2ZM2A 2LSKA 3ZCIA 3RH3A 2XE3A 4GCSA 3BQIA 2ODJA 4AXPA 4TUYE 5DJQC 2Y0HA 1HFAA 3PTRB 2L9QA 4WBOA 4TV9E 5FXWA 1GFMA 1BR2A 2Q9QC 5IYUA 3NBXX 4EXTA 2K48A 5FYMA 2CXDA 5FXVA 4GK0E 3CVRA 2JMMA 3AA1A 4AYNA 2D5UA 3AAIA 4FZLA 3SZVA 4HKAA 1D0ZA 4PJNA 4N78D 2XAHB 2NWBA 3W15B 4MBQA 3T8OA 4ADZA 4UF0A 3AA1B 3N5LA 3OKQA 1U4QA 5IHYA 1E54A 4ZI2D 4WBNE 1WR6A 3JC6C 5LHGB 4HGAA 3MXZA 3UT5E 2IC6A 4HEAA 3RYFE 3PQUA 4JEHB 4EZHA 1VOMA 4PFPA 4UF0B 3LK2A 4G2AA 5KX5E 1BT9A 5F3JA 4JUYA 4DMVA 4O3YA 4HFVA 2W81C 4KMCA 3QRCA 4CZZB 2K0LA 4AYID 3KDSE 4AYMC 7PRNA 3FBZA 3LK2B 1X79A 1IJ5A 4O2BE 2DLRA 2VASA 2G0UA 3A2SX 5HYAA 4MFRA 4MHCA 2K4TA 4AQFA 4DO0A 1G8XA 1ZHCA 2X67A 1BXWA 2E9XC 4AKGA 3EUHA 2WBLA 4DNDA 5DL8A 3LK3A 3CQGB 3FBLA 3IF8B 3PUSA 4E7SA 5KDMC 3SYSA 3L3PA 3HKBE 5HXHA 5LGTB 3SZDA 4HTEA 4AI6A 2ERVA 4F6RC 4FI5A 1YS5A 2FGQX 2K5BB 3BQKA 3HA4A 1MNDA 4PK6A 4LSHA 3AAEB 2XAGB 2Y48B 2LJLA 5JDMA 3DA4A 3FXEB 3AVRA 4E1SA 2GE4A 2ODUA 2DWGA 5H6RB 4PFOA 3AVSA 1CUNA 2ZM8A 4PJLA 1OWAA 3V5SA 5PRNA 3DTOA 2K9AA 5AFUK 2D2SA 4C91A 2RA1A 4O2AE 5AFUL 3QRAA 2PG8A 2MOZA 4XZCA 4CI3B 3LBXA 2IW5B 3SYBA 2N1GA 3EDUA 4O4HE 4OYJA 1D1BA 4NUUA 3CWZB 6PRNA 2NP9A 3CMLA 5LGUB 4GOUA 1ZEEA 4EYYR 5KMGP 2LE8A 3LBXB 1LRZA 4AKRA 2CA5A 1HG2A 2DNXA 2UXNB 5JQGE 3QUJA 2XTQA 1MNEA 3OJAA 1D0YA 2O4VA 2Y0LA 1H6S1 3QK6A 4JCHA 4O3XB 5BMVE 3C64A 4AKRB 1NWMX 4IE6A 2PJQA 4EYUA 2A2FX 1IZNA 1MIYA 2K24A 3RYCE 1AJ3A 3UPGA 5FMNA 2Y6XA 5JDLA 3K3QC 4P0BA 1PRNA 4L0RA 1HG5A 3GMIA 4Z8XA 4GCPA 1IZNB 5LBQB 2NOXA 4G76A 2ODVA 2OA5A 3VZUX 2MYSA 4KUMB 1H7CA 4TX5A 1ZKEA 5F8PA 3K19A 3NZQA 4KP3C 2YNKA 3KBTA 5L3BB 3A5XA 1ZHZA 4PNIA 2KMFA 1QUUA 4BA9A 2A72A 1NAFA 3KFWX 5JR9A 2FGRA 4BUMX 4G75A 4IE7A 3ZEFB 3GP6A 4DMWA 1LVKA 5HWXA 2VKHA 1G73A 3CX6B 2KT9A 1MPFA 4I55E 3LK42 3VZTX 1US7B 5JR9B 2I59A 4NUVA 3I9YA 4PK4A 4BAYB 1MM5A 1YKHB 2LSYA 4QHOA 4QQ1A 3DJBA 3KVBA 1O3XA 4D5UA 1E1HB 3NRYA 2YU2A 5E0OA 1HCIA 3PQSA 1D1AA 4QX8B 3J7Yq 1FMWA 2HPJA 5HXRA 3HI2A 2XTRA 4I43B 4QXCB 4CI1B 3ZYMA 1GFPA 4UXNB 2YEVC 5IYZE 5FY0A 3R84B 4FT6A 3LK41 3ESLA 4B61A 3B13A 2Y0KA 3K8PC 4UVBB 2EHOA 2VB6A 2L8KA 5T5FA 3VY8X 4AUIA 4DVDA 2KC0A 2WAUA 3E0ZA 2DI4A 5LJNA 3ZN0B 3DA3A 3P8CD 2BVLA 2H3RA 2XUEA 3LG7A 5EK2A 5L3DB 5JDPA 2EHOB 4U9CA 4KBMB 3SRZA 1G90A 4P09A 3VKGA 2VK9A 2XQYA 3M65A 3Q2MA 5EK4A 4H9NC 5LP6E 3CPZA 4BJNA 3VZWX 3BK9A 2J1NA 4X1KE 3ZYLA 2VKJA 2CMRA 4UVCB 5A1LA 1THQA 3ANWA 4GYRA 3N9NA 4QWNB 3UUNA 3VU7H 2MTQA 1HS7A 2JJ9A 5LYJE 2QTKA 3O0EA 3GWHA 2IAKA 2YK0A 3IHRA 3ANWB 2H7VC 5HXCA 4N59A 3GN5A 3AAAA 4KR4A 2WMOA 2YINA 3EDVA 4PJMA 3CQXC 3K3NA 2QGSA 2EHOD 2N2LA 4M1PA 4KRAA 3GA8A 3PDYA 3AAAB 4ASKA 4GYSA 4AKIA 3HW9A 4U74A 1IAPA 3KV5A 4H9QC 3K3OA 4FSOA 2W0GA 5LHHB 3S4UA 4I50E 4UV9B 2Q9QA 4IIJE 3Q9DA 3UTKA 3RC8A 1U5PA 2X51A 4H9OC 4YJ2E 1S94A 2W00A 3LK3B 3PU8A 4H63V 2NTYA 1D1CA 3N9MA 5FY1A 3RYIE 2Q9QB 5J1GA 4HE8A 3KINB 2A3DA 4PJJA 2CWOA 2IC9A 2C5KT 3I0OA 4PUXA 3VE1A 2HPLA 1SHZC 3BQLA 2N9DA 3ZPOA 4DBQA 2Y7SA 2V26A 3N9LA 4ISTA 2NTXA 3RYHE 4ERRA 3CX7B 3UU2A 1HXTA 3ETVA 3U3IA 5FVNA 4QKNA 5JDGA 5J2TE 5JDFA 4AKLA 3HOEA 2XTLA 5TAOA 3T0SA 3V5UA 3SY7A 3WI3A 3O1IA 3C50A 1ZV4X 4L9IA 3EVYA 3PUGA 2RP4A 3P7IA 5ETWA 2E9XA 2HH7A 4U72A 1P4TA 1HF8A 2ACXA 5EZYE 2Q9QD 3ONXA 5DQVA 4UVAB 4H9PC 2KWHA 2P9BA 2KINB 4V1Av 1ZHWA 4FOZA 2JRKA 1ZHTA 4XAXB 4FZNA 4XBFB 2XE1A 2E9XB 2ES0A 3LFMA 1QJ8A 1FMVA 2DCFA 1BR4A 3HKEE 3MK7C 1YW0A 2F1VA 5JDNA 2F1TA 2MHLA 3ZN1B 3JC6D 1D0XA 4O4JE 1VRBA 2SPCA 1MM4A 2D0UA 3ZMTB 3CQCB 2WWUA 1UCUA 3N9PA 4H9SE 3ZJ1A 5LNKA 2W80C 3I9WA 4HN9A 4XNKA 3ZMVB 3OYXA 3TKLB 8PRNA 2ZMAA 5LG4A 3N9OA 3C5OA 4GHBA 4ISSA 2X0LB 2VKDA 2XHEB 2YU1A 4OFZA 5DQWA 5L3CB 4RLBA 4FUVA 4E1TA 1Q9FA 2X9WA 4FESA 4ZI2C 4D65A 5G26A 2W61A 4AKHA 1MMNA 5D5DA 2E9XD 3N2KE 1HX8A 1S35A 4A56A 4IE5A 3VKHA 1V9DA 2CEAA 3RRCA 4J2CA 2X9YA 3E22E 4WNKA 3KV6A 4ZI3D 3PRNA 2X9XA 2LT3A 5HWYA 3RPUA 4F4BA 4MALA 2DHRA 1BR1A 3HR0A 2CLYB 3O1JA 3WI5A 4IE4A 4YFSA 5ADXK 3F2EA 1GFOA 5LOVE 5GONE 4TN7B 5ADXL 4TV8E 3AA7A 2CCQA 1MMDA 1LVFA 2N2NA 5LBMA 4YHJA 3IEEA 1HXUA 4AKMA 3LJCA 2VWAA 3FYXA 3TZGA 3KBUA 4OHFA 1KNZA 1QJ9A 2V7KA 1ZHYA 4AYEC 2KNDA 2NW7A 3I0QA 2GK9A 3SS1A 3AA7B 1WRDA 3KV9A 3HOLA 2J4UP 2XAJB 3C4XA 5M4YA 3T24A 4GIWA 4BJMA 4O4UA 5L3FB 1IJ6A 3MACA 2WSSV 4IHJE 4O8SA 3VY9X 5GV0A 3UAQA 2LOPA 3DP7A 2XAFB 2M07A 4ZI7E 2M67A 3HKDE 2XASB 3C51A 4JLEA 2C0SA 5EK3A 4UIGA 1WYBA 3QC9A 2LSGA 3PE0A 2D0TA 4FSPA 3E08A 4LSEA 1MIWA 5CA1E 2W62A 3C98B 3MZKB 4C69X 4EZ4A 4O4XA 5LHIB 1OSMA 3HWBA 4K0UA 3ZC0A 1QSDA 4AQFC 2B1EA 2XAQB 4O4LE 4O49A 2JMHA 2N2MA 4YJ3E 5FNVE 3VHLA 1WLXA 3ZMZB 1SA0E 4H63H 2LHRA 1WYCA 4AQGA 2YPVA 1KK7A 2XMXA 3PUAA 3PU3A 2MBGA 4D64A 2Z6EA 4OK0A 4DBRA 4JFBA 5EE2A 1GFNA 3PURA 2X27X 4UEMA 1FEWA 1B7TA 3KVDD 2LEHA 4RJXA 3GN5B 2ZFGA 3O4XE 4EB6E 3JTYA 3O9XA 2KZ7A 1YD8G 3CX8B 3ZJ2A 4CXWA 5LGNB 2PORA 3MA9A 3N2GE 4C90A 4IDZA 5H6QB 4FRXA 1Y64B 2V7LA 3RRWA 2KZ7B 5DL7A 4P0AA 4FMSA 3EMNX 4I4TE 2VKOA 2JPFA 1Q9GA 2XG6A 3OBVE 5HXSA 3F57A 5FXZA 2CXLA 4O3ZA 4OYKA 1ORMA 3POXA 3C4ZA 3UULA 4CXXA 2PFVA 2UXXB 4QXHB 3ZCJA 3ZLIA 3WAKA 5FXXA 5JDHA 2Y8DA 4G63A 2CXFA 1EZ3A 5LXTE 4B6XA 3RKOA 4ZI3C 3UFEA 2XE5A 1UX5A 2LM9A 3PUQA 4QXBB 3V8UA 2H7OA 3H3AA 3D0TA 3AAEA 2V7IA 1OXZA 2C5IT 3NSGA 3MJXA 4ZHQE 4L5GA 4PAGA 3B57A 3IBPA 3N2OA 2DWKA 3FB2A 4FJOA 4AFKA 2X66A 3SWHA 4FRTA 4GCQA 5JREA 2JQQA 2ZM0A 2CWYA 3Q5WA 3SY9A 4CXYA 2JMKA 4O4IE 5JH7E 5LJMA 3F31A 2X9HA 3G7GA 4Z3TA 3NRXA 3AB3B 4MLKA 1MIVA 5CB4E 5JDQA 3RBHA 3WI4A 3AA6A 3ZC1A 2BDEA 4RJWA 2LSIA 2CLYC 4IGUA 5JR9C 1MMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE A;  3AA0 A;  3AA6 B;  3LK2 A;  2KZ7 B;  3LK3 B;  3AA7 B;  4AKR A;  3AA0 B;  3AAE B;  3LK4 1;  2KXP A;  3LK2 B;  3AAA A;  4AKR B;  3AA1 A;  2KXP B;  3LK4 2;  1IZN A;  5AFU K;  3AAA B;  5AFU L;  3AA6 A;  5ADX K;  3LK3 A;  3AA1 B;  5ADX L;  2KZ7 A;  3AA7 A;  1IZN B; 
