1IZNB

Crystal structure of actin filament capping protein capz
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CapZ alpha-1 subunit
publication title Crystal structure of CapZ: structural basis for actin filament barbed end capping
pubmed doi rcsb
source organism Gallus gallus
total genus 88
structure length 270
sequence length 270
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 1iznB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1iznB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 1iznB02
2KZ7B 3LK3B 3LK41 3AAEA 5AFUL 3LK2A 5ADXL 3AAAA 3AA6B 5AFUK 5ADXK 4AKRA 2KXPA 3LK42 1IZNA 3AA7A 2KZ7A 3LK3A 3AA0B 3AA1B 3AA6A 3AAEB 3LK2B 3AAAB 4AKRB 3AA0A 2KXPB 3AA1A 3AA7B 1IZNB
chains in the Genus database with same CATH superfamily
1S5LH 1T8BA 3HKCE 5CGMA 1HWTC 2WPSA 3ETUA 2R5DA 4AKHA 2ZYDA 3KV5A 3I55P 3PRJA 3SRZA 4ZEYA 2AXTE 4RLBA 4U33A 2KP8A 1ZV4X 2XQ9A 3BASA 5DL7A 3SFDA 2FYUG 4K35A 3KHUA 4DO0A 1U7MA 1SQVE 5HCMA 2WITA 2HLOA 1HBWA 1YBKA 2R5BA 1E54A 3AA1A 1L0LE 1OSMA 3CMEP 3LK41 2B89A 2E9XD 3H32B 4HWFA 1D1CA 4NPFX 1VQLP 3O0EA 4EDFA 2Y7SA 4JEHB 2E5TA 3FBLA 3N9PA 1URQC 3CC4P 3SZDA 2WPRA 2Q9QD 5FL0A 2ZXEB 4CI3B 3O8ZA 3AA6A 3K5BA 1YJNP 4HFIA 3PUGA 3L71J 4DR2T 2KI7B 2X51A 3D70A 1YKHB 3CI9A 3A0HH 3PORA 3GMIA 2FKWB 3PGRA 5GTIH 4L73A 2WB5A 4D6TE 2JRKA 3LDQB 2WTYA 2BG9C 1SS1A 3VMXA 2V7KA 5FXWA 4D64A 5AW8B 3RF1A 1OZHA 1T2KC 3I5CA 1UX4A 1EZVI 4GDOA 4YHJA 4IL6E 2FYZA 3A7MA 5LHIB 1IJ6A 2BASA 3GF7A 4CI2B 2LKHA 4JV5T 4YSZA 1ZOYC 3BATA 2FBWA 2FUPA 1MNEA 5AQLB 4MHCA 5L4EA 3PUXF 2WJQA 2SPCA 1FZCB 1EDLA 2XE3A 5KJ7A 2CM0A 3KINB 1BCCG 3H1HD 1FZFA 5TJHA 1HJ0A 4FRTA 1JCDA 3VMZA 5LBQB 3HW9A 4DR6T 4TZ4C 2XQ8A 2L3LA 3CX8B 1LT9A 2LKMA 1S5LE 4QWNB 4O2AE 2SPZA 1FOSE 4H9NC 1BH3A 4JQ0D 3NWIA 4PD4I 4H13B 1VF5D 3ANWB 1J1DB 4I6MC 4D5UA 2LSIA 2KSEA 1CZQA 3PUYF 1H89A 2OYHC 1M8OB 1MMAA 1SQXD 3UQ7A 1L0NJ 1SQQJ 3ONLC 1Y47A 3KVAA 1JCCA 4HGAA 2JQ9A 4GKJT 2WQYC 1KILA 4DUYT 1SP4A 2WU5A 3ZMSB 2R3CA 1FDMA 2KSRA 5DQWA 2YXRB 2E76B 2DL1A 5GTHH 1NO4A 3AECA 3H1LE 5KJ7D 3CX5H 1DH3A 3BCCG 3LFMA 4DR3T 4OYKA 4DV7T 4WYVA 2P2UA 4EEBA 3N9OA 4AKMA 2KXPA 1NHLA 2VVNA 3HTKA 3ESLA 4EXTA 3TNUB 1W2EA 1M1JB 3CCLP 3FZKB 4UVAB 4X66T 3RIAA 4HWDA 4KHXA 2DLRA 3VKGA 1KB9H 2VKOA 2AXTO 3O1JA 5ETWA 4RJXA 2FXPA 3CPWO 3SOLA 3IR9A 3H1JD 5AW0B 3RYIE 1YJ9P 2R89A 1ZMEC 2HN1A 1YW0A 3RYCE 3AVSA 4L76A 1RHZB 4WWIA 1XTCC 4K3CA 3L70D 1N73C 1DIPA 1KILD 1NTZJ 4H44B 1SQQD 4OYJA 1IK7A 3T20A 2NZ2A 3M9QA 1IO4A 2K24A 2V1DB 2D0UA 2WZIA 1PP9G 3JCFA 4A56A 3V4WA 3S1KA 2PFXA 1LP1A 1Q7YQ 2A45I 5AQFB 1ZLLA 4AZLA 5AW1B 4YXDC 2V6YB 2ZJSE 2IIUA 2K9JA 3B71A 2CHOA 3D0TA 3HE4A 5TAOA 3VE2A 2VKHA 3RBHA 8PRNA 3HUSC 1KYOE 4PK6A 3UFGA 3PV0F 2M3EA 1N7SB 3AB3B 4PJ0O 3USSA 2H88C 3K1SA 1GL2A 3ETVA 3VR8A 2YO2A 1OW8A 4AKGA 2DHRA 3DZMA 2IWWA 4EIJA 1L0LK 1LTJC 1OMIA 1SQPD 2KIKA 2M5AA 4I0UA 2J58A 3GP6A 3L3PA 3AXJA 3N4XA 1NKZB 2WSCJ 4AKLA 2WM9A 5HXCA 1OVVA 4B6XA 1NTZD 2WY2A 2YIUC 1ZP0C 3IAOA 5KAIH 5AVZB 2MYSA 1NH4A 4C7NB 4DBRA 4KP3C 4HFEA 2QJKC 3KYQA 4ZXLA 2V4HA 5APWA 1BR0A 1NTKK 2XNDH 3KFWX 1IZNA 3W68A 2RN0A 5J2TE 2R4LA 1XTGB 1KK7A 3RC3A 1YQ3A 2JMMA 4GHBA 2M67A 2W61A 5H2FE 2EHOA 2ZT9B 4KBMB 4HYTB 3FB2A 4TWHA 3P8CE 3Q5PA 2WAUA 5FY1A 4IFFA 5JDHA 4NXMT 2JJLA 1L4AA 3SY9A 2MAWA 5BU5A 3UUMA 5FL1A 2YINA 4GOFA 3AAIA 3O6QA 2FFDC 2W63A 2E5LT 1SQVJ 2E8IA 1VQOP 1S5LO 1W09A 1NTKG 1WR6A 1BGYD 3TKLB 4O49A 3G6EP 2I8DA 2HFED 2CXFA 3E1RA 3ZC1A 2Z5HA 2WT7B 2N9YB 3RGLA 1HGZA 4JI4T 3JC6C 1RE4C 3DWOX 5HXRA 5JR9C 2BBHA 5L47A 1BXWA 2E9XC 3CWBG 4HFBA 1NENA 3A0BE 1ZHTA 3GN5B 1P84E 2EHOD 3QNUA 2Y0LA 5M4YA 5B66H 2WCAA 2V7LA 3V2QA 2BS3A 1OEDE 1L4AD 1EDJA 2XQYA 4C91A 1OVUA 5BR8T 1KQGB 3CD6P 3LIEA 5LGUB 2KT9A 2CPTA 3LJCA 3CK6A 3VU7H 3MZWB 4GKGA 1SE7A 4UVBB 5LGNB 4O4UA 1X22A 3A5XA 1USEA 4B3ST 1T3JA 3ZSTA 1H0TA 2YK0A 1AJ3A 1FAVA 1JY2P 2ACZA 4FJOA 3O4XE 3Q5RA 2X9WA 2W90A 2NTYA 4YPCA 2XQ7A 4JI2T 3H3AA 4CQIA 1W0AA 2E74C 4FI5A 3ZKRA 2V5DA 3MJXA 3L75D 1NTMK 1DD4A 3NVOA 4DCKA 3UUXB 4LMLA 4HJGH 1K04A 5FMNA 2JO1A 3EMNX 1VRBA 4LFCT 2FGRA 2A9UA 1ZHWA 4U7YA 5AVTB 2D2CC 3FXDA 1DEBA 1ZXGA 1D1AA 3Q1MA 4C90A 2LM9A 4JYAT 1GU5A 2X0YA 2OYIA 1PV3A 1KEYA 2XQAA 1GMJA 2XSAA 3BQLA 1URQA 1Q82Q 3RK3C 5CBNA 2NRGA 2W6AA 4IDPA 2YIUB 1VQ5P 4U9CA 3MKDA 1HXUA 1WR0A 3L73J 3HI2A 2GM4A 2C9NY 2KLVA 1NTMG 2VK9A 5D5DA 2QJKB 4X62T 3CC7P 5HXEA 3SWYA 3MK7C 1MIYA 1U57A 3T97B 4HTEA 4O3ZA 2LE8A 4ISTA 5HEOA 4DV1T 5LP6E 4IE5A 1M7KA 3NRYA 2D5UA 4JYBA 3IN6A 4PFOA 2BG9A 3PH0A 3MACA 3HWBA 3NJTA 4AISA 2PTFA 4N6JA 1AFOA 5AQVB 3AA7A 3H1LJ 1J1JA 3FYXA 2KOGA 3WUVA 4IE7A 4E7ZA 1OX3A 1CHUA 2N2LA 5LJNA 2L5GB 1URQD 3L37A 4BJMA 4LF6T 1OWAA 5LHGB 3VMYA 2LHFA 2HR3A 4Y99B 4QQ1A 1ZOYA 4EYYR 2V6XA 4LMKA 2CXDA 3NXSA 2LRKA 4P0AA 1GDTA 3JSVC 2VL8A 2M06A 2K88A 2C5JA 3CCVP 4HE8A 4H63V 4FMSA 3ZCJA 2MJZA 3H1HE 4QH1A 1S2EA 3Q2MA 1QL1A 3M3ZB 4CXYA 4EEDA 4PV1C 1FBMA 4YJ3E 4TT3H 3LW5J 3PDYA 3V5UA 1LWUA 3UIAA 5G38A 4LFBT 1CW5A 1IFDA 4O4XA 1T2KD 1G73A 3N9LA 5ABHA 2OYHA 1SQXE 2BKOA 3QH9A 5BMVE 5TISH 2HYNA 3RQWA 4ZI2D 2WQYA 2JWAA 2XPKA 1KF6A 4EIWA 2C0SA 5IYZE 5H6QB 2POHA 2NTXA 3NTNA 3N2OA 2QJYC 2V7JA 1E5WA 2F4VT 1SQBD 4YTMA 5AQKB 1KTMA 3RYHE 4GODA 4YT0A 4TNVA 4YSXA 3HE5B 4P09A 5HXSA 2ZFCA 2YKSA 1J1EC 3UULA 2WDQA 1R5LA 1NYHA 2Y0CA 3VZWX 4E1SA 4U3FG 2JDIH 1S4XA 3H1JE 1E79H 4ILUA 3RI5A 1A02F 1FMWA 1Z8UA 4HFVA 1OVRA 3MD0A 1EZVD 2JQQA 3L70E 1N73A 4C4VB 1BE3G 1KILE 1N86A 1SQQE 3TLSA 2F1CX 1MIVA 4P1NA 3KV9A 1VQ9P 4I43B 5DJQC 2IYPA 3KDSE 4U31A 1KNZA 1GW3A 3ZYKA 4O9BA 5KAIO 3I0OA 2AXTH 1RQVA 2IZ1A 