#chains in the Genus database with same CATH topology
 2LHN A;  5AQN B;  2QJY B;  1K04 A;  1HTJ F;  3FXD A;  4EIW A;  3ABV C;  1GTW A;  1L0N E;  1VQ7 P;  2FYU D;  4EDF A;  2UUB T;  3O1H A;  4JYA T;  1VQ8 P;  3HKC E;  3RGL A;  2CM0 A;  3SFD A;  2KLQ A;  2E75 C;  2V7J A;  4AZL A;  3G3Z A;  4JI8 T;  2R8A A;  3GHG B;  1YKE B;  5C8Y E;  3L73 E;  2AEM A;  4YSY A;  2EHO C;  2M3E A;  4UV8 B;  1L4A D;  1X9V A;  3FHN A;  3T20 A;  5JRC A;  3USS A;  2CHN A;  1SQB K;  3CX5 E;  3QB5 A;  4OVN F;  4ANJ A;  4IDN A;  2QJP C;  4LLH A;  2L3L A;  4X20 E;  1ZHX A;  1IFD A;  4E7Z A;  1KYO D;  4F8H A;  2H89 A;  4HKZ H;  3CD6 P;  2ZLY A;  3H1H E;  2PBI A;  2WJR A;  1H89 A;  2KS1 A;  1BH3 A;  1KB9 D;  2YXQ B;  2A06 E;  3HL6 A;  4IE0 A;  1JY3 O;  3H1K G;  5CCH D;  3ETU A;  4GOD A;  2X68 A;  4YSZ A;  3TDK A;  1FC2 C;  2WSE H;  3AE2 A;  1EDK A;  5HAX A;  2FXO A;  2LM2 A;  4JEU B;  1N33 T;  4LML A;  4MN4 C;  3RH3 A;  2XE3 A;  1E5W A;  1J1D C;  1S5L E;  1NVO A;  3BRT B;  1PL5 A;  1LJ2 A;  1L0N K;  4WBO A;  2RKL A;  2AXT E;  2WB5 A;  1GFM A;  4N75 A;  1G2C A;  4EXT A;  3ZT6 A;  2P67 A;  1SQV E;  5H2F E;  3LDQ B;  3SZV A;  3AAI A;  3L75 E;  1S5L O;  1D0Z A;  3RK2 C;  2GUS A;  2BG9 C;  1GL2 D;  2NWB A;  4IFF A;  4MBQ A;  1LTI C;  4ADZ A;  2W4X A;  1NGM B;  2AXT O;  2KK7 A;  5APT A;  4WVZ A;  1T8Z A;  2FBW C;  3FZK B;  3ONJ A;  1SUM B;  5H2F O;  1ZW0 A;  4HGA A;  3VTP C;  3PJA A;  3UT5 E;  2KSR A;  1SQP J;  5KAF E;  1VOM A;  4UF0 B;  3LK2 A;  5APX A;  4G2A A;  5FL0 A;  3OPC A;  5KX5 E;  5F3J A;  4HFV A;  4WBA A;  1P84 E;  4HWH A;  4AYI D;  3KDS E;  1NH4 A;  7PRN A;  3AEF A;  1LTJ C;  4O2B E;  2DLR A;  5KAF O;  1ZOY A;  1R8E A;  2YO2 A;  4HJG H;  3GF7 A;  1T16 A;  2RPA A;  3PGS A;  2QRX A;  1EQ7 A;  4XE5 B;  3JAE A;  3WUV A;  3TGU G;  1FJK A;  1NTK J;  2I1J A;  3CQG B;  4E7S A;  3L3P A;  1IK7 A;  3A2A A;  1N32 T;  3LID A;  4WWI A;  1JY2 N;  2YDS A;  4HTE A;  4U2Y A;  3GG2 A;  3FXE A;  1EZV D;  4U2Z A;  1G1I A;  1BGY E;  4R4M A;  1L0N D;  1T72 A;  1MND A;  1J5E T;  2XAG B;  3BRY A;  4JI1 T;  4E1S A;  2GE4 A;  2MKV A;  2IHR 1;  1NTM E;  2K1A A;  2R6G F;  3P4S A;  3MUD A;  2ZM8 A;  3HUS B;  1OWA A;  4EYY Q;  1MV8 A;  3HE5 B;  1IK9 A;  2XQ8 A;  4YTM A;  3A3Y B;  3RKG A;  2ZJS E;  5AFU K;  3D71 A;  2M5A B;  1FDI A;  1NAY A;  1KIL D;  3A0H H;  5FL1 A;  3M0A A;  3SYB A;  4XA4 A;  4C7R A;  3EDU A;  4O4H E;  1HNX T;  1D1B A;  3KZI E;  3AXJ A;  5GTH O;  3JC2 2;  1PP9 J;  2Q1K A;  1CW5 A;  5KMG P;  3LBX B;  2UXN B;  5JQG E;  3N4X A;  3QUJ A;  2CPT A;  2O4V A;  3S9O A;  1EDJ A;  3KZI O;  3I56 P;  1KFY A;  1H6S 1;  2J5U A;  2B87 B;  4O3X B;  3GLM A;  4JBW F;  1QLB A;  2OQQ A;  4EYU A;  2QM8 A;  3H1H D;  1XNR T;  1MIY A;  2MPK A;  2Y6X A;  2R4O A;  4O9B A;  1OZH A;  2A06 D;  4C7N B;  2JP3 A;  1HH0 A;  1L0L D;  1HG5 A;  4NPP A;  2YKP A;  2A45 H;  3GMI A;  3H1L G;  5AQH B;  1SQB J;  1VCS A;  4H0L D;  2OA5 A;  5F8P A;  4AIU A;  1K9M Q;  4GT1 A;  2OYI C;  3B71 A;  5L3B B;  4PNI A;  2KMF A;  1JNR A;  1LT9 A;  4KX6 A;  4BUM X;  4DMW A;  1JNM A;  2BG9 E;  3Q5E A;  2JKV A;  5K5G B;  1SQV D;  1G73 A;  2VKH A;  2XJ7 A;  1NTM K;  2XDJ A;  5JR9 B;  1E2A A;  2IZ0 A;  3CL3 D;  1YKH B;  4QHO A;  1KN7 A;  3ZDM A;  3KVB A;  4D5U A;  1O3X A;  2YKO A;  1HCI A;  1YQ4 C;  1D1A A;  4QX8 B;  1FMW A;  1YQ3 C;  4CI1 B;  1S72 P;  3ZYM A;  1KQG B;  4JBZ A;  2YEV C;  1SFC A;  3R84 B;  4JV5 T;  1PGP A;  2IDB A;  3L74 E;  3ESL A;  1DIP A;  3LK4 1;  4X5T A;  4UVB B;  1L0V A;  4N3Y B;  4UB8 E;  2VB6 A;  2WQY A;  3IA3 A;  3VY8 X;  2ZFC A;  4DR2 T;  1FDO A;  4ZKU A;  2KLV A;  2KLU A;  3WU2 H;  3FZM B;  5LJN A;  3LSV A;  2WDR A;  3MGN A;  3SRZ A;  5AVX B;  3L73 J;  4UB8 O;  2L5G B;  4YTN A;  3CME P;  3CPZ A;  4BJN A;  3VZW X;  1JMB A;  3EAB A;  5LG3 A;  4X1K E;  2ZYD A;  2QIW A;  5LB7 B;  1H8A A;  2UUA T;  3N9N A;  1URQ B;  2Q3E A;  3H3M A;  1HJ0 A;  1YIJ P;  3GWH A;  1NTM D;  2E75 D;  3ANW B;  5HXC A;  3EHZ A;  2W90 A;  3L72 G;  2YMK A;  3CQX C;  5AQT B;  1FZC C;  2QJK B;  5L47 A;  2K9J A;  2EHO D;  4M1P A;  3PDY A;  5FVK A;  4AKI A;  4U74 A;  3NVO A;  4I50 E;  5AQI B;  4IIJ E;  3RC8 A;  3UTK A;  3PGR A;  2IWW A;  2J47 A;  2W00 A;  3PU8 A;  3ZKR A;  3H1K E;  1JUN A;  5AQF B;  5FY1 A;  3RYI E;  4EED A;  3SWF A;  4BRY B;  4HE8 A;  3M0D A;  3VE1 A;  4NXN T;  3L75 J;  3ZPO A;  1KYO H;  2V26 A;  4IST A;  4N78 E;  3D6Y A;  3L35 A;  1HXT A;  3HOE A;  1VQ5 P;  1KB9 H;  2HLO A;  1HNW T;  1SQP G;  4A5X A;  1N2D C;  2N1T B;  1M90 Q;  2JJL A;  4A98 A;  2RP4 A;  3P7I A;  2E9X A;  3C8V A;  1MFZ A;  5DQV A;  4EIJ A;  2KWH A;  2KIN B;  1ZHT A;  4XAX B;  1LP1 B;  4XBF B;  2ES0 A;  1IFI A;  3TNU A;  3LFM A;  4ILC A;  1FMV A;  1BR4 A;  3MK7 C;  1YW0 A;  1LTA C;  1K8A Q;  4LMJ A;  3ITK A;  1NTK G;  3D6Z A;  1VQL P;  5LNK A;  4H9S E;  3V2P A;  5IUX A;  4HN9 A;  3OYX A;  5LG4 A;  1AV1 A;  5DJU B;  3C5O A;  4RLB A;  5DQW A;  2VKD A;  1OED A;  5AVV B;  2D9D A;  4OFZ A;  1BGY J;  4DR6 T;  4FUV A;  3MIW A;  2CRB A;  3FX0 A;  2HHH T;  3L74 D;  2W61 A;  1NHL A;  1JTH B;  4IE5 A;  3VKH A;  1V9D A;  2CEA A;  5AQO B;  3RRC A;  2XQ3 A;  3KXD A;  5HEG A;  4WY4 A;  4ZI3 D;  4IL4 A;  4JI4 T;  3HD7 C;  1UIX A;  4U3F G;  2XQ9 A;  3QB5 K;  5ADX K;  3F2E A;  5LOV E;  5CBN A;  2CCQ A;  1J1E C;  4YHJ A;  3L70 E;  2WWV A;  4GKJ T;  1HXU A;  1PP9 G;  3KBU A;  1ZHY A;  1OIP A;  1UUS A;  1WRD A;  3KV9 A;  1RY3 A;  2LXC B;  2XAJ B;  1LWU A;  5M4Y A;  4GIW A;  2OTJ P;  2WSS V;  4IHJ E;  4O8S A;  4U33 A;  5GV0 A;  2LOP A;  1GL2 A;  3CMA P;  1VQO P;  2WCA A;  3AE4 A;  5AQR B;  1RF1 B;  2K3W A;  1SQQ E;  2C0S A;  5EK3 A;  1LTS C;  4X65 T;  1J5W A;  1WYB A;  1LTT C;  1NTZ E;  1MIW A;  4DV4 T;  2W62 A;  1SQB G;  3C98 B;  4C69 X;  4Q25 A;  4RKU J;  2FY8 A;  4EZ4 A;  5ABF A;  4ZNC A;  5LHI B;  4O4X A;  4K0U A;  2WMM A;  1KQL A;  1QSD A;  4AQF C;  2B88 A;  2B1E A;  3H1K D;  5CJ4 A;  4IFD K;  3PV0 F;  1T1L A;  2IX7 C;  2FXM A;  1WLX A;  3OVU A;  4NPF X;  3ZMZ B;  1J2J B;  1YJ9 P;  4X64 T;  3CX5 H;  4X62 T;  2WDV A;  1N73 A;  3CC4 P;  2VQF T;  1HTL C;  3AEB C;  2E2A A;  3DZM A;  2R3C A;  2ZFG A;  3O4X E;  4CN4 A;  2KZ7 A;  3RIU C;  3A8Y C;  3ZJ2 A;  1XNQ T;  2A45 I;  4P1N A;  2OTK E;  2FXP A;  2X0Y A;  3CCR P;  3EMN X;  5KLV E;  2XG6 A;  3OBV E;  1KQF B;  5FXZ A;  2V7Q J;  2E74 B;  2XQA A;  3UU4 A;  3POX A;  1JY2 O;  3H32 A;  1S5L H;  2NPS B;  2L91 A;  2AEJ A;  2E76 B;  3GF3 A;  4RJT A;  3PGU A;  2AXT H;  3L73 G;  2Q7C A;  3B5N D;  4NPE A;  5AW4 B;  2CXF A;  2Y8D A;  5H2F H;  2XE5 A;  1UX5 A;  3V8U A;  5AVY B;  1W09 A;  1SQQ K;  5KJ7 C;  4I2L C;  3D0T A;  3TGU D;  2QG4 A;  1M7K A;  3O6Q A;  1NTZ K;  5ABE A;  1OXZ A;  1GD2 E;  4ZEY A;  1M56 D;  1XDP A;  4PAG A;  1KF6 A;  3B57 A;  5KAF H;  3N2O A;  4FJO A;  1P84 H;  5HEJ A;  2ZM0 A;  2CWY A;  3H1H G;  1T8B A;  4CXY A;  5AW1 B;  1XMO T;  5AQQ B;  3RIA A;  3F31 A;  2X9H A;  3VR8 A;  2WVR A;  2A06 G;  5KLI B;  3UU5 A;  5CB4 E;  5L4H A;  3H1J J;  4WY4 C;  1PPJ E;  1HXX A;  2KDY A;  3AA6 B;  1L4A B;  2LFU A;  2W63 A;  1YTZ T;  1E79 H;  3C4W A;  2WY2 A;  1DEB A;  4WW0 A;  2Q9I A;  3VE2 A;  3P4P A;  5KLV K;  2J62 A;  5CBO A;  1OED B;  1UX4 A;  3GHG A;  3L75 G;  4TLF A;  1HVV A;  2WSS H;  1GW3 A;  5J2U E;  3T1H T;  2KXP B;  5LA6 E;  3POQ A;  3X1D A;  4GF4 A;  2GA1 A;  1RE3 A;  1E7P A;  4DV7 T;  2FYN C;  1VQ9 P;  2C5J A;  4LFA T;  5GTH H;  1RE4 C;  2KUB A;  3I1A A;  4EAH A;  4YSX A;  5L3G B;  2H7H A;  3ZMS B;  4Y99 B;  2I1K A;  1OW6 A;  2BS3 A;  2FFD B;  3POR A;  2ZYG A;  2D2C C;  3L8R A;  3KDP B;  3H1L D;  1OW7 A;  1VQK P;  3S1K A;  4CQI A;  3KZI H;  2WMN A;  4ZS3 A;  2X9K A;  3ZYK A;  3ZMU B;  4GK5 E;  4PK5 A;  3AA0 B;  4XNL A;  5AVZ B;  3POU A;  5APU A;  4JI7 T;  4JI2 T;  5DL5 A;  4CI2 B;  1UGO A;  4TZ4 C;  5AW9 B;  2Y2X A;  3R6N A;  2YO3 A;  4KR8 A;  3MD0 A;  3D70 A;  1KYO I;  2H43 A;  3BS0 A;  4EEB A;  2V7M A;  2BVM A;  3N9Q A;  4YXD A;  1NTK E;  3KV4 A;  2WDQ A;  5L3E B;  1KB9 I;  3PH0 A;  1BGY G;  4N58 A;  5KAI E;  4GOF A;  5CCG C;  3UUX B;  2ZM2 A;  2LSK A;  3CPW O;  3BQI A;  1NTM G;  5F5W A;  5ABF B;  2Y0H A;  5KAI O;  2HOD A;  4XFJ A;  4IL6 E;  2Q9Q C;  3NBX X;  4Z91 A;  2K48 A;  4AYN A;  5FXV A;  4LF6 T;  1GU5 A;  2JMM A;  4LGD E;  4FZL A;  2YN6 A;  3L71 E;  3ZSS A;  3PHL A;  3AEE A;  2MAW A;  1HF9 A;  3T8O A;  4UF0 A;  3OKQ A;  5CMZ A;  4IL6 O;  5IHY A;  4OWF A;  3EWK A;  2F4V T;  1N73 B;  4WBN E;  3L70 J;  1WR6 A;  3JC6 C;  5KXJ A;  3MXZ A;  2IYO A;  2IC6 A;  1AJY A;  4JEH B;  4HH2 A;  2YIU B;  5B66 E;  2W83 C;  1PP9 E;  2I6H A;  4CZZ B;  2YXR B;  5AW0 B;  3HD7 D;  2HG5 D;  3CCJ P;  3A2S X;  2VAS A;  2G0U A;  5HYA A;  2V7Q H;  4MFR A;  4MHC A;  2K4T A;  5B66 O;  2C0X A;  4UB8 H;  1ZHC A;  2X67 A;  4PD4 H;  1LNQ A;  1SQQ J;  2IYP A;  4HFE A;  1X79 B;  2WBL A;  3H32 B;  1NTZ J;  1QLE D;  2KOG A;  3SYS A;  1PIX A;  1KIL B;  2VRS A;  2IDO B;  4U7I A;  3SZD A;  1PZQ A;  2XQ4 A;  4LMK A;  2IML A;  4Z90 A;  1XZY A;  4HFI A;  2FGQ X;  3BQK A;  4GKK T;  3HA4 A;  3HUS A;  2GUV A;  2SPZ A;  4PK6 A;  4DR3 T;  3HE5 A;  3LW5 J;  1N7L A;  4QH5 A;  2DWG A;  4L75 A;  5H6R B;  1RHZ B;  3CCU P;  3V2Q A;  1QL2 A;  2D2S A;  2M6I A;  3S4R A;  5AFU L;  3BAS A;  1S3J A;  3U1C A;  4HFD A;  4CI3 B;  3LBX A;  1S9K D;  2IW5 B;  2N1G A;  1NKZ B;  4NUU A;  2XM2 A;  6PRN A;  3CML A;  1SQP D;  4GOU A;  2B87 A;  4H0L B;  3L74 G;  1ZEE A;  5KLV J;  4EYY R;  2V6Y A;  1HG2 A;  2DNX A;  2XTQ A;  3A5T A;  4DZO A;  2WIT A;  3QK6 A;  5CFB A;  3CX5 I;  4JCH A;  5GTI E;  5BMV E;  4AKR B;  1BE3 J;  4C7N A;  3H25 A;  4IE6 A;  2A2F X;  4KT0 J;  1VDF A;  3RYC E;  4ZKP A;  1AJ3 A;  3UPG A;  4CPG A;  5FMN A;  1U57 A;  4L0R A;  5GTI O;  2ACZ A;  1NTK D;  3G6E P;  1DD3 A;  1SE7 A;  3QNU A;  4GCP A;  2ODV A;  2Y0E A;  1YTZ I;  2MYS A;  2KB7 P;  1H7C A;  4KUM B;  1ZKE A;  2YNK A;  3KBT A;  1ZHZ A;  3A5X A;  4BA9 A;  3KFW X;  1N7S D;  5JR9 A;  4G75 A;  3M06 A;  5AQV B;  3GP6 A;  2LKH A;  3WUU A;  1M1J B;  3CWB J;  2C9L Y;  1LVK A;  5HWX A;  3CK6 A;  4GDO A;  3PP5 A;  3SSU A;  3PRJ A;  5KJ7 D;  3LK4 2;  2Y0D A;  3IFM A;  2O3J A;  4QQ1 A;  3DJB A;  4U3F D;  3NRY A;  5E0O A;  3J7Y q;  2HPJ A;  5HXR A;  2XTR A;  2HFE D;  2V6X A;  1GFP A;  1T2K C;  2W6A A;  1PP9 D;  1FZG A;  5IYZ E;  4ILA