3F31A 3C8VA 4YXDA 1KC8Q 4G2AA 3P4QA 5GONE 2Q5UA 3AEAA 4HWCA 1JTHA 3HUSA 2R8AA 2J1NA 4TLFA 2LHNA 3CLQA 2ZLYA 4DV4T 2W83C 3NZPA 1M1KQ 3QWOC 4UF0B 4X65T 3UU6A 2WSFJ 3N9QA 2XZRA 3NRXA 1SQPE 1LTJA 4HFCA 1SUMB 2KK7A 4PD4D 2CBIA 4KR4A 3HOLA 2N1TB 1GFMA 4I7ZC 1AJYA 2MHLA 2X27X 2Q9IA 3UQ4A 4UB8E 2JEEA 4IDQA 1KQFB 5JDLA 3BRVB 4RJWA 5DABA 1NTZE 2LLYA 2QRXA 2FJDA 5EE2A 1ZP0A 3LK2B 4LSFA 2V7IA 2FJAA 7PRNA 4AKRB 2KC0A 3SYSA 1S5LX 3MZKB 3H1IJ 3ZYLA 2O4VA 2W4XA 3V4QA 3L09A 1BR1A 2L91A 3KDPB 1NWQA 2CXLA 5AW5B 3F89A 2XJ7A 3RHWA 5A1LA 5TISE 1Q81Q 3AA0B 3CXHI 4HFDA 1DD3A 2WVRA 4HWHA 5AW7B 5HEUA 5B66O 1Y8AA 3AEEC 1EDKA 4C7RA 1CI6B 4IL6H 2Y9YA 2J62A 2QJPB 2BCCG 4QX7B 5CCHC 1FZCC 1GK6A 3H1KD 5AQIB 3LK3B 2FFDA 2ZFGA 1X79B 1SHZC 3IEEA 5GV0A 1W5CE 4AI6A 1BGYE 2VB6A 2N2MA 1HVVA 4WW0A 3ZT5A 3N9MA 1MM4A 4GIWA 2XAHB 1MV8A 4DV2T 3JCUE 3KPEA 1RE4A 2J5UA 2DNXA 3C98B 2OGUA 2A06G 5JR9A 4RKUJ 3I1AA 3WAKA 1IFNA 1BE3D 3DWNA 2DCFA 2E9XA 1QLED 4H13C 3DA3A 1J1DC 1J1EB 2YMKA 3RIUC 3VP8A 1ZR4A 2UXBT 2QA4P 1Y01A 4KHZF 2Q9QA 2RA1A 5L2LA 1MUUA 4IE4A 2Y9ZA 3L39A 3M0DC 3MIWA 3TSIA 5J0ZA 3PURA 3AEGC 3JC22 2IFNA 2E76C 3PUVF 2KZIA 1R5SA 2IFMA 2WMMA 4H9QC 5AVWB 1JY3N 5JTGA 3L71G 3U3IA 1K9MQ 1BR2A 4CXWA 2LHRA 3L74G 2ZVOB 3E22E 4W7YA 3UU5A 2VL0A 5KLVJ 3N9NA 2NW8A 4Z3TA 4JPZB 3JC6D 1M1JC 1JNRA 2X9KA 5CJ5A 1XWMA 4IIJE 4I4TE 4JBWF 1JY2O 1FDOA 3OKQA 1HNXT 2OMFA 2CEAA 3L75E 1YI2P 4IFDK 3I0QA 3ZSSA 2E75B 4ILCA 4JI1T 3C5OA 4AYMC 2CHNA 4I50E 2B1EA 2V26A 2RH0A 4R4MA 4J2CA 4H44C 3AAEB 3O9XA 3AE2C 4YHHT 2QA7A 3KZIE 4I7ZB 1LTIC 4U7JA 2XTRA 3H1HJ 3TGUJ 3JADA 1ZHCA 1NU1J 3EFFK 4IDOA 4ZKPA 4OK0A 3LW5H 1JNZA 2QTKA 3CVRA 1RQUA 1L0NK 2J47A 2W0GA 3LIDA 3U1CA 4V1Av 1N7SC 1SVFA 2P67A 5CB4E 4QXCB 4B86A 2X0HA 2R3SA 1XDOA 5KLVD 2KS1A 1SQXJ 2HG5D 5HEGA 4UB8O 2E74D 1T7SA 1YQ4A 2CLYB 1KYOH 1YYCA 1IBMT 2C0XA 4H0LB 4AYDC 5FXZA 1FZBA 4X5TA 2MBGA 2Z4EA 4TWFA 3QRCA 4R4LA 3MHVA 3PTZA 2J59M 3ZMZB 4BRYA 4ZI2C 3R2PA 1RF1A 3B5NC 1L0NG 2D2CD 1UIIA 2ZAEB 4N75A 2KNCA 1BR4A 2G8YA 5EK4A 4Z90A 2IUBA 5AW9B 5APVA 2LSJA 3RK3D 1PL5A 3TGUD 1MMGA 5TISO 2VQFT 1NU1D 5BU8B 2W81C 2WPQA 1R8EA 3HOEA 4HWIB 3AE6C 3FXEA 1VCTA 5HYAA 1HX1B 3L72G 3Q5SA 3C51A 3N2GE 1T1LA 4AYCA 1Y64B 3WI5A 3VOPA 1KD1Q 4NUUA 1HFAA 3L73E 2WWWA 3A5TA 1GFPA 1B7TA 1HUCA 3PUZF 4IDNA 3H1JJ 1ZV8A 4G63A 1GK4A 1IFMA 2AXCA 4KHPT 2ZT9C 3RLFF 2FYUD 1XNRT 2PJQA 2FJBA 3L70J 3L74D 3QK6A 2YKQA 1M62A 2W27A 2BG9E 1LGHB 2QVAA 1IFPA 3HL6A 3ONXA 5H2FH 3SWFA 2XV5A 4YY3T 3B13A 1S3JA 5JRCA 4NPEA 3C1LA 4DJGA 2IC9A 1FJPA 1QUUA 5FKYA 2ACXA 1VCSA 2LSKA 1HNZT 4QH4A 1PRNA 1S72P 3AE7C 5FY7A 4AYEC 4NXNT 2JMKA 2ZM8A 4JI0T 4WBOA 3POQA 3JAFA 4GYSA 3QC9A 5F3JA 5LBMA 1LTAC 3EUHA 4HB1A 5IUXA 1SQPJ 2CPSA 1SQBE 1PFIA 4PNIA 2WSEJ 3OJAA 2M6BA 5L8RJ 4PV1D 1DEEG 4K3BA 4H9PC 2QYWA 4MALA 4CN6A 2FGQX 2KZ7B 3II6A 3A0BH 2M8RA 4FZMA 3CX5I 2JIWA 4JFBA 1VDFA 3M9BA 1H7CA 3AAAA 1P84H 1G2CA 4O4HE 4YTPC 1H88A 3KXDA 2A45H 3GHGC 1TU3F 2O01J 2XUEA 4O3XB 4B61A 1KZUB 2KZJA 1ZHYA 1FMVA 5CHXA 2LFUA 2Y6XA 4O4JE 1EZVE 1KB9I 1PPJG 2QGSA 4OGQC 1K73Q 5HEHA 4ZS3A 2CA5A 2P1JA 2P7JA 3FGAD 5CMZA 2NPSB 4GF4A 4PFPA 3P32A 1W2BO 1SQVK 2KNDA 4N58A 2M3BA 3EHZA 3Q5WA 1YJWP 4O3YA 4ASKA 2N9DA 4ZI7E 1BCCD 4TV9E 2XQ3A 4U3CA 2RKLA 4DMWA 3H32A 4EZHA 2B87B 1D0XA 4U7IA 3L72D 2C5KT 1EDIA 3NMDA 1BGYJ 3B5NB 1HX8A 2XNXA 2R88A 4RJTA 3LBXB 1PGOA 5APXA 1JEKA 3PTRB 4PD4E 3I9WA 4X1YE 1SQVG 4EYUA 4OFZA 4IL6O 2O1KA 3R84B 1HTLC 5LHHB 4HEAA 3AE8C 1EQ7A 4FZLA 1L0LG 1L2PA 2K37A 1HJBA 1QEXA 1US7B 4XZCA 1WCRA 5AQQB 2XQ5A 3RL0B 2L8KA 4OWFA 1J2JB 2HODB 3BCCD 2R6GF 5KXJA 4XNLA 2Y0EA 1HF9A 5KTBA 2V5CA 3LSVA 1GFNA 1LRZA 3KV4A 2ZXXA 4FSOA 3T0SA 1NWMX 5AVVB 3D6YA 3IF4A 1FC2C 1KV4A 4EI2A 1FEWA 1WYCA 3RC8A 3POUA 4Y99C 5T5FA 4M3LA 3AEEA 4FUVA 3B4SA 4DV6T 2K3RA 4D6TG 4CN1A 1KFYA 3G9RA 2RMZA 3CQXC 5CCHA 2IBZI 3H1KE 1FZCA 3PF1A 2VASA 2XM1A 4EGWA 1LTSC 3L75J 4ANJA 1RE3C 1QJ8A 2L9QA 3ZLIA 1UCUA 2PGDA 3RK2C 5FVLA 1PP9D 2VWAA 4ISSA 3ZN1B 2G0UA 5DJTB 3WMM0 2HN2A 3KBTA 4F6RC 2IZ0A 1NGMB 4FESA 5LGTB 2VRSA 2JKVA 3ANWA 3RIUA 2JJ9A 1NOHA 3H1IE 2LSGA 2AEJA 2P9BA 3GHGB 5APYA 2OV9A 2H43A 2JQKA 1JMMA 2I0MA 3M0DA 4JI6T 1XMOT 1MM5A 5DL6A 4X1IE 3AEGA 1NKNA 1HF8A 4MFRA 3RKOA 4EV6A 4DR5T 4FRXA 1SA0E 1OPFA 3L36A 4OGQB 5CCHD 2XAQB 3Q5EA 3R6NA 3UU3A 3E08A 1NTKJ 3ZEFB 3NBXX 2XY8B 3I56P 3RRWA 3G7GA 3OA7A 1OW7A 1EZ3A 5H6RB 2HPJA 3SSUA 2F1VA 3PHLA 1MZ9A 2ZVNB 3TNUA 3D6ZA 2UXXB 2ODVA 3SYBA 1M1JA 2CK3H 4C00A 2WP9A 3CWBJ 5JREA 4AQFC 3N7NA 4H13D 1L0LD 1KFMA 2K4TA 5DL5A 3OTOT 3ZJ1A 2X0LB 3OBVE 3C4ZA 3O1HA 3H1LG 3OVUA 3K8PC 2WVPA 2XTLA 1EXJA 1HGVA 3L8RA 4XFJA 2IHR1 2PBIA 3PGSA 4UV8B 3AE2A 3CXHD 2GE4A 1IJDB 4OVNF 2E76D 4GIFA 4WZXA 3QUJA 4LGDE 1FOSF 2QM8A 1U4QA 2ZLDA 5LNKA 2V6YA 1S9KD 3P50A 5FP3A 1NTKD 3UU4A 2W66A 1N7SA 5LMNT 2BBJA 4OX9T 3P4PA 1FZEA 4JEUB 2NWBA 2K0LA 5KLVE 1JB0J 5JVDE 5HAXA 2YN6A 2ERVA 1AV1A 3P4SA 1ZKEA 3C9IA 2XASB 4UIGA 4UB6E 3A8YC 1OEDB 3S9OA 3CWBD 1I94T 5LA6E 2BKNA 3QB5K 1Q9GA 3L35A 4JI8T 5APQA 2B87A 2N1TC 4CTDA 5APSA 4KJMA 2GUVA 3Q5XA 4H44D 5H2FO 3B5NA 2LRLA 1N32T 1YTZI 1SQBJ 2WSEH 3Q5DA 2C0WA 2Q6QA 5AQJB 4RESB 3EABA 4AYID 2QEXP 2ZM2A 3CIRA 3RK3E 3TGUE 1WYBA 4ILAA 2KSJA 2E43A 2WBLA 4C7NA 1NU1E 4UB8H 3G4SP 1N36T 3RK2B 3AE6A 4QMAA 4WBNE 1N7SD 5HWYA 5LMUT 5EFWB 1FZGA 2A2FX 2O01H 3HD7B 4WY4B 5AW6B 3FZLB 3OYZA 1E7PA 1U7JA 2FYUE 4FT6A 2YKPA 3QRAA 4N3YB 3H3MA 4AUWA 1WRGA 3A0BO 1QSDA 2XKMA 2H89C 3O1IA 3BRTB 3BRZA 2QJPC 2M0BA 3VRAA 3NFQA 1N7LA 3B5ND 5FYMA 1DU2A 1USDA 2V7MA 4ASWA 1MFTA 1M7LA 2KB7P 2PP6A 3KQGA 2KMFA 4QKNA 1JOCA 1LT1A 3HA4A 