A;  5AW6 B;  3VMX A;  4GKG A;  4B61 A;  2OTL P;  1M57 D;  3K8P C;  1XDO A;  1P84 I;  3HRN A;  4IOI H;  2E75 B;  4AUI A;  1ZP0 A;  1QX8 A;  2G8Y A;  1EDI A;  3AE7 C;  2DI4 A;  3IN6 A;  2WAU A;  4NIQ A;  3ZN0 B;  3DA3 A;  3P8C D;  4ASW A;  2H3R A;  2HN1 A;  2XUE A;  2WZ7 A;  2ZT9 C;  2EHO B;  4U9C A;  1FJP A;  4KBM B;  1IC2 A;  1NU1 J;  2HOD B;  2RH0 A;  2BBJ A;  4LF8 T;  1RF0 A;  2VK9 A;  2XQY A;  1URQ A;  4H9N C;  4LFC T;  2J58 A;  4PV1 C;  2UU9 T;  4K35 A;  1SQB D;  5L8R J;  4UVC B;  2HR3 A;  3ANW A;  1ZLL A;  3PUV F;  4QWN B;  4LF7 T;  3A0B E;  2QJP B;  3VU7 H;  1N86 A;  2JQ9 A;  1HS7 A;  2JJ9 A;  1ZR4 A;  2QTK A;  3O0E A;  4I7Z C;  4WB4 A;  3B5N A;  2R4N A;  1UK5 A;  2WMO A;  4PJM A;  3A0B O;  5AVU B;  2WPQ A;  3K3N A;  2BEQ D;  4B86 A;  2N2L A;  3GA8 A;  2D2C D;  5CHX A;  3HW9 A;  4OGQ D;  1IAP A;  1A02 F;  5G3A A;  4H9Q C;  1LTB C;  2N9B A;  3K3O A;  2W0G A;  3PUZ F;  1FZF A;  3B8E B;  5LHH B;  4UV9 B;  4ZMD A;  5AQJ B;  1J1D B;  5AVQ B;  4BRY A;  1U5P A;  2X51 A;  2Z4E A;  4YJ2 E;  2BKO A;  3EFG A;  4H44 C;  2QEX P;  3L39 A;  1WMK A;  2A3D A;  2CWO A;  3R4Y A;  5KKZ C;  2C5K T;  2XPK A;  4PUX A;  1K73 Q;  2BG9 B;  3BQL A;  3L71 J;  3N9L A;  2NTX A;  3UQ4 A;  2N1T A;  2GM4 A;  5GTH E;  4AKL A;  3L70 G;  3L73 D;  3DWN A;  5TAO A;  3RL0 g;  3V5U A;  1GQE A;  3WI3 A;  1ZV4 X;  4M3L A;  3EVY A;  1IBL T;  1LP1 A;  1NYH A;  1SQX K;  3SFD C;  4U72 A;  2HH7 A;  5ETW A;  1P4T A;  2ACX A;  5EZY E;  2Q9Q D;  3ONX A;  3TLV A;  3CX5 D;  4H9P C;  2P9B A;  2VQE T;  4FOZ A;  4LFB T;  1SQQ G;  2E5Y A;  5LMU T;  2V6Y B;  5JDN A;  1AVY A;  2XU6 A;  3ZN1 B;  1NTZ G;  1LT1 A;  3JC6 D;  1D0X A;  2SPC A;  1JY3 P;  3ZMT B;  2KIK A;  2WWU A;  1UCU A;  4XNK A;  1YJW P;  2VL0 A;  4GHB A;  2YU1 A;  2H89 C;  4E1T A;  2BKP A;  1JTH A;  4QH1 A;  1Q9F A;  2KZI A;  3E7K A;  4ZI2 C;  4D65 A;  3BCC J;  1NEN A;  5D5D A;  3N2K E;  1S35 A;  5HEH A;  1JO5 A;  4J2C A;  2X9Y A;  3Q3D A;  3E22 E;  4WNK A;  3PRN A;  3AED A;  2X9X A;  2LT3 A;  4EV6 A;  3AE2 C;  5HWY A;  3RPU A;  4ZZB A;  4F4B A;  4MAL A;  3L75 D;  1BDC A;  1BR1 A;  3HR0 A;  3O1J A;  2XV5 A;  5BU5 A;  4NPD A;  5TJH A;  4EOT A;  3BVH A;  5ADX L;  4UB6 E;  1MMD A;  2LKG A;  2N2N A;  2M0B A;  5LBM A;  1M62 A;  5C39 A;  3IEE A;  2BAS A;  5KLV G;  4OHF A;  1KFM A;  1QJ9 A;  2JIW A;  3AA7 B;  3HE4 A;  2J4U P;  4UB6 O;  2CPB A;  2XZE A;  1P84 D;  1XTG B;  1RF1 A;  3BRV B;  4D6T E;  1URQ C;  5L3F B;  1W2B O;  3SWK A;  4H13 C;  1BE3 G;  1BDD A;  3VY9 X;  4PD4 E;  2M07 A;  3HKD E;  4JLE A;  3QC9 A;  5CA1 E;  4DCK A;  3RBX A;  1ZXG A;  3AEF C;  1KEY A;  1ZOY C;  1PFI A;  1OSM A;  3HWB A;  2FJB A;  1BGY D;  4U7Y A;  5APY A;  2N2M A;  4YJ3 E;  2RN0 A;  1AA0 A;  1JEK A;  1SA0 E;  3P7K A;  2XQ5 A;  3AEC A;  3CWB G;  3RK3 C;  1YXR A;  2R88 A;  3PUA A;  3CI9 A;  5LMN T;  4LF9 T;  2X27 X;  1HGZ A;  3FZH B;  4TNW A;  1FEW A;  2LEH A;  3B5N B;  3AEA A;  3G71 P;  1PPJ G;  2Y9Y A;  2AE9 A;  5L4E A;  2WTY A;  1JCD A;  2XY8 B;  4CXW A;  3MUD C;  2OGU A;  5H6Q B;  3H1J E;  4FRX A;  4P0A A;  2NPS A;  5KTB A;  5KAI H;  3M91 A;  3G9R A;  1Q9G A;  3F57 A;  2CXL A;  3L4F A;  1XMQ T;  2WU5 A;  2BCC J;  3NFQ A;  3AE1 A;  3ZT5 A;  3ZLI A;  1DEE G;  3CCM P;  4IL6 H;  3WAK A;  2WSF J;  4G63 A;  1YBK A;  5ABH A;  3CCE P;  2IIU A;  4IT4 A;  3UFE A;  2UUC T;  4QXB B;  4QH4 A;  2H7O A;  1SQX J;  4W7Z A;  3AAE A;  3M9B A;  1H0T B;  1HNZ T;  2C5I T;  2Q6Q A;  1Q86 Q;  3NWI A;  5APV A;  1T7S A;  3MHV A;  3V6I A;  1FOS F;  5B66 H;  1M7L A;  4AFK A;  1FZC B;  2X66 A;  3P4R A;  4GCQ A;  4A97 A;  5JRE A;  4TWF A;  2JWD A;  2X0H A;  3RK2 D;  5AW5 B;  3Q5W A;  5AVT B;  5JH7 E;  1OW8 A;  3AE9 A;  3NKZ A;  4PV1 D;  4HWD A;  3NRX A;  3G7G A;  2KP8 A;  2WS3 A;  4MLK A;  2J4G A;  1JOC A;  3CXH E;  1MIV A;  3AA6 A;  1L4A A;  1N8R Q;  1LT9 C;  2R5B A;  1MMG A;  2B89 A;  2AXC A;  1JMM A;  2QA7 A;  3VP8 A;  3RQU A;  5HXE A;  4H9R C;  1GDT A;  3B4S A;  3UIA A;  1Z0P A;  2QSI A;  2LOS A;  4YT0 A;  2KXP A;  4JI5 T;  3A7M A;  3Q5X A;  2IFM A;  4PD4 D;  2N9Y B;  3AE5 A;  3L71 G;  4DV2 T;  3CKD A;  2JEE A;  2QM7 A;  3OW2 O;  1MMA A;  4I6M C;  4EOZ B;  5HCM A;  1RQV A;  4AYD C;  3SOL A;  2FFD A;  1SFC C;  2FJE A;  5FY7 A;  1GFQ A;  5CCH A;  1AFO A;  1R5L A;  2KSE A;  2V1D B;  4RL9 A;  1USE A;  4AYC A;  2WQY C;  4H44 D;  3AA0 A;  2ZYA A;  1SS1 A;  2Y0C A;  3RK3 E;  4ZXL A;  2PTF A;  2NW9 A;  5APW A;  2IFN A;  3VN0 A;  2MJZ A;  5C3J A;  4AUW A;  4IDP A;  1BR0 A;  3H37 A;  2W27 A;  2KWI B;  2V5D A;  2OLT A;  3L09 A;  3HE4 B;  4LC1 A;  3AE3 A;  3V5B A;  4UEL A;  5GTI H;  2O01 N;  1HBW A;  1BSH A;  2JWA A;  2W8Z A;  4LSI A;  1OPF A;  5CA0 E;  2O1K A;  3WAJ A;  2CE7 A;  1QJP A;  2R3S A;  4X1I E;  1LKX A;  1HUC A;  1PHO A;  2NZ2 A;  5AVS B;  3UUM A;  4YLH A;  3H1J D;  5LCY A;  2ZXE B;  3BCC G;  2KZJ A;  4X1Y E;  3ZCI A;  4GCS A;  3AEA C;  2ODJ A;  4AXP A;  2OV9 A;  1CHU A;  2YDQ A;  1HFA A;  3PTR B;  3N7N A;  2L9Q A;  3HD7 B;  1HJB A;  4TV9 E;  5FXW A;  1BR2 A;  1VQ6 P;  3IR9 A;  4GK0 E;  3CVR A;  3TLT A;  2D5U A;  4PJN A;  2V4H A;  3RL0 C;  4N78 D;  1J1E B;  3L37 A;  3W15 B;  3K5B A;  1JCC A;  3V4Q A;  3PUX F;  5C2T A;  3AA1 B;  3SFE A;  2WJQ A;  4ZI2 D;  3M0D C;  1T3J A;  5LHG B;  5ABG A;  1PGQ A;  4HEA A;  3RYF E;  3PQU A;  1BT9 A;  4O3Y A;  1VF5 C;  1OX3 A;  5BVZ A;  