5LJMA 2WT7A 4KI0F 3AECC 2ZMAA 2H7OA 2Z6EA 4H9SE 4CI1B 4LF7T 2WU2A 2R4NA 2FYNB 2WSCH 3AE1C 3DTOA 3UPGA 2OQQA 5E79E 1QVFO 1JNMA 4G75A 2DW3A 4OH8B 4L9IA 3POXA 1NTMD 3TF5A 1UK5A 3AA1B 3GN5A 3JCUH 5L3FB 3CQGB 1N8RQ 2ZT9D 1JM0A 2IW5B 3C4XA 2E42A 5L3EB 3DP7A 3CCEP 2K48A 2W80C 3H6PA 2Y0KA 3VY9X 2YXQB 4PJLA 4PJNA 2CBJA 2WZHA 4YTPA 3GHGA 3OYXA 3AA6B 3PP5A 1KQSO 1JY3P 5AW3B 1VQKP 4NIQA 3ZYMA 4LMJA 4AQRD 1D0ZA 5EZYE 1IBKT 2ODJA 4DMVA 3AE4C 1VQNP 5L4HA 4IL6X 1T16A 4QX8B 2XG6A 4DV0T 4BJNA 1UURA 2H88A 2JPFA 4TUYE 4LF5T 1VQ6P 2OTKE 2IYOA 1OXZA 3PUWF 1FDIA 4MLKA 1BCCE 2E75C 2ES0A 1GL2C 2QSIA 2MTQA 3F57A 4GCSA 3AEBC 1VF5B 2JQHA 3Q9DA 3H1KJ 4TN7B 3CPZA 3L4FA 2W6BA 1GFQA 1WT6A 2X9YA 4O4LE 2LXBA 2XHEB 1P4TA 2QE7H 1FIOA 3WU2E 3SWKA 3W15B 3V2PA 3KZIH 3FZFB 4UB6O 3ZPOA 3AEDC 3P7KA 4KUMB 4UXNB 2X68A 1BE3J 4ZS2A 4PW8A 1QJPA 3AE8A 4OGQD 5C8YE 4D65A 1VQ7P 1NVOA 3PUAA 1UUSA 4CPGA 5CA1E 1M56D 3T97A 1EXIA 1QX8A 2J4GA 4P0BA 4QXHB 2CLYC 3GMAA 2D2SA 4H0LC 1IFIA 2MNHA 3UUNA 3PLNA 1LT9B 4DT0A 3R4YA 1AQ5A 4ASVA 3BCCE 2KWIB 4NPPA 5FXVA 4N78D 5ABFB 3K3QC 1EC5A 2CWYA 4YJ2E 3UFEA 3EQ2A 1LJ2A 1N33T 2IBZG 5DQVA 2OA5A 3CX5D 2X9XA 3C50A 4M1PA 2IDOB 5JDPA 4U3FD 3H37A 3BRYA 1T72A 4LF4T 4IL9A 1D1BA 2UUAT 3JTYA 2YO3A 2Y8DA 4JUYA 2A72A 1S94A 5HCJA 3CCRP 2IDBA 4MN4C 4LFAT 1KB9D 1RE3A 4W80A 5CFBA 4QHOA 2KXPB 3GWHA 1PP9E 2YU2A 2GA1A 3HTKB 1I6ZA 1G1JA 3SZVA 1LNQA 1E1HB 2PG8A 3M91A 3P4RA 2G3AA 4Z8XA 4K3AA 1IJ5A 3S4UA 1HG2A 4KX6A 5ABGA 2JMHA 3BQIA 4EOTA 1SQXK 2QM7A 5E79O 1GD2E 1QGKB 1VOMA 3SWHA 3H1HG 3G3ZA 4RO0A 2LKGA 3EI0A 1WMKA 1WRDA 2WS3A 4A97A 1MKMA 2YDQA 3PU8A 1LP1B 1PIXA 2BCCJ 4ZNCA 4QXBB 2XM2A 3FX0A 3D71A 1NEKA 3T8OA 2WWUA 2CPBA 2K9JB 5AQPB 4FSPA 3HE4B 3P4WA 3RK2D 5C39A 3WAJA 3HE5A 2K3WA 5JH7E 1XMQT 1SQXG 1IAPA 2KUBA 1GL2B 2DWKA 2AE9A 4LLHA 5J2UE 3HD7D 4JI7T 5KKZB 4YTNA 5AQNB 4AQFA 4WY4D 3GG2A 2M5AB 5AW4B 2LOPA 2Z5IA 5G39A 5KDMC 3CWZB 3HKBE 2W8ZA 3TLUA 1Q2NA 4UR9A 4XAXB 2VKDA 1O3XA 5APTA 3WUTA 3AXJB 1MMNA 2OYIC 1HXXA 5CCGC 4C4VA 1GZLA 3V6IA 1LVFA 1SQQK 5DJUB 5HWXA 3CXHE 3AE9C 5KMGP 3WUUA 3U78A 3B57A 2CRBA 4PJ0E 5KAFH 1K8AQ 3N5LA 4ZI3C 3C64A 2NPSC 4U72A 3BS0A 3NSGA 2P58A 2FYUJ 2E5VA 2BCCD 3L74J 2NR4A 2W67A 5AVRB 2IBZD 1S9KE 2P10A 1NTKE 3H1JG 1IZNB 3AE5C 3DJBA 5EK3A 3A2AA 1KORA 1N2DC 1WLXA 3C4WA 1ORMA 4PUXA 3WU2O 5CA0E 1GU4A 3VP9A 1SLQA 3FBZA 5APUA 4ZZBA 3TZGA 3L70G 2W2UA 2GUSA 3V2RA 2EHOB 2HPLA 1SQQG 4HKAA 4UF0A 1G1IA 2A06D 2WDVA 4WNKA 1SQPK 1L4AB 3CWBE 4CN4A 1ZR2A 3VN0A 1YD8G 4I2LC 2N1TA 4OHFA 3O6QB 1S35A 5PRNA 2RPAA 4H63H 1KYOI 3TLWA 1VL2A 1NTZK 4PD4H 1J5WA 2FY8A 1DX7A 3PUQA 3LK2A 2J4UP 3RL0C 4RLCA 5AFUK 4AKRA 2YKOA 4CZZB 2IMLA 2PRRA 4AQGA 2XQ6A 1J5ET 3L71D 5JDMA 3QOFA 5AVUB 1SQPG 4IREA 2YU1A 4AUIA 2Q3IA 2KINB 2XQ4A 3F2EA 3VYIA 1FJKA 3CCMP 3F5HA 3RQUA 4N74A 5F5WA 3FZMB 3IHRA 1NJIQ 3P8MC 5IYUA 3U59A 1LWUC 2O1JA 3CX6B 3AA0A 3JCUO 2WWVA 3BQKA 3KVBA 1NAYA 2VVSA 1NTZG 4W7ZA 5ABFA 2I1KA 4WVZA 2BZBA 2V8SV 3OPCA 4PJJA 1CI6A 2H89A 3SS1A 5AFUL 1FJGT 4KRAA 2N1TD 5ADXK 2X66A 1KN7A 3J7Yq 2X67A 1YXRA 1FZAA 3LK3A 2B88A 5BVZA 1X79A 1PGQA 4DVDA 2WSFH 4QH5A 3NZQA 1H0TB 2D9DA 2BDEA 2XAFB 1BCCJ 3PQUA 2R44A 2KDYA 3AE3C 1QJ9A 2CMRA 2W6JH 2CE7A 4ZMDA 3AEFC 4DIDB 3L72J 2OTJP 1QVGO 1AVYA 3AE1A 4B3TT 3G06A 3ONJA 1SFCC 2ZYAA 3EDUA 1AA0A 2XDJA 5ADXL 3RGUA 1NTME 4YSYA 4I1LA 3PJSK 4HH2A 5AQHB 5AQSB 4CXXA 4LSIA 4LC1A 3TDKA 4KMCA 5DL8A 1BGYG 4BUMX 3RIFA 5KAFE 3FXDB 3MUDC 2LR2A 4IFMA 2OYIB 2YEVC 4TV8E 3HKDE 5M1BA 2ZYGA 1URQB 3PGUA 2YDRA 4XE5B 1L0ND 3A0HE 6PRNA 3KZIO 2HHHT 3BCCJ 3V8UA 2ZM6T 5GTIE 1NAFA 2E5YA 5FVKA 1YTZT 1P84I 4A5XA 3CCQP 4PK4A 4Q25A 4KR8A 4BAYB 1RF0C 1JY3O 3AE4A 3ZC0A 2BS2A 2XAJB 4L0RA 2OLTA 2IAKA 3AEAC 1KNRA 5JDFA 4UV9B 3PRNA 2BG9B 4YXWH 4ZKUA 1H8AA 3IFMA 1GQEA 4JLEA 3CC2P 1IBLT 3PQSA 2I1JA 3AA7B 1YHQP 2R4OA 1G8XA 3AEBA 5CJ4A 2NW7A 1KMIZ 4A98A 1LKXA 3AAEA 3SFEC 5LOVE 4U74A 3FWNA 3A7OA 4WBAA 3KVDD 4DV5T 2A3DA 3UTKA 2QG4A 1PP9J 4LSEA 1XZYA 3ZN0B 4E1TA 4GCPA 5AVQB 3N2KE 3E7KA 1ZW0A 5L3DB 3AEDA 2N2NA 3U1AA 3L75G 3V5SA 4I55E 5G26A 2OARA 4A7PA 4C46A 3VE1A 2BS4A 2PFVA 2UXDT 2M07A 4COFA 4PK5A 3OW2O 1JO5A 3Q2YA 1OEDC 1LWUB 3RX6A 4ERRA 1JUNA 2OTLP 2MOZA 2LOSA 3RBZA 2E75D 5KLIC 1GL2D 4N78E 2V7QJ 3MGNA 4AYNA 4UB6H 2YMYA 2WSSH 2BVMA 5AQOB 2VQET 4FZNA 5AQTB 2KWHA 2OYHB 2I6HA 3FWLA 5GTHE 1UGOA 1OIPA 4MBQA 3CX5E 1Y9BA 5HXHA 3VMAA 4B3RT 5L3CB 4U3FE 3EWKA 3GF3A 1HG5A 1CSBA 5IHYA 4BWNA 4GOUA 1ZRTD 5HEJA 1KQLA 2XAGB 4DV3T 1HTJF 2H7HA 2WMOA 1CUNA 3LK42 5IWAT 1HXTA 4YFSA 3V2NA 1L0LJ 1X9VA 1BDDA 3RRCA 3SY7A 2J1DG 3ABVC 3MTUE 4O3WA 4XNKA 3HD7C 1BE3E 1PPJD 2QIWA 1SFCB 1KB9E 5ABEA 2WDRA 1LVKA 4WY4C 3RKGA 1BT9A 1PHOA 2XE2A 2FJEA 4NUVA 4H0LD 4X1KE 3RYFE 5B5EH 5KX5E 4X20E 1JMBA 1Q9FA 1BDCA 3B5MA 2UUCT 4LSHA 1Z0PA 2K5BB 5K5GB 4E7SA 5CJ0A 1GW4A 3LG7A 4XA4A 2AEMA 2UXNB 2Q9QC 1RY3A 3VR9A 2UU9T 3UAQA 3L73G 1VQ4P 3ZMTB 3TYYA 4TWDA 3OAKA 1N73B 4JF7A 1X9BA 3FZHB 2C9LY 4EB6E 2NP9A 3SFDC 5JDQA 2XZEA 1THQA 2XE1A 2YNKA 1LTBC 4D6TJ 2VURA 3RL0g 3HKEE 4BA9A 2FYNC 3PUSA 1H6S1 1AVOA 1SQVD 1HCIA 5KAFO 1K05A 1SQBK 3UUBA 4YLHA 1YIJP 4F8HA 1JTHB 2IPPA 3HUSB 2KYVA 3K3NA 3IF8B 5E79H 2WPVB 2PAJA 5AQRB 2WJRA 3A0HO 2KZ7A 3J9X1 4TNWA 2ZM0A 2C5IT 2Q1KA 2HH7A 5GTIO 3Q3DA 2H7VC 1MFZA 1T6AA 3ZCIA 5C3JA 1GTWA 1LTJB 1HR0T 1T98A 3NKZA 4IE0A 1VQMP 3EVYA 4GYRA 3VY8X 5KAIE 4HN9A 2IX7C 3CL3D 3ZMUB 3MP7B 4IT4A 1SQBG 4LF9T 3VKHA 3RBXA 1MPFA 4IOIH 5CCGA 3TLVA 2IWVA 1D0YA 3AE9A 3GW6A 2XTQA 4Z1MH 1KFNA 1E2AA 4O4IE 3M9HA 4Z91A 5LG4A 2NPSA 2JP3A 4D6TD 2BCCE 3TK1A 2VKJA 2DWGA 2IBZE 3EDVA 1MNDA 3AE5A 3BVHA 1VF5C 