3QRC A;  4D6T J;  4K0K T;  1EXI A;  4I0U A;  1X79 A;  1IJ5 A;  3JCU E;  4WYV A;  1QGK B;  4DO0 A;  1BXW A;  1BE3 E;  1KIL A;  3GW6 A;  2E9X C;  4AKG A;  4EI2 A;  3DWO X;  3FWL A;  1FBM A;  3VRA A;  5DL8 A;  3LK3 A;  2WSF H;  3JCU O;  1UUR A;  1L2P A;  3PUS A;  5KDM C;  3RLF F;  5HXH A;  5LGT B;  1KNP A;  2K3R A;  4H13 D;  4AI6 A;  5E79 E;  3NJT A;  4FI5 A;  1YS5 A;  1L4A C;  2JQK A;  3A0B H;  3AAE B;  3W68 A;  2LJL A;  2Y48 B;  4DUY T;  1EXJ A;  3DA4 A;  3AVR A;  3RBZ A;  2ODU A;  1CZQ A;  1HX1 B;  3QWO C;  4PFO A;  5E79 O;  3CWB E;  1OED C;  2C9N Y;  3V5S A;  3DTO A;  2POH A;  2K9A A;  4U3C A;  4C91 A;  4O2A E;  1VQ4 P;  1DU2 A;  2P10 A;  4CTD A;  4OYJ A;  3L70 D;  3AE8 A;  3H1I E;  3RK3 D;  2NP9 A;  4Y99 C;  5LGU B;  3TLS A;  1LRZ A;  4AKR A;  5BR8 T;  1ZN5 A;  2XQ6 A;  4C46 A;  2ZXX A;  2XZR A;  1T6A A;  1N7S B;  1ZR2 A;  3C64 A;  3IF4 A;  4JYB A;  4HYT B;  3OJA B;  2W67 A;  1SQQ D;  2HPC B;  2Q3I A;  2AXD S;  2H88 A;  4DR1 T;  1LWU C;  1SQX G;  2J59 M;  1NTZ D;  1ZRT E;  1NU1 E;  4Z8X A;  1BCC E;  1IZN B;  1GW4 A;  2E5T A;  1AQ5 A;  5AQS B;  3KPE A;  2NOX A;  1GL2 C;  4G76 A;  3AE4 C;  2P58 A;  3M9Q A;  1M1J A;  3NZQ A;  4KP3 C;  4TWD A;  4HFB A;  1QUU A;  2VVN A;  1NAF A;  2FGR A;  3ZEF B;  3AEG A;  1X22 A;  3CX6 B;  4B3R T;  2I0M A;  2KT9 A;  4IDQ A;  1MPF A;  4X66 T;  3VZT X;  3Q5R A;  3ABV A;  3I9Y A;  5AQP B;  4PK4 A;  1MM5 A;  2PGD A;  2LSY A;  2JQH A;  4COF A;  1E1H B;  2YU2 A;  4BWN A;  4DV5 T;  3HI2 A;  1N73 C;  4QXC B;  1LTG C;  1JY2 P;  5KLV D;  1VQP P;  2B76 A;  3PJA J;  4FT6 A;  1VQN P;  3B13 A;  5AQL B;  2FYU E;  2E5L T;  4B3S T;  2Y0K A;  2EHO A;  3UUB A;  5T5F A;  2L8K A;  4DV0 T;  2JQY A;  3CLQ A;  2FYN B;  1BE3 D;  5AW7 B;  2V5C A;  2BVL A;  3LG7 A;  5EK2 A;  5L3D B;  5JDP A;  2IPP A;  2UWJ E;  1G90 A;  4P09 A;  5APS A;  3O8Z A;  2D2C B;  2HYN A;  3VKG A;  3Q2M A;  3M65 A;  2WT7 B;  3NTN A;  4OGQ B;  4UB6 H;  3BK9 A;  1KIL C;  1NU1 K;  1THQ A;  5HEU A;  5HEO A;  1UII A;  4KI0 F;  2MTQ A;  5LYJ E;  4HWC A;  4OH8 B;  1OED E;  4CN1 A;  1H88 A;  3IHR A;  3F5H A;  4N59 A;  1SFC D;  1Q90 D;  4KR4 A;  3CWB D;  2YIN A;  3EDV A;  2IUB A;  2QGS A;  2XND H;  1J1J A;  1WCR A;  4KRA A;  3AAA B;  4ASK A;  4GYS A;  3KV5 A;  4FSO A;  1S5L X;  3T97 B;  1PPJ D;  2V8S V;  3RI5 A;  1DD4 A;  4H9O C;  4H63 V;  3LK3 B;  1Q2N A;  2NTY A;  5CJ0 A;  2QJY C;  2BG9 A;  2Q9Q B;  3BCC E;  4I1L A;  3KIN B;  2FBW A;  1Q82 Q;  1JNZ A;  2IC9 A;  2FYU K;  2N9D A;  3LIE A;  3UU2 A;  3CX7 B;  2WWW A;  2NRG A;  5FVN A;  1ZRT D;  4QKN A;  5JDG A;  3H6P A;  1NU1 D;  3TK1 A;  1GZL A;  2PAJ A;  1LTJ A;  3O1I A;  4YPC A;  3GHG C;  3H1L J;  3CC2 P;  4L9I A;  2M3B A;  1PGO A;  4D6T G;  3PUW F;  1HF8 A;  1RE3 C;  2K37 A;  5AQG B;  1ZHW A;  4QMA A;  2JRK A;  4FZN A;  3RL0 D;  2XE1 A;  3M9H A;  3KQG A;  2DCF A;  1Y47 A;  3CCS P;  2F1T A;  3UU3 A;  1PGJ A;  1M1J C;  2G3A A;  2K9Y A;  1VRB A;  3CQC B;  3ZJ1 A;  2W80 C;  4C4V A;  2E42 A;  3I9W A;  3ZMV B;  1VF5 D;  3AEG C;  4DV1 T;  3TKL B;  1MFT A;  2XSA A;  2X0L B;  2XHE B;  4ISS A;  1EZV E;  5L3C B;  1VPC A;  4JYC A;  2X9W A;  3VP9 A;  2XQ7 A;  4A7P A;  1G1J A;  2WPS A;  5G26 A;  4AKH A;  1MMN A;  2K88 A;  1YYC A;  2E9X D;  1BSN A;  2C0W A;  4YXD C;  2W6B A;  1N34 T;  3KV6 A;  3B5M A;  3CIR A;  2DHR A;  2Y9Z A;  3L71 D;  2IBZ E;  2CLY B;  2OYH B;  3WI5 A;  1Q7Y Q;  4YFS A;  1GFO A;  1KIL E;  3CXH H;  4TV8 E;  3AA7 A;  3H1J G;  1ZME C;  4N74 A;  4AKM A;  3H1I J;  3LJC A;  3FYX A;  1GMJ A;  3TSI A;  2WSC J;  1KNZ A;  1FAV A;  4AYE C;  3I0Q A;  3SS1 A;  1CI6 B;  2YNY A;  3HOL A;  4HFH A;  3AEE C;  3T24 A;  3P8M C;  2WP9 A;  2H8P D;  2BEZ F;  4GIF A;  3ZST A;  3OAK A;  2BCC E;  1CSB A;  4TT3 H;  3L72 J;  4K3A A;  2M67 A;  3C51 A;  2OYI A;  4UIG A;  2LSG A;  4WY4 D;  2D0T A;  2M8R A;  4N6J A;  1L0L E;  3MZK B;  1BCC J;  1LGH B;  1SQX E;  2YKS A;  5J0Z A;  4DR7 T;  1EDL A;  2YOE A;  2BS2 A;  1I94 T;  3BCC D;  4H63 H;  1WYC A;  4AQG A;  1YQ4 A;  3T1Y T;  2XMX A;  1YQ3 A;  1YIT P;  3PU3 A;  2MBG A;  2Z6E A;  4OK0 A;  4DBR A;  4JFB A;  3CC7 P;  5EE2 A;  5FVL A;  1WT6 A;  3Q5P A;  3HUS C;  1B7T A;  3KVD D;  1W2E A;  5FKY A;  3O9X A;  5AW8 B;  4IFM A;  3UQ7 A;  4PJ0 E;  1YD8 G;  2POR A;  1WR0 A;  3MA9 A;  1VCT A;  4C90 A;  1IFJ A;  3VOP A;  4IDZ A;  3JAF A;  1Y64 B;  2V7L A;  2BS4 A;  2KNC B;  4FMS A;  3RHW A;  4I4T E;  4PR7 A;  5AVW B;  2XKM A;  2UXD T;  4PJ0 O;  1FZA A;  5HXS A;  2ZVO B;  2FYU J;  1ORM A;  3RIF A;  3C4Z A;  2BKN A;  4IRE A;  2ZT9 B;  2R4L A;  4CXX A;  2PFV A;  3II6 A;  2UXX B;  3RK2 B;  4QXH B;  3LW5 H;  5CGM A;  3U1A A;  5FXX A;  4EGW A;  1H0T A;  4PV1 B;  1EZ3 A;  1IBM T;  5LXT E;  4B6X A;  3RKO A;  4ZI3 C;  2LM9 A;  3PUQ A;  2I8D A;  3H3A A;  5CCG D;  2KYV A;  3GMA A;  5M1B A;  1L0L K;  3NSG A;  1FZC A;  4I7Z B;  4ZHQ E;  1WRG A;  2LRK A;  3Q1M A;  4L5G A;  4KJM A;  4ILB A;  5TIS E;  1LTJ B;  2DWK A;  3FB2 A;  3SWH A;  2JQQ A;  4RES B;  4YTP A;  3SY9 A;  2JMK A;  5LJM A;  1T3U A;  1WFD A;  5TIS O;  3JCU H;  4Z3T A;  1IBK T;  2IBZ D;  1S1C X;  1SQV K;  4U3F J;  2JDI H;  1FDM A;  3ZC1 A;  4DV3 T;  4RJW A;  2LSI A;  5JR9 C;  2YDR A;  3QH9 A;  4PW8 A;  2LHF A;  3P4W A;  2UXB T;  4H44 B;  3J9X 1;  4C4V B;  2E8I A;  3RC3 A;  2XE2 A;  3MTU E;  5B5E E;  5E79 H;  1FIO A;  2NW8 A;  5AW2 B;  1RQU A;  5KKZ B;  5L2L A;  2ZLD A;  2YKQ A;  5EFW B;  3FXD B;  1KTM A;  4QX7 B;  2YMY A;  4OX9 T;  2BCC D;  5DL6 A;  2M06 A;  2LRL A;  5B5E O;  2WM9 A;  4PD4 I;  5DJT B;  1NEK A;  2W6J H;  1I6Z A;  4C00 A;  2LSJ A;  5DAB A;  3NZP A;  3FWN A;  1FU1 A;  1T98 A;  4O3W A;  1SQX D;  2ZM6 T;  1ZP0 C;  1U7M A;  3KVA A;  4HWF A;  2O1J A;  2PRN A;  4RLC A;  2WSC H;  5FP3 A;  4B3T T;  1FJG T;  3E1I A;  2OMF A;  5JVD E;  4LSF A;  5G39 A;  1RF0 C;  1VQM P;  3U78 A;  2BZB A;  4FQE A;  1ZV8 A;  1IO4 A;  1GU4 A;  4ILU A;  5JRC B;  1IFN A;  3RX6 A;  4NXM T;  3UU6 A;  1R8I A;  2MNH A;  1KFN A;  1Z56 A;  2E5V A;  2QVA A;  3OYZ A;  2VL8 A;  3G4S P;  2J1D G;  4DR5 T;  3C1L A;  4ZS2 A;  3PLN A;  1IJD B;  1XTC C;  2QJK C;  4FZM A;  1XWM A;  3B5N C;  3EQ2 A;  4L76 A;  3F89 A;  2KS1 B;  4ZOL E;  3MKD A;  2OYI B;  1FZE A;  2Z5I A;  3TLW A;  1KZU B;  4UR9 A;  1L0N J;  3HD7 A;  4TUY E;  5APQ A;  2FJA A;  5DJQ C;  3G06 A;  3OA7 A;  1OMI A;  5IYU A;  3AA1 A;  2A45 G;  5FYM A;  2CXD A;  2O01 J;  5AW3 B;  2WZH A;  1X9B A;  4HKA A;  2XAH B;  1G2C B;  3Q5S A;  3N5L A;  2KSJ A;  3H1I G;  1U4Q A;  1E54 A;  2FYZ A;  3CCV P;  2R44 A;  4EZH A;  4PFP A;  1MKM A;  2CBJ A;  4H13 B;  2N1T C;  3VMY A;  4JUY A;  4DMV A;  1Y8A A;  2W81 C;  4KMC A;  1S4X A;  2K0L A;  1NO4 A;  4DOJ A;  3P4Q A;  4AYM C;  3FBZ A;  3LK2 B;  4JPZ B;  4AQF A;  1N36 T;  3H1H J;  1G8X A;  2B9B A;  1NU1 G;  4KHX A;  3EUH A;  4DUZ T;  4DND A;  1BCC G;  1NKN A;  1L0L J;  3FBL A;  5G38 A;  3IF8 B;  2ITA A;  1T2K D;  3CXH I;  4YTP C;  3HKB E;  4B3M T;  2ERV A;  4F6R C;  3RK3 B;  1W9R A;  2K5B B;  4HFC A;  3AEB A;  4LSH A;  2P7J A;  4CN6 A;  2OYO A;  5JDM A;  4DT0 A;  3RIU A;  3FXE B;  3I5C A;  3UFG A;  3C9I A;  2XNX A;  2ZT9 D;  5CJ5 A;  3AVS A;  1SQV J;  3TYY A;  1CUN A;  2WU2 A;  4PJL A;  4DJG A;  4GOE A;  1USD A;  2FKW B;  5PRN A;  3L36 A;  4JI6 T;  4YHH T;  2R32 A;  2RA1 A;  4IL9 A;  3JCF A;  3QRA A;  2PG8 A;  2MOZ A;  5HCJ A;  4XZC A;  1NJI Q;  2ZVN B;  3CWZ B;  3AED C;  1N7S A;  2LE8 A;  2PP6 A;  2LR2 A;  2FYU G;  2CA5 A;  3K1S A;  2R4P A;  1HWT C;  1MNE A;  3OJA A;  4D6T D;  1D0Y A;  3AE6 A;  3AXJ B;  2UXC T;  2Y0L A;  2HPC A;  5KJ7 A;  3FGA D;  1KNR A;  2NR4 A;  3P50 A;  2ZAE B;  1NWM X;  1HR0 T;  1DX7 A;  2PJQ A;  3UU8 A;  3VMA A;  1KV4 A;  1IZN A;  2K24 A;  3JSV C;  3MZW B;  1RH5 B;  2M6B A;  1GK4 A;  5JDL A;  3K3Q C;  4P0B A;  1RF1 C;  1PRN A;  3R2P A;  1AQT A;  1QVF O;  3WMM 0;  3TGU E;  5LBQ B;  1IFM A;  1QL1 A;  3VZU X;  3BAT A;  4TX5 A;  3K19 A;  2LLY A;  5AQU B;  3BRZ A;  2QYW A;  2A9U A;  2QE7 H;  2FUP A;  1NTM J;  1SP4 A;  2A72 A;  4AQY T;  3CCL P;  4IE7 A;  4YY3 T;  2DW3 A;  3IAO A;  4LF5 T;  4I55 E;  1US7 B;  1LT9 B;  2I59 A;  2FJD A;  4NUV A;  3RQW A;  4BAY B;  1Y9B A;  3AEC C;  2CHO A;  1QEX A;  3PQS A;  1KQS O;  4JF7 A;  2BBH A;  5IWA T;  2WPV B;  2DL1 A;  3RF1 A;  1JM0 A;  4YXW H;  4I43 B;  2IZ1 A;  4UXN B;  1S2E A;  3QOF A;  5FY0 A;  1RE4 A;  2AEF A;  4DVD A;  1SFC B;  2KC0 A;  3E0Z A;  2CK3 H;  4TNV A;  2E74 C;  1JY3 N;  4RO0 A;  2WT7 A;  2NPS C;  2O01 H;  2E76 C;  1FOS E;  1R5S A;  2W2U A;  1FZB A;  2QA4 P;  5AQM B;  5EK4 A;  5LP6 E;  2J1N A;  3AE1 C;  3ZYL A;  2VKJ A;  2CMR A;  3H1L E;  5A1L A;  4GYR A;  3HTK A;  3VR9 A;  4K3B A;  3UUN A;  2IAK A;  1PV3 A;  2YK0 A;  1A02 J;  2H7V C;  3RGU A;  3GN5 A;  3EAM A;  4AIS A;  2P1J A;  3AAA A;  4HB1 A;  3I55 P;  5CCG A;  4JI3 T;  4L73 A;  3A0H E;  3T97 A;  3CXH D;  1JB0 J;  1YI2 P;  5KLI C;  1GK6 A;  1EZV G;  2K9J B;  1Q81 Q;  3W67 A;  3S4U A;  2Q9Q A;  1L0N G;  3Q9D A;  3A0H O;  1URQ D;  3EFF K;  3P32 A;  3AE9 C;  1S94 A;  2VUR A;  2F1C X;  4IL6 X;  4ZZC A;  3L74 J;  1D1C A;  3N9M A;  2XM1 A;  1DH3 A;  5J1G A;  3U59 A;  4PJJ A;  3NMD A;  1NOH A;  3RL0 B;  1YJN P;  3I0O A;  2IBZ G;  2HPL A;  1SHZ C;  1N7S C;  2WZI A;  2CPS A;  3PTZ A;  4WZX A;  1SVF A;  4DBQ A;  2Y7S A;  2JR8 A;  3RYH E;  4ERR A;  4Y28 J;  3ETV A;  3U3I A;  3AE6 C;  3EI0 A;  5J2T E;  5JDF A;  4DR4 T;  4KHP T;  2XTL A;  3T0S A;  4LF4 T;  3SY7 A;  3C50 A;  3AE5 C;  1VF5 B;  4PJ0 H;  3PUG A;  4IDO A;  2Q5U A;  2FFD C;  3TLU A;  2CBI A;  4UVA B;  5CCH C;  4V1A v;  1MUU A;  2BCC G;  1VL2 A;  2WVP A;  1D7M A;  2E9X B;  4TWH A;  1QJ8 A;  3HKE E;  3VRB A;  2F1V A;  2MHL A;  3V2N A;  5AVR B;  3L72 E;  1L0L G;  4L74 A;  4O4J E;  1MM4 A;  2P2U A;  3TNU B;  2D0U A;  4K3C A;  3N9P A;  1OVR A;  3PUY F;  2N1T D;  8PRN A;  2ZMA A;  3N9O A;  3AE3 C;  4W7Y A;  3H1K J;  1FE6 A;  5AQK B;  4FES A;  2Z5H A;  1U7J A;  1YHQ P;  3A7O A;  4A56 A;  5TIS H;  1HX8 A;  1SQV G;  2OYH A;  3VMZ A;  3WU2 E;  2LXB A;  4Z1M H;  4U31 A;  2XSB A;  4IE4 A;  1OVV A;  4HWI B;  5JTG A;  5GON E;  4TN7 B;  3WU2 O;  4WY4 B;  1CI6 A;  1QVG O;  1LVF A;  1S9K E;  1KC8 Q;  2PRR A;  2VWA A;  3TZG A;  4OGQ C;  1SQP E;  1MZ9 A;  2V7K A;  2KND A;  2NW7 A;  2GK9 A;  3C4X A;  2YIU C;  4BJM A;  4O4U A;  5B5E H;  1SLQ A;  3SFE C;  1IJ6 A;  3MAC A;  3UAQ A;  3WUT A;  3E1R A;  3DP7 A;  2XAF B;  1X8Y A;  1LWU B;  2R5D A;  4ZI7 E;  2XAS B;  3FZL B;  3M3Z B;  1OVU A;  3NXS A;  3PE0 A;  4FSP A;  1GL2 B;  3E08 A;  4LSE A;  4KHZ F;  3TGU J;  2WSE J;  3VYI A;  1KMI Z;  4W80 A;  1KD1 Q;  3ZC0 A;  3Q5D A;  2JO1 A;  2XAQ B;  4O4L E;  4O49 A;  2JMH A;  2HN2 A;  1HGV A;  1K05 A;  5FNV E;  3MP7 B;  3VHL A;  2LHR A;  1TU3 F;  4U7J A;  2RMZ A;  2YPV