2BEQD 3ZMVB 5G3AA 1OFCX 2HPCB 1W0BA 1YQ4C 3UU2A 5KLIB 1M90Q 4F4BA 3CQCB 1EZVG 2LXCB 4FQEA 2GK9A 3PJAJ 4UEMA 3CCUP 2X9HA 4IHJE 4DR7T 4AFKA 2A06E 1IK9A 3LBXA 2FBWC 1RF1C 3FHNA 4GK5E 4K0KT 4BXLA 1QL2A 3PJAA 2XSBA 2Y0DA 4ZZCA 2YOEA 1Q90D 4UELA 5AVYB 5CCGD 4U2YA 5KJ7C 2FFDB 5LYJE 3T24A 1VPCA 1LTGC 3WU2H 4JI5T 1NTMJ 2AXDS 3MA9A 5B5EE 1MIWA 1L0VA 4ZI3D 5AQGB 2NPSD 1AQTA 1PGJA 4PR7A 2N1GA 3CKDA 3EAMA 3JAEA 2K9YA 3L73D 5GTHO 4NPDA 1LT9C 3L71E 5JR9B 2HODA 4AQYT 5B66E 3L74E 1VQPP 2E9XB 1KNPA 2JR8A 3EFGA 2UWJE 3CCSP 2XMXA 4ADZA 4ZOLE 4HFHA 4IL4A 2E2AA 2LJLA 3G71P 2Q9QB 4DUZT 2FXMA 4AXPA 1FS0E 2MPKA 1KILC 3KV6A 2K1AA 2M6IA 1D7MA 5L3GB 4Y28J 4DOJA 1G90A 1ZHXA 3AE7A 3GLMA 4EYYQ 4GT1A 4G76A 3H1LD 3RPUA 3P7IA 2Q7CA 2Q3EA 4K0UA 5AW2B 4EOZB 1JY2N 3E1IA 2W62A 1UIXA 3IA3A 2R4PA 2CWOA 1OW6A 3M0AA 3V5BA 3VHLA 4ZHQE 3I9YA 3RL0D 4EZ4A 4L74A 3AE3A 2BKPA 2Y2XA 4JCHA 3UU8A 4WB4A 3AEFA 2DI4A 4AKIA 4KT0J 3CX7B 2YDSA 4JBZA 2E74B 4DR4T 3IBPA 1SFCA 2W00A 3ITKA 5CBOA 3CMAP 2MKVA 2KLQA 1X8YA 3QB5A 2OYOA 1N34T 3H1KG 4U2ZA 2BVLA 3DA4A 5JQGE 5L3BB 3W67A 2AEFA 5LB7B 2H8PD 1GFOA 3MXZA 2JQYA 2D2CB 3B8EB 3MUDA 4DR1T 1A02J 4JI3T 3A2SX 3WI3A 3RK3B 3VRBA 1T3UA 2A45G 2F1TA 2WZ7A 2NOXA 4TX5A 1LTTC 4O8SA 4PAGA 1L0NE 2B9BA 5LG3A 1HH0A 5AVXB 4C69X 4DZOA 1KYOD 3H1IG 4L75A 2V7QH 2BEZF 1V9DA 5E0OA 1ZHZA 5J1GA 2O01N 4DBQA 1RF0A 4UVCB 2KS1B 1VQ8P 2Y48B 5KKZC 1SFCD 2O3JA 4X64T 3L72E 3X1DA 4EAHA 4JYCA 1HNWT 5FY0A 3T1HT 3AVRA 4U3FJ 2UXCT 4BRYB 4GKKT 1RF1B 3S4RA 4L5GA 2D0TA 2NW9A 3K19A 3SFEA 2LM2A 2FXOA 3VZUX 3HR0A 1T8ZA 4N59A 2KNCB 5LCYA 3PE0A 1BSHA 1M57D 5AQUB 2H3RA 5LXTE 2UUBT 2RP4A 3UT5E 1RH5B 5FVNA 2YPVA 4GK0E 4HKZH 3FXEB 3CXHH 1YS5A 5AVSB 5FXXA 1QLBA 4PJMA 1Z56A 1PGPA 2ODUA 2JWDA 4PJ0H 4GCQA 2WMNA 3RH3A 3BK9A 4RL9A 1YQ3C 3ZDMA 2KLUA 1YITP 2PORA 2Y0HA 2LSYA 3ZJ2A 5KLVK 2B76A 2LT3A 1Q86Q 4PV1B 2EHOC 4IE6A 1R8IA 1IFJA 3GA8A 3P8CD 1OEDA 2I59A 1L4AC 5C2TA 5B5EO 2N9BA 4IDZA 1U5PA 3K3OA 4GOEA 3KBUA 2YNYA 2HPCA 1BSNA 1KILB 1WFDA 5JDGA 3TLTA 5JRCB 1XDPA 3WI4A 4XBFB 4LF8T 1HS7A 1ZN5A 2R32A 1UX5A 2LEHA 1FE6A 1W9RA 2XU6A 3M06A 2IC6A 3ZT7A 3HRNA 5EK2A 1FU1A 1MMDA 1X0TA 5KLVG 3H25A 3CMLA 2ITAA 4O2BE 1IC2A 4H9OC 1NU1K 3VTPC 3VZTX 2WSSV 3PU3A 3M65A 1ZRTE 4AIUA 4DNDA 2QJYB 4H9RC 4FOZA 2K9AA 3ZT6A 3T1YT 3E0ZA 3ABVA 3OJAB 1PPJE 3HD7A 1YKEB 3A3YB 1XNQT 1P84D 4IGUA 2PRNA 4WY4A 5JDNA 1PZQA 2FYUK 3CCJP 2XE5A 1S1CX 4ILBA 3H1ID 3TGUG 5AQMB 3AAAB 1G2CB 2CCQA 1NU1G 5F8PA 5FNVE 1ZEEA 4B3MT
chains in the Genus database with same CATH topology
3HKCE 3RYHE 5DL6A 1MM5A 4X1IE 3EDUA 1HF8A 4MFRA 3ETUA 4P09A 3RKOA 5ADXL 5HXSA 1SA0E 4AKHA 1OPFA 4FRXA 3KV5A 3SRZA 4RLBA 2XAQB 3UULA 1ZV4X 3R6NA 3VZWX 4CXXA 3E08A 4LSIA 4E1SA 3ZEFB 5DL7A 3NBXX 4KMCA 5DL8A 3RRWA 4BUMX 3G7GA 3FXDB 4DO0A 1EZ3A 4ILUA 2HPJA 5H6RB 2F1VA 4TV8E 2YEVC 3HKDE 1FMWA 2UXXB 4HFVA 3SYBA 2ODVA 2JQQA 1E54A 3AA1A 1MIVA 5JREA 1OSMA 3KV9A 4I43B 4AQFC 3LK41 5DJQC 2E9XD 6PRNA 2K4TA 3KDSE 3V8UA 1D1CA 1KNZA 5DL5A 3ZJ1A 2X0LB 3O0EA 1NAFA 3ZYKA 3OBVE 3C4ZA 3O1HA 3I0OA 2Y7SA 3K8PC 3F31A 2XTLA 4JEHB 4PK4A 3FBLA 3N9PA 4KR8A 4BAYB 3SZDA 2Q9QD 4G2AA 5GONE 2PBIA 4UV8B 3ZC0A 4CI3B 2GE4A 2XAJB 3AA6A 4L0RA 2J1NA 2IAKA 3PUGA 2LHNA 5JDFA 4UV9B 3PRNA 2ZLYA 3QUJA 2X51A 1U4QA 3NZPA 4JLEA 2ZLDA 3PQSA 4UF0B 1YKHB 3AA7B 5LNKA 3N9QA 1G8XA 3NRXA 5FP3A 2NW7A 3PORA 3GMIA 3AAEA 1LKXA 5LOVE 4U74A 3KVDD 4KR4A 3HOLA 2A3DA 2JRKA 3UTKA 1GFMA 2MHLA 4JEUB 2NWBA 2K0LA 2X27X 5JVDE 2V7KA 5FXWA 5HAXA 4LSEA 2ERVA 4D64A 3ZN0B 5JDLA 1ZKEA 2XASB 4UIGA 4RJWA 4E1TA 5DABA 4GCPA 3N2KE 5L3DB 1UX4A 5EE2A 4YHJA 2N2NA 3LK2B 5LA6E 3V5SA 2V7IA 4LSFA 5LHIB 1Q9GA 7PRNA 1IJ6A 4I55E 4AKRB 2KC0A 3SYSA 5G26A 3Q5XA 3MZKB 4CI2B 3ZYLA 2O4VA 1MNEA 3VE1A 4MHCA 2PFVA 2M07A 3L09A 1BR1A 2CXLA 4PK5A 5A1LA 4AYID 3RX6A 2ZM2A 2SPCA 4ERRA 2MOZA 2LOSA 2XE3A 1WYBA 2CM0A 3KINB 2WBLA 3AA0B 4FRTA 4AYNA 5LBQB 2BVMA 4WBNE 4FZNA 2KWHA 3HW9A 5HWYA 4TZ4C 4MBQA 2A2FX 2L3LA 4QX7B 3CX8B 5HXHA 3LK3B 4QWNB 1SHZC 4O2AE 2ZFGA 3IEEA 5L3CB 3OYZA 4H9NC 1HG5A 1BH3A 5GV0A 4AI6A 5IHYA 4FT6A 3ANWB 2VB6A 3QRAA 4GOUA 4D5UA 2N2MA 2LSIA 4WW0A 2XAGB 1HTJF 2WMOA 1QSDA 3N9MA 1CUNA 1MMAA 3LK42 1HXTA 4YFSA 3O1IA 3RRCA 3SY7A 3KVAA 2J1DG 2XAHB 4GIWA 4HGAA 1MM4A 4O3WA 2DNXA 3C98B 5JR9A 1LVKA 5FYMA 3I1AA 2V7MA 3WAKA 1BT9A 2DCFA 2E9XA 3ZMSB 1PHOA 2XE2A 4NUVA 4X1KE 3RYFE 3DA3A 5DQWA 5KX5E 4X20E 1Q9FA 2KMFA 4QKNA 4LSHA 1Z0PA 2K5BB 3HA4A 4E7SA 5LJMA 3LFMA 2Q9QA 2ZMAA 2RA1A 3LG7A 4OYKA 5L2LA 2H7OA 2Z6EA 4IE4A 4H9SE 2UXNB 2Q9QC 4CI1B 3N9OA 4AKMA 2KXPA 3DTOA 3UPGA 3PURA 3UAQA 4EXTA 3ESLA 4G75A 4L9IA 3ZMTB 3POXA 4H9QC 4UVAB 3AA1B 3GN5A 5L3FB 2DLRA 3CQGB 3U3IA 2VKOA 1BR2A 4CXWA 3VKGA 3O1JA 2LHRA 2IW5B 4EB6E 2NP9A 5JDQA 5ETWA 1THQA 3C4XA 2XE1A 4RJXA 3E22E 5L3EB 2YNKA 3DP7A 3SOLA 3HKEE 4BA9A 2K48A 3PUSA 3RYIE 1H6S1 2W80C 1HCIA 2Y0KA 1YW0A 3RYCE 3AVSA 2NW8A 3N9NA 4PJLA 4PJNA 3VY9X 4Z3TA 3JC6D 4YLHA 4IIJE 4OYJA 3OYXA 4I4TE 3T20A 3AA6B 2K24A 2V1DB 2D0UA 3K3NA 3OKQA 3IF8B 4A56A 2OMFA 2KZ7A 2CEAA 3J9X1 2ZM0A 2C5IT 2HH7A 3I0QA 3ZYMA 2H7VC 3ZCIA 1D0ZA 4AZLA 4AYMC 3C5OA 5EZYE 4I50E 2ODJA 2B1EA 2V26A 4DMVA 4J2CA 3D0TA 5TAOA 3AAEB 3VE2A 1T98A 3O9XA 2VKHA 4IE0A 4QX8B 4PK6A 2XG6A 2QA7A 3EVYA 3RBHA 8PRNA 2XTRA 4BJNA 2JPFA 3AB3B 1ZHCA 4GYRA 3VY8X 4HN9A 4TUYE 3ZMUB 4OK0A 3VKHA 1MPFA 3VZUX 3ETVA 1OXZA 4AKGA 2DHRA 4MLKA 1D0YA 2ES0A 2QTKA 2MTQA 3CVRA 3F57A 4GCSA 3Q9DA 2W0GA 4TN7B 2XTQA 3GP6A 4O4IE 4V1Av 5LG4A 3CPZA 1GFQA 2X9YA 4O4LE 3L3PA 5CB4E 4QXCB 2VKJA 2XHEB 1P4TA 1FIOA 2DWGA 3EDVA 4AKLA 1MNDA 2WM9A 5HXCA 2CLYB 4AYDC 3W15B 4B6XA 