A;  1KK7 A;  3HTK B;  1Y01 A;  1KOR A;  2OAR A;  4D64 A;  1KYO E;  1GFN A;  3PUR A;  4UEM A;  1X0T A;  4RJX A;  1KB9 E;  3PJS K;  3GN5 B;  3ZT7 A;  4U3F E;  4EB6 E;  3JTY A;  1W0A A;  2KNC A;  3CX8 B;  5LGN B;  4JQ0 D;  3N2G E;  3H1I D;  4AQR D;  3AE7 A;  3RRW A;  2KZ7 B;  5DL7 A;  3JAD A;  4R4L A;  2VKO A;  2JPF A;  3TF5 A;  3ONL C;  4DV6 T;  1SQP K;  2IWV A;  2W66 A;  4O3Z A;  2KI7 B;  4OYK A;  4H0L C;  1NWQ A;  2E43 A;  3UUL A;  2VVS A;  3AE8 C;  3ZCJ A;  3P8C E;  3L72 D;  1EC5 A;  5JDH A;  3CCQ P;  3KYQ A;  1W5C E;  1OFC X;  3PF1 A;  4DID B;  1FS0 E;  1AVO A;  1BCC D;  3V2R A;  2WPR A;  3SWY A;  2V7I A;  1SQB E;  1IFP A;  1NTK K;  4ASV A;  3OTO T;  1M8O B;  3MJX A;  4JI0 T;  1M1K Q;  3IBP A;  2H88 C;  5BU8 B;  2R89 A;  1EZV I;  3O6Q B;  2E74 D;  4BXL A;  2M5A A;  2NPS D;  4FRT A;  2E76 D;  3FZF B;  2LKM A;  2PFX A;  1Z8U A;  4O4I E;  3V4W A;  3AB3 B;  3Q2Y A;  3KHU A;  1W0B A;  5JDQ A;  3RBH A;  3WI4 A;  2BDE A;  2CLY C;  4IGU A;  2OYH C;  2IBZ I; 
#chains in the Genus database with same CATH homology
 2LHN A;  4PW8 A;  2QA7 A;  5HXE A;  2LHF A;  1HXX A;  2KDY A;  3AA6 B;  1HTJ F;  3J9X 1;  4EIW A;  4H9R C;  2LFU A;  2W63 A;  1Z0P A;  2E8I A;  3RC3 A;  3C4W A;  2XE2 A;  4WW0 A;  2NW8 A;  1FIO A;  2LOS A;  5L2L A;  2KXP A;  2ZLD A;  3VE2 A;  3FXD B;  3Q5X A;  1UX4 A;  4QX7 B;  3O1H A;  2M06 A;  5DL6 A;  3CKD A;  3HKC E;  5J2U E;  3POQ A;  2KXP B;  1MMA A;  2CM0 A;  2WM9 A;  5LA6 E;  4EOZ B;  4GF4 A;  2KLQ A;  4AYD C;  3SOL A;  2V7J A;  4AZL A;  5FY7 A;  1GFQ A;  2C5J A;  1YKE B;  2LSJ A;  5DAB A;  3NZP A;  5C8Y E;  2V1D B;  1T98 A;  3I1A A;  4EAH A;  5L3G B;  4O3W A;  4RL9 A;  2EHO C;  3ZMS B;  4UV8 B;  3AA0 A;  3POR A;  2PRN A;  3KVA A;  4RLC A;  3FHN A;  2NW9 A;  3T20 A;  4CQI A;  5JRC A;  2WMN A;  4ZS3 A;  3ZYK A;  3ZMU B;  4GK5 E;  5FP3 A;  4PK5 A;  3AA0 B;  4XNL A;  2OMF A;  5JVD E;  4LSF A;  4ANJ A;  3POU A;  3U78 A;  2BZB A;  1BR0 A;  3H37 A;  2L3L A;  2KWI B;  4ILU A;  4X20 E;  5JRC B;  1ZHX A;  4E7Z A;  3RX6 A;  3L09 A;  5DL5 A;  2MNH A;  4UEL A;  4CI2 B;  4TZ4 C;  2ZLY A;  2Y2X A;  3R6N A;  2PBI A;  1OPF A;  4KR8 A;  4LSI A;  3OYZ A;  2VL8 A;  2J1D G;  1BH3 A;  4ZS2 A;  5CA0 E;  3WAJ A;  2CE7 A;  2V7M A;  4FZM A;  1QJP A;  4X1I E;  2BVM A;  3HL6 A;  3N9Q A;  1LKX A;  3KV4 A;  4IE0 A;  1PHO A;  5L3E B;  3UUM A;  4YLH A;  3ETU A;  4ZOL E;  3MKD A;  5LCY A;  4N58 A;  2X68 A;  5HAX A;  4JEU B;  4X1Y E;  3UUX B;  2ZM2 A;  2LSK A;  3ZCI A;  3RH3 A;  2XE3 A;  4GCS A;  3BQI A;  2ODJ A;  4AXP A;  4TUY E;  5DJQ C;  2Y0H A;  1HFA A;  3PTR B;  2L9Q A;  4WBO A;  4TV9 E;  5FXW A;  1GFM A;  1BR2 A;  2Q9Q C;  5IYU A;  3NBX X;  4EXT A;  2K48 A;  5FYM A;  2CXD A;  5FXV A;  4GK0 E;  3CVR A;  2JMM A;  3AA1 A;  4AYN A;  2D5U A;  3AAI A;  4FZL A;  3SZV A;  4HKA A;  1D0Z A;  4PJN A;  4N78 D;  2XAH B;  2NWB A;  3W15 B;  4MBQ A;  3T8O A;  4ADZ A;  4UF0 A;  3AA1 B;  3N5L A;  3OKQ A;  1U4Q A;  5IHY A;  1E54 A;  4ZI2 D;  4WBN E;  1WR6 A;  3JC6 C;  5LHG B;  4HGA A;  3MXZ A;  3UT5 E;  2IC6 A;  4HEA A;  3RYF E;  3PQU A;  4JEH B;  4EZH A;  1VOM A;  4PFP A;  4UF0 B;  3LK2 A;  4G2A A;  5KX5 E;  1BT9 A;  5F3J A;  4JUY A;  4DMV A;  4O3Y A;  4HFV A;  2W81 C;  4KMC A;  3QRC A;  4CZZ B;  2K0L A;  4AYI D;  3KDS E;  4AYM C;  7PRN A;  3FBZ A;  3LK2 B;  1X79 A;  1IJ5 A;  4O2B E;  2DLR A;  2VAS A;  2G0U A;  3A2S X;  5HYA A;  4MFR A;  4MHC A;  2K4T A;  4AQF A;  4DO0 A;  1G8X A;  1ZHC A;  2X67 A;  1BXW A;  2E9X C;  4AKG A;  3EUH A;  2WBL A;  4DND A;  5DL8 A;  3LK3 A;  3CQG B;  3FBL A;  3IF8 B;  3PUS A;  4E7S A;  5KDM C;  3SYS A;  3L3P A;  3HKB E;  5HXH A;  5LGT B;  3SZD A;  4HTE A;  4AI6 A;  2ERV A;  4F6R C;  4FI5 A;  1YS5 A;  2FGQ X;  2K5B B;  3BQK A;  3HA4 A;  1MND A;  4PK6 A;  4LSH A;  3AAE B;  2XAG B;  2Y48 B;  2LJL A;  5JDM A;  3DA4 A;  3FXE B;  3AVR A;  4E1S A;  2GE4 A;  2ODU A;  2DWG A;  5H6R B;  4PFO A;  3AVS A;  1CUN A;  2ZM8 A;  4PJL A;  1OWA A;  3V5S A;  5PRN A;  3DTO A;  2K9A A;  5AFU K;  2D2S A;  4C91 A;  2RA1 A;  4O2A E;  5AFU L;  3QRA A;  2PG8 A;  2MOZ A;  4XZC A;  4CI3 B;  3LBX A;  2IW5 B;  3SYB A;  2N1G A;  3EDU A;  4O4H E;  4OYJ A;  1D1B A;  4NUU A;  3CWZ B;  6PRN A;  2NP9 A;  3CML A;  5LGU B;  4GOU A;  1ZEE A;  4EYY R;  5KMG P;  2LE8 A;  3LBX B;  1LRZ A;  4AKR A;  2CA5 A;  1HG2 A;  2DNX A;  2UXN B;  5JQG E;  3QUJ A;  2XTQ A;  1MNE A;  3OJA A;  1D0Y A;  2O4V A;  2Y0L A;  1H6S 1;  3QK6 A;  4JCH A;  4O3X B;  5BMV E;  3C64 A;  4AKR B;  1NWM X;  4IE6 A;  2PJQ A;  4EYU A;  2A2F X;  1IZN A;  1MIY A;  2K24 A;  3RYC E;  1AJ3 A;  3UPG A;  5FMN A;  2Y6X A;  5JDL A;  3K3Q C;  4P0B A;  1PRN A;  4L0R A;  1HG5 A;  3GMI A;  4Z8X A;  4GCP A;  1IZN B;  5LBQ B;  2NOX A;  4G76 A;  2ODV A;  2OA5 A;  3VZU X;  2MYS A;  4KUM B;  1H7C A;  4TX5 A;  1ZKE A;  5F8P A;  3K19 A;  3NZQ A;  4KP3 C;  2YNK A;  3KBT A;  5L3B B;  3A5X A;  1ZHZ A;  4PNI A;  2KMF A;  1QUU A;  4BA9 A;  2A72 A;  1NAF A;  3KFW X;  5JR9 A;  2FGR A;  4BUM X;  4G75 A;  4IE7 A;  3ZEF B;  3GP6 A;  4DMW A;  1LVK A;  5HWX A;  2VKH A;  1G73 A;  3CX6 B;  2KT9 A;  1MPF A;  4I55 E;  3LK4 2;  3VZT X;  1US7 B;  5JR9 B;  2I59 A;  4NUV A;  3I9Y A;  4PK4 A;  4BAY B;  1MM5 A;  1YKH B;  2LSY A;  4QHO A;  4QQ1 A;  3DJB A;  3KVB A;  1O3X A;  4D5U A;  1E1H B;  3NRY A;  2YU2 A;  5E0O A;  1HCI A;  3PQS A;  1D1A A;  4QX8 B;  3J7Y q;  1FMW A;  2HPJ A;  5HXR A;  3HI2 A;  2XTR A;  4I43 B;  4QXC B;  4CI1 B;  3ZYM A;  1GFP A;  4UXN B;  2YEV C;  5IYZ E;  5FY0 A;  3R84 B;  4FT6 A;  3LK4 1;  3ESL A;  4B61 A;  3B13 A;  2Y0K A;  3K8P C;  4UVB B;  2EHO A;  2VB6 A;  2L8K A;  5T5F A;  3VY8 X;  4AUI A;  4DVD A;  2KC0 A;  2WAU A;  3E0Z A;  2DI4 A;  5LJN A;  3ZN0 B;  3DA3 A;  3P8C D;  2BVL A;  2H3R A;  2XUE A;  3LG7 A;  5EK2 A;  5L3D B;  5JDP A;  2EHO B;  4U9C A;  4KBM B;  3SRZ A;  1G90 A;  4P09 A;  3VKG A;  2VK9 A;  2XQY A;  3M65 A;  3Q2M A;  5EK4 A;  4H9N C;  5LP6 E;  3CPZ A;  4BJN A;  3VZW X;  3BK9 A;  2J1N A;  4X1K E;  3ZYL A;  2VKJ A;  2CMR A;  4UVC B;  5A1L A;  1THQ A;  3ANW A;  4GYR A;  3N9N A;  4QWN B;  3UUN A;  3VU7 H;  2MTQ A;  1HS7 A;  2JJ9 A;  5LYJ E;  2QTK A;  3O0E A;  3GWH A;  2IAK A;  2YK0 A;  3IHR A;  3ANW B;  2H7V C;  5HXC A;  4N59 A;  3GN5 A;  3AAA A;  4KR4 A;  2WMO A;  2YIN A;  3EDV A;  4PJM A;  3CQX C;  3K3N A;  2QGS A;  2EHO D;  2N2L A;  4M1P A;  4KRA A;  3GA8 A;  3PDY A;  3AAA B;  4ASK A;  4GYS A;  4AKI A;  3HW9 A;  4U74 A;  1IAP A;  3KV5 A;  4H9Q C;  3K3O A;  4FSO A;  2W0G A;  5LHH B;  3S4U A;  4I50 E;  4UV9 B;  2Q9Q A;  4IIJ E;  3Q9D A;  3UTK A;  3RC8 A;  1U5P A;  2X51 A;  4H9O C;  4YJ2 E;  1S94 A;  2W00 A;  3LK3 B;  3PU8 A;  4H63 V;  2NTY A;  1D1C A;  3N9M A;  5FY1 A;  3RYI E;  2Q9Q B;  5J1G A;  4HE8 A;  3KIN B;  2A3D A;  4PJJ A;  2CWO A;  2IC9 A;  2C5K T;  3I0O A;  4PUX A;  3VE1 A;  2HPL A;  1SHZ C;  3BQL A;  2N9D A;  3ZPO A;  4DBQ A;  2Y7S A;  2V26 A;  3N9L A;  4IST A;  2NTX A;  3RYH E;  4ERR A;  3CX7 B;  3UU2 A;  1HXT A;  3ETV A;  3U3I A;  5FVN A;  4QKN A;  5JDG A;  5J2T E;  5JDF A;  4AKL A;  3HOE A;  2XTL A;  5TAO A;  3T0S A;  3V5U A;  3SY7 A;  3WI3 A;  3O1I A;  3C50 A;  1ZV4 X;  4L9I A;  3EVY A;  3PUG A;  2RP4 A;  3P7I A;  5ETW A;  2E9X A;  2HH7 A;  4U72 A;  1P4T A;  1HF8 A;  2ACX A;  5EZY E;  2Q9Q D;  3ONX A;  5DQV A;  4UVA B;  4H9P C;  2KWH A;  2P9B A;  2KIN B;  4V1A v;  1ZHW A;  4FOZ A;  2JRK A;  1ZHT A;  4XAX B;  4FZN A;  4XBF B;  2XE1 A;  2E9X B;  2ES0 A;  3LFM A;  1QJ8 A;  1FMV A;  2DCF A;  1BR4 A;  3HKE E;  3MK7 C;  1YW0 A;  2F1V A;  5JDN A;  2F1T A;  2MHL A;  3ZN1 B;  3JC6 D;  1D0X A;  4O4J E;  1VRB A;  2SPC A;  1MM4 A;  2D0U A;  3ZMT B;  3CQC B;  2WWU A;  1UCU A;  3N9P A;  4H9S E;  3ZJ1 A;  5LNK A;  2W80 C;  3I9W A;  4HN9 A;  4XNK A;  3ZMV B;  3OYX A;  3TKL B;  8PRN A;  2ZMA A;  5LG4 A;  3N9O A;  3C5O A;  4GHB A;  4ISS A;  2X0L B;  2VKD A;  2XHE B;  2YU1 A;  4OFZ A;  5DQW A;  5L3C B;  4RLB A;  4FUV A;  4E1T A;  1Q9F A;  2X9W A;  4FES A;  4ZI2 C;  4D65 A;  5G26 A;  2W61 A;  4AKH A;  1MMN A;  5D5D A;  2E9X D;  3N2K E;  1HX8 A;  1S35 A;  4A56 A;  4IE5 A;  3VKH A;  1V9D A;  2CEA A;  3RRC A;  4J2C A;  2X9Y A;  3E22 E;  4WNK A;  3KV6 A;  4ZI3 D;  3PRN A;  2X9X A;  2LT3 A;  5HWY A;  3RPU A;  4F4B A;  4MAL A;  2DHR A;  1BR1 A;  3HR0 A;  2CLY B;  3O1J A;  3WI5 A;  4IE4 A;  4YFS A;  5ADX K;  3F2E A;  1GFO A;  5LOV E;  5GON E;  4TN7 B;  5ADX L;  4TV8 E;  3AA7 A;  2CCQ A;  1MMD A;  1LVF A;  2N2N A;  5LBM A;  4YHJ A;  3IEE A;  1HXU A;  4AKM A;  3LJC A;  2VWA A;  3FYX A;  3TZG A;  3KBU A;  4OHF A;  1KNZ A;  1QJ9 A;  2V7K A;  1ZHY A;  4AYE C;  2KND A;  2NW7 A;  3I0Q A;  2GK9 A;  3SS1 A;  3AA7 B;  1WRD A;  3KV9 A;  3HOL A;  2J4U P;  2XAJ B;  3C4X A;  5M4Y A;  3T24 A;  4GIW A;  4BJM A;  4O4U A;  5L3F B;  1IJ6 A;  3MAC A;  2WSS V;  4IHJ E;  4O8S A;  3VY9 X;  5GV0 A;  3UAQ A;  2LOP A;  3DP7 A;  2XAF B;  2M07 A;  4ZI7 E;  2M67 A;  3HKD E;  2XAS B;  3C51 A;  4JLE A;  2C0S A;  5EK3 A;  4UIG A;  1WYB A;  3QC9 A;  2LSG A;  3PE0 A;  2D0T A;  4FSP A;  3E08 A;  4LSE A;  1MIW A;  5CA1 E;  2W62 A;  3C98 B;  3MZK B;  4C69 X;  4EZ4 A;  4O4X A;  5LHI B;  1OSM A;  3HWB A;  4K0U A;  3ZC0 A;  1QSD A;  4AQF C;  2B1E A;  2XAQ B;  4O4L E;  4O49 A;  2JMH A;  2N2M A;  4YJ3 E;  5FNV E;  3VHL A;  1WLX A;  3ZMZ B;  1SA0 E;  4H63 H;  2LHR A;  1WYC A;  4AQG A;  2YPV A;  1KK7 A;  2XMX A;  3PUA A;  3PU3 A;  2MBG A;  4D64 A;  2Z6E A;  4OK0 A;  4DBR A;  4JFB A;  5EE2 A;  1GFN A;  3PUR A;  2X27 X;  4UEM A;  1FEW A;  1B7T A;  3KVD D;  2LEH A;  4RJX A;  3GN5 B;  2ZFG A;  3O4X E;  4EB6 E;  3JTY A;  3O9X A;  2KZ7 A;  1YD8 G;  3CX8 B;  3ZJ2 A;  4CXW A;  5LGN B;  2POR A;  3MA9 A;  3N2G E;  4C90 A;  4IDZ A;  5H6Q B;  4FRX A;  1Y64 B;  2V7L A;  3RRW A;  2KZ7 B;  5DL7 A;  4P0A A;  4FMS A;  3EMN X;  4I4T E;  2VKO A;  2JPF A;  1Q9G A;  2XG6 A;  3OBV E;  5HXS A;  3F57 A;  5FXZ A;  2CXL A;  4O3Z A;  4OYK A;  1ORM A;  3POX A;  3C4Z A;  3UUL A;  4CXX A;  2PFV A;  2UXX B;  4QXH B;  3ZCJ A;  3ZLI A;  3WAK A;  5FXX A;  5JDH A;  2Y8D A;  4G63 A;  2CXF A;  1EZ3 A;  5LXT E;  4B6X A;  3RKO A;  4ZI3 C;  3UFE A;  2XE5 A;  1UX5 A;  2LM9 A;  3PUQ A;  4QXB B;  3V8U A;  2H7O A;  3H3A A;  3D0T A;  3AAE A;  2V7I A;  1OXZ A;  2C5I T;  3NSG A;  3MJX A;  4ZHQ E;  4L5G A;  4PAG A;  3B57 A;  3IBP A;  3N2O A;  2DWK A;  3FB2 A;  4FJO A;  4AFK A;  2X66 A;  3SWH A;  4FRT A;  4GCQ A;  5JRE A;  2JQQ A;  2ZM0 A;  2CWY A;  3Q5W A;  3SY9 A;  4CXY A;  2JMK A;  4O4I E;  5JH7 E;  5LJM A;  3F31 A;  2X9H A;  3G7G A;  4Z3T A;  3NRX A;  3AB3 B;  4MLK A;  1MIV A;  5CB4 E;  5JDQ A;  3RBH A;  3WI4 A;  3AA6 A;  3ZC1 A;  2BDE A;  4RJW A;  2LSI A;  2CLY C;  4IGU A;  5JR9 C;  1MMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...