3ZMVB 5FXZA 2MBGA 3ZPOA 3UU2A 2MYSA 4KUMB 4UXNB 2X68A 3QRCA 4F4BA 3CQCB 4ZS2A 4PW8A 1QJPA 2GK9A 5C8YE 3ZMZB 4ZI2C 4DBRA 4UEMA 4D65A 3PUAA 2X9HA 4IHJE 4KP3C 4AFKA 5CA1E 3LBXA 3FHNA 4GK5E 1BR0A 4P0BA 3KFWX 4QXHB 1IZNA 2CLYC 2D2SA 5J2TE 1KK7A 1BR4A 3RC3A 2MNHA 3UUNA 4UELA 5EK4A 2LSJA 2JMMA 4GHBA 2M67A 1MMGA 2KWIB 5LYJE 3T24A 2W61A 2EHOA 5FXVA 2W81C 4N78D 3K3QC 3HOEA 4KBMB 3MA9A 5HYAA 3FB2A 5JDHA 2WAUA 1MIWA 2CWYA 3C51A 3N2GE 5FY1A 1Y64B 4YJ2E 3SY9A 3WI5A 4ZI3D 4NUUA 3UFEA 1HFAA 3UUMA 1GFPA 1B7TA 2N1GA 3CKDA 2YINA 5DQVA 2OA5A 2X9XA 3C50A 4G63A 3AAIA 4M1PA 5JR9B 2W63A 5JDPA 2E8IA 3H37A 2E9XB 1WR6A 2PJQA 3TKLB 3QK6A 4O49A 1D1BA 2XMXA 3JTYA 4ADZA 2Y8DA 2CXFA 4JUYA 2A72A 4ZOLE 3ZC1A 1S94A 2LJLA 2Q9QB 3HL6A 3ONXA 4AXPA 3JC6C 3B13A 5JRCA 5HXRA 5JR9C 4QHOA 1BXWA 2IC9A 2KXPB 2E9XC 3GWHA 3KV6A 2YU2A 5L3GB 1G90A 1QUUA 1ZHXA 3SZVA 2ACXA 1ZHTA 1E1HB 2LSKA 2PG8A 4Z8XA 1PRNA 4G76A 3GN5B 1IJ5A 3RPUA 3P7IA 1HG2A 3S4UA 4K0UA 2EHOD 5FY7A 4AYEC 2Y0LA 5M4YA 2JMHA 4EOZB 2V7LA 3BQIA 2JMKA 2W62A 2ZM8A 4WBOA 2CWOA 3POQA 2XQYA 4GYSA 4C91A 3VHLA 3QC9A 4ZHQE 5F3JA 3I9YA 5LBMA 3EUHA 4EZ4A 5LGUB 1VOMA 2Y2XA 4JCHA 4PNIA 3SWHA 5AFUK 3OJAA 2KT9A 2DI4A 4AKIA 3LJCA 3CX7B 3VU7H 1WRDA 4H9PC 4MALA 4UVBB 3IBPA 2W00A 5LGNB 4O4UA 3A5XA 2FGQX 2KZ7B 3PU8A 2YK0A 2KLQA 4FZMA 4JFBA 1AJ3A 4QXBB 1H7CA 4FJOA 3AAAA 3O4XE 2X9WA 2BVLA 2WWUA 4O4HE 3T8OA 3DA4A 2NTYA 5JQGE 5L3BB 4FSPA 3H3AA 4CQIA 1GFOA 3MXZA 2XUEA 4O3XB 4B61A 3WAJA 1ZHYA 4FI5A 5JH7E 3MJXA 1IAPA 1FMVA 2LFUA 3A2SX 2Y6XA 4O4JE 3WI3A 2DWKA 3UUXB 5J2UE 2QGSA 2F1TA 2NOXA 4TX5A 4ZS3A 4O8SA 4PAGA 2CA5A 5FMNA 4AQFA 4C69X 3EMNX 2LOPA 1VRBA 2FGRA 1ZHWA 5KDMC 3CWZB 3HKBE 1V9DA 1D1AA 4GF4A 4PFPA 2LM9A 4XAXB 2VKDA 1O3XA 2KNDA 5E0OA 5J1GA 4C90A 1ZHZA 4N58A 3Q5WA 4DBQA 4O3YA 3BQLA 4ASKA 1MMNA 2N9DA 4UVCB 1HXXA 4ZI7E 1LVFA 2Y48B 4TV9E 4U9CA 5HWXA 3MKDA 1HXUA 3HI2A 4DMWA 5KMGP 4EAHA 4EZHA 3U78A 5FY0A 3B57A 1D0XA 3AVRA 3N5LA 4ZI3C 4XNKA 3C64A 2VK9A 4U72A 3NSGA 2C5KT 1HX8A 5D5DA 5HXEA 4PUXA 3MK7C 1MIYA 3LBXB 4L5GA 2D0TA 4HTEA 4O3ZA 2LE8A 4ISTA 2NW9A 3K19A 3DJBA 1IZNB 3PTRB 5EK3A 1WLXA 5LP6E 3C4WA 3HR0A 4IE5A 1ORMA 3NRYA 3I9WA 5LCYA 4X1YE 5CA0E 4EYUA 4N59A 3PE0A 2D5UA 4OFZA 3R84B 3FBZA 2H3RA 5LXTE 4PFOA 3TZGA 2RP4A 3MACA 4HEAA 3UT5E 5LHHB 3HWBA 4FZLA 2EHOB 2HPLA 4HKAA 2YPVA 5FVNA 4GK0E 4UF0A 3AA7A 3FXEB 1US7B 1YS5A 5FXXA 4PJMA 4WNKA 3FYXA 4XZCA 2ODUA 4IE7A 4E7ZA 4GCQA 2N2LA 2WMNA 5LJNA 3RH3A 3BK9A 1YD8G 4RL9A 2PORA 2Y0HA 4BJMA 4OHFA 2L8KA 2LSYA 3ZJ2A 1S35A 1OWAA 5PRNA 5LHGB 2LT3A 2LHFA 4XNLA 2EHOC 4QQ1A 4H63H 4IE6A 4EYYR 3GA8A 2CXDA 3P8CD 2I59A 4P0AA 3PUQA 4IDZA 1U5PA 1GFNA 2VL8A 1LRZA 3K3OA 3LK2A 2M06A 3KV4A 3KBUA 2C5JA 4RLCA 4AKRA 4FSOA 4HE8A 4CZZB 4H63V 1NWMX 3ZCJA 5JDGA 4FMSA 3T0SA 4AQGA 5JRCB 3Q2MA 5JDMA 1FEWA 1WYCA 4XBFB 3RC8A 4CXYA 3POUA 3WI4A 2YU1A 5T5FA 4AUIA 2KINB 4YJ3E 4FUVA 3F2EA 1HS7A 2LEHA 1UX5A 2J4UP 3PDYA 3V5UA 2IC6A 3IHRA 3CQXC 5EK2A 1MMDA 5IYUA 2VASA 3CMLA 4O2BE 3CX6B 4H9OC 3AA0A 3BQKA 4O4XA 3VZTX 3KVBA 4ANJA 1QJ8A 2WSSV 2L9QA 3PU3A 1UCUA 3M65A 3ZLIA 4DNDA 1G73A 3N9LA 4H9RC 2VWAA 4ISSA 4PJJA 2BZBA 2K9AA 3SS1A 3ZN1B 5AFUL 4FOZA 2G0UA 4KRAA 5ADXK 2X66A 5BMVE 3E0ZA 3KBTA 4F6RC 3J7Yq 1YKEB 2X67A 4ZI2D 4FESA 4IGUA 5LGTB 2PRNA 3LK3A 5JDNA 1X79A 4EIWA 2C0SA 5IYZE 5H6QB 4DVDA 3ANWA 3NZQA 2NTXA 2JJ9A 3N2OA 2BDEA 2XAFB 2XE5A 3PQUA 2LSGA 2P9BA 2V7JA 2KDYA 1QJ9A 3AAAB 2CMRA 2CCQA 5F8PA 2CE7A 5FNVE 1ZEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ7 B;  3LK3 B;  3LK4 1;  3AAE A;  5AFU L;  3LK2 A;  5ADX L;  3AAA A;  3AA6 B;  5AFU K;  5ADX K;  4AKR A;  2KXP A;  3LK4 2;  1IZN A;  3AA7 A;  2KZ7 A;  3LK3 A;  3AA0 B;  3AA1 B;  3AA6 A;  3AAE B;  3LK2 B;  3AAA B;  4AKR B;  3AA0 A;  2KXP B;  3AA1 A;  3AA7 B;  1IZN B; 
#chains in the Genus database with same CATH topology
 1S5L H;  1T8B A;  3HKC E;  5CGM A;  1HWT C;  2WPS A;  3ETU A;  2R5D A;  4AKH A;  2ZYD A;  3KV5 A;  3I55 P;  3PRJ A;  3SRZ A;  4ZEY A;  2AXT E;  4RLB A;  4U33 A;  2KP8 A;  1ZV4 X;  2XQ9 A;  3BAS A;  5DL7 A;  3SFD A;  2FYU G;  4K35 A;  3KHU A;  4DO0 A;  1U7M A;  1SQV E;  5HCM A;  2WIT A;  2HLO A;  1HBW A;  1YBK A;  2R5B A;  1E54 A;  3AA1 A;  1L0L E;  1OSM A;  3CME P;  3LK4 1;  2B89 A;  2E9X D;  3H32 B;  4HWF A;  1D1C A;  4NPF X;  1VQL P;  3O0E A;  4EDF A;  2Y7S A;  4JEH B;  2E5T A;  3FBL A;  3N9P A;  1URQ C;  3CC4 P;  3SZD A;  2WPR A;  2Q9Q D;  5FL0 A;  2ZXE B;  4CI3 B;  3O8Z A;  3AA6 A;  3K5B A;  1YJN P;  4HFI A;  3PUG A;  3L71 J;  4DR2 T;  2KI7 B;  2X51 A;  3D70 A;  1YKH B;  3CI9 A;  3A0H H;  3POR A;  3GMI A;  2FKW B;  3PGR A;  5GTI H;  4L73 A;  2WB5 A;  4D6T E;  2JRK A;  3LDQ B;  2WTY A;  2BG9 C;  1SS1 A;  3VMX A;  2V7K A;  5FXW A;  4D64 A;  5AW8 B;  3RF1 A;  1OZH A;  1T2K C;  3I5C A;  1UX4 A;  1EZV I;  4GDO A;  4YHJ A;  4IL6 E;  2FYZ A;  3A7M A;  5LHI B;  1IJ6 A;  2BAS A;  3GF7 A;  4CI2 B;  2LKH A;  4JV5 T;  4YSZ A;  1ZOY C;  3BAT A;  2FBW A;  2FUP A;  1MNE A;  5AQL B;  4MHC A;  5L4E A;  3PUX F;  2WJQ A;  2SPC A;  1FZC B;  1EDL A;  2XE3 A;  5KJ7 A;  2CM0 A;  3KIN B;  1BCC G;  3H1H D;  1FZF A;  5TJH A;  1HJ0 A;  4FRT A;  1JCD A;  3VMZ A;  5LBQ B;  3HW9 A;  4DR6 T;  4TZ4 C;  2XQ8 A;  2L3L A;  3CX8 B;  1LT9 A;  2LKM A;  1S5L E;  4QWN B;  4O2A E;  2SPZ A;  1FOS E;  4H9N C;  1BH3 A;  4JQ0 D;  3NWI A;  4PD4 I;  4H13 B;  1VF5 D;  3ANW B;  1J1D B;  4I6M C;  4D5U A;  2LSI A;  2KSE A;  1CZQ A;  3PUY F;  1H89 A;  2OYH C;  1M8O B;  1MMA A;  1SQX D;  3UQ7 A;  1L0N J;  1SQQ J;  3ONL C;  1Y47 A;  3KVA A;  1JCC A;  4HGA A;  2JQ9 A;  4GKJ T;  2WQY C;  1KIL A;  4DUY T;  1SP4 A;  2WU5 A;  3ZMS B;  2R3C A;  1FDM A;  2KSR A;  5DQW A;  2YXR B;  2E76 B;  2DL1 A;  5GTH H;  1NO4 A;  3AEC A;  3H1L E;  5KJ7 D;  3CX5 H;  1DH3 A;  3BCC G;  3LFM A;  4DR3 T;  4OYK A;  4DV7 T;  4WYV A;  2P2U A;  4EEB A;  3N9O A;  4AKM A;  2KXP A;  1NHL A;  2VVN A;  3HTK A;  3ESL A;  4EXT A;  3TNU B;  1W2E A;  1M1J B;  3CCL P;  3FZK B;  4UVA B;  4X66 T;  3RIA A;  4HWD A;  4KHX A;  2DLR A;  3VKG A;  1KB9 H;  2VKO A;  2AXT O;  3O1J A;  5ETW A;  4RJX A;  2FXP A;  3CPW O;  3SOL A;  3IR9 A;  3H1J D;  5AW0 B;  3RYI E;  1YJ9 P;  2R89 A;  1ZME C;  2HN1 A;  1YW0 A;  3RYC E;  3AVS A;  4L76 A;  1RHZ B;  4WWI A;  1XTC C;  4K3C A;  3L70 D;  1N73 C;  1DIP A;  1KIL D;  1NTZ J;  4H44 B;  1SQQ D;  4OYJ A;  1IK7 A;  3T20 A;  2NZ2 A;  3M9Q A;  1IO4 A;  2K24 A;  2V1D B;  2D0U A;  2WZI A;  1PP9 G;  3JCF A;  4A56 A;  3V4W A;  3S1K A;  2PFX A;  1LP1 A;  1Q7Y Q;  2A45 I;  5AQF B;  1ZLL A;  4AZL A;  5AW1 B;  4YXD C;  2V6Y B;  2ZJS E;  2IIU A;  2K9J A;  3B71 A;  2CHO A;  3D0T A;  3HE4 A;  5TAO A;  3VE2 A;  2VKH A;  3RBH A;  8PRN A;  3HUS C;  1KYO E;  4PK6 A;  3UFG A;  3PV0 F;  2M3E A;  1N7S B;  3AB3 B;  4PJ0 O;  3USS A;  2H88 C;  3K1S A;  1GL2 A;  3ETV A;  3VR8 A;  2YO2 A;  1OW8 A;  4AKG A;  2DHR A;  3DZM A;  2IWW A;  4EIJ A;  1L0L K;  1LTJ C;  1OMI A;  1SQP D;  2KIK A;  2M5A A;  4I0U A;  2J58 A;  3GP6 A;  3L3P A;  3AXJ A;  3N4X A;  1NKZ B;  2WSC J;  4AKL A;  2WM9 A;  5HXC A;  1OVV A;  4B6X A;  1NTZ D;  2WY2 A;  2YIU C;  1ZP0 C;  3IAO A;  5KAI H;  5AVZ B;  2MYS A;  1NH4 A;  4C7N B;  4DBR A;  4KP3 C;  4HFE A;  2QJK C;  3KYQ A;  4ZXL A;  2V4H A;  5APW A;  1BR0 A;  1NTK K;  2XND H;  3KFW X;  1IZN A;  3W68 A;  2RN0 A;  5J2T E;  2R4L A;  1XTG B;  1KK7 A;  3RC3 A;  1YQ3 A;  2JMM A;  4GHB A;  2M67 A;  2W61 A;  5H2F E;  2EHO A;  2ZT9 B;  4KBM B;  4HYT B;  3FB2 A;  4TWH A;  3P8C E;  3Q5P A;  2WAU A;  5FY1 A;  4IFF A;  5JDH A;  4NXM T;  2JJL A;  1L4A A;  3SY9 A;  2MAW A;  5BU5 A;  3UUM A;  5FL1 A;  2YIN A;  4GOF A;  3AAI A;  3O6Q A;  2FFD C;  2W63 A;  2E5L T;  1SQV J;  2E8I A;  1VQO P;  1S5L O;  1W09 A;  1NTK G;  1WR6 A;  1BGY D;  3TKL B;  4O49 A;  3G6E P;  2I8D A;  2HFE D;  2CXF A;  3E1R A;  3ZC1 A;  2Z5H A;  2WT7 B;  2N9Y B;  3RGL A;  1HGZ A;  4JI4 T;  3JC6 C;  1RE4 C;  3DWO X;  5HXR A;  5JR9 C;  2BBH A;  5L47 A;  1BXW A;  2E9X C;  3CWB G;  4HFB A;  1NEN A;  3A0B E;  1ZHT A;  3GN5 B;  1P84 E;  2EHO D;  3QNU A;  2Y0L A;  5M4Y A;  5B66 H;  2WCA A;  2V7L A;  3V2Q A;  2BS3 A;  1OED E;  1L4A D;  1EDJ A;  2XQY A;  4C91 A;  1OVU A;  5BR8 T;  1KQG B;  3CD6 P;  3LIE A;  5LGU B;  2KT9 A;  2CPT A;  3LJC A;  3CK6 A;  3VU7 H;  3MZW B;  4GKG A;  1SE7 A;  4UVB B;  5LGN B;  4O4U A;  1X22 A;  3A5X A;  1USE A;  4B3S T;  1T3J A;  3ZST A;  1H0T A;  2YK0 A;  1AJ3 A;  1FAV A;  1JY2 P;  2ACZ A;  4FJO A;  3O4X E;  3Q5R A;  2X9W A;  2W90 A;  2NTY A;  4YPC A;  2XQ7 A;  4JI2 T;  3H3A A;  4CQI A;  1W0A A;  2E74 C;  4FI5 A;  3ZKR A;  2V5D A;  3MJX A;  3L75 D;  1NTM K;  1DD4 A;  3NVO A;  4DCK A;  3UUX B;  4LML A;  4HJG H;  1K04 A;  5FMN A;  2JO1 A;  3EMN X;  1VRB A;  4LFC T;  2FGR A;  2A9U A;  1ZHW A;  4U7Y A;  5AVT B;  2D2C C;  3FXD A;  1DEB A;  1ZXG A;  1D1A A;  3Q1M A;  4C90 A;  2LM9 A;  4JYA T;  1GU5 A;  2X0Y A;  2OYI A;  1PV3 A;  1KEY A;  2XQA A;  1GMJ A;  2XSA A;  3BQL A;  1URQ A;  1Q82 Q;  3RK3 C;  5CBN A;  2NRG A;  2W6A A;  4IDP A;  2YIU B;  1VQ5 P;  4U9C A;  3MKD A;  1HXU A;  1WR0 A;  3L73 J;  3HI2 A;  2GM4 A;  2C9N Y;  2KLV A;  1NTM G;  2VK9 A;  5D5D A;  2QJK B;  4X62 T;  3CC7 P;  5HXE A;  3SWY A;  3MK7 C;  1MIY A;  1U57 A;  3T97 B;  4HTE A;  4O3Z A;  2LE8 A;  4IST A;  5HEO A;  4DV1 T;  5LP6 E;  4IE5 A;  1M7K A;  3NRY A;  2D5U A;  4JYB A;  3IN6 A;  4PFO A;  2BG9 A;  3PH0 A;  3MAC A;  3HWB A;  3NJT A;  4AIS A;  2PTF A;  4N6J A;  1AFO A;  5AQV B;  3AA7 A;  3H1L J;  1J1J A;  3FYX A;  2KOG A;  3WUV A;  4IE7 A;  4E7Z A;  1OX3 A;  1CHU A;  2N2L A;  5LJN A;  2L5G B;  1URQ D;  3L37 A;  4BJM A;  4LF6 T;  1OWA A;  5LHG B;  3VMY A;  2LHF A;  2HR3 A;  4Y99 B;  4QQ1 A;  1ZOY A;  4EYY R;  2V6X A;  4LMK A;  2CXD A;  3NXS A;  2LRK A;  4P0A A;  1GDT A;  3JSV C;  2VL8 A;  2M06 A;  2K88 A;  2C5J A;  3CCV P;  4HE8 A;  4H63 V;  4FMS A;  3ZCJ A;  2MJZ A;  3H1H E;  4QH1 A;  1S2E A;  3Q2M A;  1QL1 A;  3M3Z B;  4CXY A;  4EED A;  4PV1 C;  1FBM A;  4YJ3 E;  4TT3 H;  3LW5 J;  3PDY A;  3V5U A;  1LWU A;  3UIA A;  5G38 A;  4LFB T;  1CW5 A;  1IFD A;  4O4X A;  1T2K D;  1G73 A;  3N9L A;  5ABH A;  2OYH A;  1SQX E;  2BKO A;  3QH9 A;  5BMV E;  5TIS H;  2HYN A;  3RQW A;  4ZI2 D;  2WQY A;  2JWA A;  2XPK A;  1KF6 A;  4EIW A;  2C0S A;  5IYZ E;  5H6Q B;  2POH A;  2NTX A;  3NTN A;  3N2O A;  2QJY C;  2V7J A;  1E5W A;  2F4V T;  1SQB D;  4YTM A;  5AQK B;  1KTM A;  3RYH E;  4GOD A;  4YT0 A;  4TNV A;  4YSX A;  3HE5 B;  4P09 A;  5HXS A;  2ZFC A;  2YKS A;  1J1E C;  3UUL A;  2WDQ A;  1R5L A;  1NYH A;  2Y0C A;  3VZW X;  4E1S A;  4U3F G;  2JDI H;  1S4X A;  3H1J E;  1E79 H;  4ILU A;  3RI5 A;  1A02 F;  1FMW A;  1Z8U A;  4HFV A;  1OVR A;  3MD0 A;  1EZV D;  2JQQ A;  3L70 E;  1N73 A;  4C4V B;  1BE3 G;  1KIL E;  1N86 A;  1SQQ E;  3TLS A;  2F1C X;  1MIV A;  4P1N A;  3KV9 A;  1VQ9 P;  4I43 B;  5DJQ C;  2IYP A;  3KDS E;  4U31 A;  1KNZ A;  1GW3 A;  3ZYK A;  4O9B A;  5KAI O;  3I0O A;  2AXT H;  1RQV A;  2IZ1 A;  3F31 A;  3C8V A;  4YXD A;  1KC8 Q;  4G2A A;  3P4Q A;  5GON E;  2Q5U A;  3AEA A;  4HWC A;  1JTH A;  3HUS A;  2R8A A;  2J1N A;  4TLF A;  2LHN A;  3CLQ A;  2ZLY A;  4DV4 T;  2W83 C;  3NZP A;  1M1K Q;  3QWO C;  4UF0 B;  4X65 T;  3UU6 A;  2WSF J;  3N9Q A;  2XZR A;  3NRX A;  1SQP E;  1LTJ A;  4HFC A;  1SUM B;  2KK7 A;  4PD4 D;  2CBI A;  4KR4 A;  3HOL A;  2N1T B;  1GFM A;  4I7Z C;  1AJY A;  2MHL A;  2X27 X;  2Q9I A;  3UQ4 A;  4UB8 E;  2JEE A;  4IDQ A;  1KQF B;  5JDL A;  3BRV B;  4RJW A;  5DAB A;  1NTZ E;  2LLY A;  2QRX A;  2FJD A;  5EE2 A;  1ZP0 A;  3LK2 B;  4LSF A;  2V7I A;  2FJA A;  7PRN A;  4AKR B;  2KC0 A;  3SYS A;  1S5L X;  3MZK B;  3H1I J;  3ZYL A;  2O4V A;  2W4X A;  3V4Q A;  3L09 A;  1BR1 A;  2L91 A;  3KDP B;  1NWQ A;  2CXL A;  5AW5 B;  3F89 A;  2XJ7 A;  3RHW A;  5A1L A;  5TIS E;  1Q81 Q;  3AA0 B;  3CXH I;  4HFD A;  1DD3 A;  2WVR A;  4HWH A;  5AW7 B;  5HEU A;  5B66 O;  1Y8A A;  3AEE C;  1EDK A;  4C7R A;  1CI6 B;  4IL6 H;  2Y9Y A;  2J62 A;  2QJP B;  2BCC G;  4QX7 B;  5CCH C;  1FZC C;  1GK6 A;  3H1K D;  5AQI B;  3LK3 B;  2FFD A;  2ZFG A;  1X79 B;  1SHZ C;  3IEE A;  5GV0 A;  1W5C E;  4AI6 A;  1BGY E;  2VB6 A;  2N2M A;  1HVV A;  4WW0 A;  3ZT5 A;  3N9M A;  1MM4 A;  4GIW A;  2XAH B;  1MV8 A;  4DV2 T;  3JCU E;  3KPE A;  1RE4 A;  2J5U A;  2DNX A;  3C98 B;  2OGU A;  2A06 G;  5JR9 A;  4RKU J;  3I1A A;  3WAK A;  1IFN A;  1BE3 D;  3DWN A;  2DCF A;  2E9X A;  1QLE D;  4H13 C;  3DA3 A;  1J1D C;  1J1E B;  2YMK A;  3RIU C;  3VP8 A;  1ZR4 A;  2UXB T;  2QA4 P;  1Y01 A;  4KHZ F;  2Q9Q A;  2RA1 A;  5L2L A;  1MUU A;  4IE4 A;  2Y9Z A;  3L39 A;  3M0D C;  3MIW A;  3TSI A;  5J0Z A;  3PUR A;  3AEG C;  3JC2 2;  2IFN A;  2E76 C;  3PUV F;  2KZI A;  1R5S A;  2IFM A;  2WMM A;  4H9Q C;  5AVW B;  1JY3 N;  5JTG A;  3L71 G;  3U3I A;  1K9M Q;  1BR2 A;  4CXW A;  2LHR A;  3L74 G;  2ZVO B;  3E22 E;  4W7Y A;  3UU5 A;  2VL0 A;  5KLV J;  3N9N A;  2NW8 A;  4Z3T A;  4JPZ B;  3JC6 D;  1M1J C;  1JNR A;  2X9K A;  5CJ5 A;  1XWM A;  4IIJ E;  4I4T E;  4JBW F;  1JY2 O;  1FDO A;  3OKQ A;  1HNX T;  2OMF A;  2CEA A;  3L75 E;  1YI2 P;  4IFD K;  3I0Q A;  3ZSS A;  2E75 B;  4ILC A;  4JI1 T;  3C5O A;  4AYM C;  2CHN A;  4I50 E;  2B1E A;  2V26 A;  2RH0 A;  4R4M A;  4J2C A;  4H44 C;  3AAE B;  3O9X A;  3AE2 C;  4YHH T;  2QA7 A;  3KZI E;  4I7Z B;  1LTI C;  4U7J A;  2XTR A;  3H1H J;  3TGU J;  3JAD A;  1ZHC A;  1NU1 J;  3EFF K;  4IDO A;  4ZKP A;  4OK0 A;  3LW5 H;  1JNZ A;  2QTK A;  3CVR A;  1RQU A;  1L0N K;  2J47 A;  2W0G A;  3LID A;  3U1C A;  4V1A v;  1N7S C;  1SVF A;  2P67 A;  5CB4 E;  4QXC B;  4B86 A;  2X0H A;  2R3S A;  1XDO A;  5KLV D;  2KS1 A;  1SQX J;  2HG5 D;  5HEG A;  4UB8 O;  2E74 D;  1T7S A;  1YQ4 A;  2CLY B;  1KYO H;  1YYC A;  1IBM T;  2C0X A;  4H0L B;  4AYD C;  5FXZ A;  1FZB A;  4X5T A;  2MBG A;  2Z4E A;  4TWF A;  3QRC A;  4R4L A;  3MHV A;  3PTZ A;  2J59 M;  3ZMZ B;  4BRY A;  4ZI2 C;  3R2P A;  1RF1 A;  3B5N C;  1L0N G;  2D2C D;  1UII A;  2ZAE B;  4N75 A;  2KNC A;  1BR4 A;  2G8Y A;  5EK4 A;  4Z90 A;  2IUB A;  5AW9 B;  5APV A;  2LSJ A;  3RK3 D;  1PL5 A;  3TGU D;  1MMG A;  5TIS O;  2VQF T;  1NU1 D;  5BU8 B;  2W81 C;  2WPQ A;  1R8E A;  3HOE A;  4HWI B;  3AE6 C;  3FXE A;  1VCT A;  5HYA A;  1HX1 B;  3L72 G;  3Q5S A;  3C51 A;  3N2G E;  1T1L A;  4AYC A;  1Y64 B;  3WI5 A;  3VOP A;  1KD1 Q;  4NUU A;  1HFA A;  3L73 E;  2WWW A;  3A5T A;  1GFP A;  1B7T A;  1HUC A;  3PUZ F;  4IDN A;  3H1J J;  1ZV8 A;  4G63 A;  1GK4 A;  1IFM A;  2AXC A;  4KHP T;  2ZT9 C;  3RLF F;  2FYU D;  1XNR T;  2PJQ A;  2FJB A;  3L70 J;  3L74 D;  3QK6 A;  2YKQ A;  1M62 A;  2W27 A;  2BG9 E;  1LGH B;  2QVA A;  1IFP A;  3HL6 A;  3ONX A;  5H2F H;  3SWF A;  2XV5 A;  4YY3 T;  3B13 A;  1S3J A;  5JRC A;  4NPE A;  3C1L A;  4DJG A;  2IC9 A;  1FJP A;  1QUU A;  5FKY A;  2ACX A;  1VCS A;  2LSK A;  1HNZ T;  4QH4 A;  1PRN A;  1S72 P;  3AE7 C;  5FY7 A;  4AYE C;  4NXN T;  2JMK A;  2ZM8 A;  4JI0 T;  4WBO A;  3POQ A;  3JAF A;  4GYS A;  3QC9 A;  5F3J A;  5LBM A;  1LTA C;  3EUH A;  4HB1 A;  5IUX A;  1SQP J;  2CPS A;  1SQB E;  1PFI A;  4PNI A;  2WSE J;  3OJA A;  2M6B A;  5L8R J;  4PV1 D;  1DEE G;  4K3B A;  4H9P C;  2QYW A;  4MAL A;  4CN6 A;  2FGQ X;  2KZ7 B;  3II6 A;  3A0B H;  2M8R A;  4FZM A;  3CX5 I;  2JIW A;  4JFB A;  1VDF A;  3M9B A;  1H7C A;  3AAA A;  1P84 H;  1G2C A;  4O4H E;  4YTP C;  1H88 A;  3KXD A;  2A45 H;  3GHG C;  1TU3 F;  2O01 J;  2XUE A;  4O3X B;  4B61 A;  1KZU B;  2KZJ A;  1ZHY A;  1FMV A;  5CHX A;  2LFU A;  2Y6X A;  4O4J E;  1EZV E;  1KB9 I;  1PPJ G;  2QGS A;  4OGQ C;  1K73 Q;  5HEH A;  4ZS3 A;  2CA5 A;  2P1J A;  2P7J A;  3FGA D;  5CMZ A;  2NPS B;  4GF4 A;  4PFP A;  3P32 A;  1W2B O;  1SQV K;  2KND A;  4N58 A;  2M3B A;  3EHZ A;  3Q5W A;  1YJW P;  4O3Y A;  4ASK A;  2N9D A;  4ZI7 E;  1BCC D;  4TV9 E;  2XQ3 A;  4U3C A;  2RKL A;  4DMW A;  3H32 A;  4EZH A;  2B87 B;  1D0X A;  4U7I A;  3L72 D;  2C5K T;  1EDI A;  3NMD A;  1BGY J;  3B5N B;  1HX8 A;  2XNX A;  2R88 A;  4RJT A;  3LBX B;  1PGO A;  5APX A;  1JEK A;  3PTR B;  4PD4 E;  3I9W A;  4X1Y E;  1SQV G;  4EYU A;  4OFZ A;  4IL6 O;  2O1K A;  3R84 B;  1HTL C;  5LHH B;  4HEA A;  3AE8 C;  1EQ7 A;  4FZL A;  1L0L G;  1L2P A;  2K37 A;  1HJB A;  1QEX A;  1US7 B;  4XZC A;  1WCR A;  5AQQ B;  2XQ5 A;  3RL0 B;  2L8K A;  4OWF A;  1J2J B;  2HOD B;  3BCC D;  2R6G F;  5KXJ A;  4XNL A;  2Y0E A;  1HF9 A;  5KTB A;  2V5C A;  3LSV A;  1GFN A;  1LRZ A;  3KV4 A;  2ZXX A;  4FSO A;  3T0S A;  1NWM X;  5AVV B;  3D6Y A;  3IF4 A;  1FC2 C;  1KV4 A;  4EI2 A;  1FEW A;  1WYC A;  3RC8 A;  3POU A;  4Y99 C;  5T5F A;  4M3L A;  3AEE A;  4FUV A;  3B4S A;  4DV6 T;  2K3R A;  4D6T G;  4CN1 A;  1KFY A;  3G9R A;  2RMZ A;  3CQX C;  5CCH A;  2IBZ I;  3H1K E;  1FZC A;  3PF1 A;  2VAS A;  2XM1 A;  4EGW A;  1LTS C;  3L75 J;  4ANJ A;  1RE3 C;  1QJ8 A;  2L9Q A;  3ZLI A;  1UCU A;  2PGD A;  3RK2 C;  5FVL A;  1PP9 D;  2VWA A;  4ISS A;  3ZN1 B;  2G0U A;  5DJT B;  3WMM 0;  2HN2 A;  3KBT A;  4F6R C;  2IZ0 A;  1NGM B;  4FES A;  5LGT B;  2VRS A;  2JKV A;  3ANW A;  3RIU A;  2JJ9 A;  1NOH A;  3H1I E;  2LSG A;  2AEJ A;  2P9B A;  3GHG B;  5APY A;  2OV9 A;  2H43 A;  2JQK A;  1JMM A;  2I0M A;  3M0D A;  4JI6 T;  1XMO T;  1MM5 A;  5DL6 A;  4X1I E;  3AEG A;  1NKN A;  1HF8 A;  4MFR A;  3RKO A;  4EV6 A;  4DR5 T;  4FRX A;  1SA0 E;  1OPF A;  3L36 A;  4OGQ B;  5CCH D;  2XAQ B;  3Q5E A;  3R6N A;  3UU3 A;  3E08 A;  1NTK J;  3ZEF B;  3NBX X;  2XY8 B;  3I56 P;  3RRW A;  3G7G A;  3OA7 A;  1OW7 A;  1EZ3 A;  5H6R B;  2HPJ A;  3SSU A;  2F1V A;  3PHL A;  1MZ9 A;  2ZVN B;  3TNU A;  3D6Z A;  2UXX B;  2ODV A;  3SYB A;  1M1J A;  2CK3 H;  4C00 A;  2WP9 A;  3CWB J;  5JRE A;  4AQF C;  3N7N A;  4H13 D;  1L0L D;  1KFM A;  2K4T A;  5DL5 A;  3OTO T;  3ZJ1 A;  2X0L B;  3OBV E;  3C4Z A;  3O1H A;  3H1L G;  3OVU A;  3K8P C;  2WVP A;  2XTL A;  1EXJ A;  1HGV A;  3L8R A;  4XFJ A;  2IHR 1;  2PBI A;  3PGS A;  4UV8 B;  3AE2 A;  3CXH D;  2GE4 A;  1IJD B;  4OVN F;  2E76 D;  4GIF A;  4WZX A;  3QUJ A;  4LGD E;  1FOS F;  2QM8 A;  1U4Q A;  2ZLD A;  5LNK A;  2V6Y A;  1S9K D;  3P50 A;  5FP3 A;  1NTK D;  3UU4 A;  2W66 A;  1N7S A;  5LMN T;  2BBJ A;  4OX9 T;  3P4P A;  1FZE A;  4JEU B;  2NWB A;  2K0L A;  5KLV E;  1JB0 J;  5JVD E;  5HAX A;  2YN6 A;  2ERV A;  1AV1 A;  3P4S A;  1ZKE A;  3C9I A;  2XAS B;  4UIG A;  4UB6 E;  3A8Y C;  1OED B;  3S9O A;  3CWB D;  1I94 T;  5LA6 E;  2BKN A;  3QB5 K;  1Q9G A;  3L35 A;  4JI8 T;  5APQ A;  2B87 A;  2N1T C;  4CTD A;  5APS A;  4KJM A;  2GUV A;  3Q5X A;  4H44 D;  5H2F O;  3B5N A;  2LRL A;  1N32 T;  1YTZ I;  1SQB J;  2WSE H;  3Q5D A;  2C0W A;  2Q6Q A;  5AQJ B;  4RES B;  3EAB A;  4AYI D;  2QEX P;  2ZM2 A;  3CIR A;  3RK3 E;  3TGU E;  1WYB A;  4ILA A;  2KSJ A;  2E43 A;  2WBL A;  4C7N A;  1NU1 E;  4UB8 H;  3G4S P;  1N36 T;  3RK2 B;  3AE6 A;  4QMA A;  4WBN E;  1N7S D;  5HWY A;  5LMU T;  5EFW B;  1FZG A;  2A2F X;  2O01 H;  3HD7 B;  4WY4 B;  5AW6 B;  3FZL B;  3OYZ A;  1E7P A;  1U7J A;  2FYU E;  4FT6 A;  2YKP A;  3QRA A;  4N3Y B;  3H3M A;  4AUW A;  1WRG A;  3A0B O;  1QSD A;  2XKM A;  2H89 C;  3O1I A;  3BRT B;  3BRZ A;  2QJP C;  2M0B A;  3VRA A;  3NFQ A;  1N7L A;  3B5N D;  5FYM A;  1DU2 A;  1USD A;  2V7M A;  4ASW A;  1MFT A;  1M7L A;  2KB7 P;  2PP6 A;  3KQG A;  2KMF A;  4QKN A;  1JOC A;  1LT1 A;  3HA4 A;  5LJM A;  2WT7 A;  4KI0 F;  3AEC C;  2ZMA A;  2H7O A;  2Z6E A;  4H9S E;  4CI1 B;  4LF7 T;  2WU2 A;  2R4N A;  2FYN B;  2WSC H;  3AE1 C;  3DTO A;  3UPG A;  2OQQ A;  5E79 E;  1QVF O;  1JNM A;  4G75 A;  2DW3 A;  4OH8 B;  4L9I A;  3POX A;  1NTM D;  3TF5 A;  1UK5 A;  3AA1 B;  3GN5 A;  3JCU H;  5L3F B;  3CQG B;  1N8R Q;  2ZT9 D;  1JM0 A;  2IW5 B;  3C4X A;  2E42 A;  5L3E B;  3DP7 A;  3CCE P;  2K48 A;  2W80 C;  3H6P A;  2Y0K A;  3VY9 X;  2YXQ B;  4PJL A;  4PJN A;  2CBJ A;  2WZH A;  4YTP A;  3GHG A;  3OYX A;  3AA6 B;  3PP5 A;  1KQS O;  1JY3 P;  5AW3 B;  1VQK P;  4NIQ A;  3ZYM A;  4LMJ A;  4AQR D;  1D0Z A;  5EZY E;  1IBK T;  2ODJ A;  4DMV A;  3AE4 C;  1VQN P;  5L4H A;  4IL6 X;  1T16 A;  4QX8 B;  2XG6 A;  4DV0 T;  4BJN A;  1UUR A;  2H88 A;  2JPF A;  4TUY E;  4LF5 T;  1VQ6 P;  2OTK E;  2IYO A;  1OXZ A;  3PUW F;  1FDI A;  4MLK A;  1BCC E;  2E75 C;  2ES0 A;  1GL2 C;  2QSI A;  2MTQ A;  3F57 A;  4GCS A;  3AEB C;  1VF5 B;  2JQH A;  3Q9D A;  3H1K J;  4TN7 B;  3CPZ A;  3L4F A;  2W6B A;  1GFQ A;  1WT6 A;  2X9Y A;  4O4L E;  2LXB A;  2XHE B;  1P4T A;  2QE7 H;  1FIO A;  3WU2 E;  3SWK A;  3W15 B;  3V2P A;  3KZI H;  3FZF B;  4UB6 O;  3ZPO A;  3AED C;  3P7K A;  4KUM B;  4UXN B;  2X68 A;  1BE3 J;  4ZS2 A;  4PW8 A;  1QJP A;  3AE8 A;  4OGQ D;  5C8Y E;  4D65 A;  1VQ7 P;  1NVO A;  3PUA A;  1UUS A;  4CPG A;  5CA1 E;  1M56 D;  3T97 A;  1EXI A;  1QX8 A;  2J4G A;  4P0B A;  4QXH B;  2CLY C;  3GMA A;  2D2S A;  4H0L C;  1IFI A;  2MNH A;  3UUN A;  3PLN A;  1LT9 B;  4DT0 A;  3R4Y A;  1AQ5 A;  4ASV A;  3BCC E;  2KWI B;  4NPP A;  5FXV A;  4N78 D;  5ABF B;  3K3Q C;  1EC5 A;  2CWY A;  4YJ2 E;  3UFE A;  3EQ2 A;  1LJ2 A;  1N33 T;  2IBZ G;  5DQV A;  2OA5 A;  3CX5 D;  2X9X A;  3C50 A;  4M1P A;  2IDO B;  5JDP A;  4U3F D;  3H37 A;  3BRY A;  1T72 A;  4LF4 T;  4IL9 A;  1D1B A;  2UUA T;  3JTY A;  2YO3 A;  2Y8D A;  4JUY A;  2A72 A;  1S94 A;  5HCJ A;  3CCR P;  2IDB A;  4MN4 C;  4LFA T;  1KB9 D;  1RE3 A;  4W80 A;  5CFB A;  4QHO A;  2KXP B;  3GWH A;  1PP9 E;  2YU2 A;  2GA1 A;  3HTK B;  1I6Z A;  1G1J A;  3SZV A;  1LNQ A;  1E1H B;  2PG8 A;  3M91 A;  3P4R A;  2G3A A;  4Z8X A;  4K3A A;  1IJ5 A;  3S4U A;  1HG2 A;  4KX6 A;  5ABG A;  2JMH A;  3BQI A;  4EOT A;  1SQX K;  2QM7 A;  5E79 O;  1GD2 E;  1QGK B;  1VOM A;  3SWH A;  3H1H G;  3G3Z A;  4RO0 A;  2LKG A;  3EI0 A;  1WMK A;  1WRD A;  2WS3 A;  4A97 A;  1MKM A;  2YDQ A;  3PU8 A;  1LP1 B;  1PIX A;  2BCC J;  4ZNC A;  4QXB B;  2XM2 A;  3FX0 A;  3D71 A;  1NEK A;  3T8O A;  2WWU A;  2CPB A;  2K9J B;  5AQP B;  4FSP A;  3HE4 B;  3P4W A;  3RK2 D;  5C39 A;  3WAJ A;  3HE5 A;  2K3W A;  5JH7 E;  1XMQ T;  1SQX G;  1IAP A;  2KUB A;  1GL2 B;  2DWK A;  2AE9 A;  4LLH A;  5J2U E;  3HD7 D;  4JI7 T;  5KKZ B;  4YTN A;  5AQN B;  4AQF A;  4WY4 D;  3GG2 A;  2M5A B;  5AW4 B;  2LOP A;  2Z5I A;  5G39 A;  5KDM C;  3CWZ B;  3HKB E;  2W8Z A;  3TLU A;  1Q2N A;  4UR9 A;  4XAX B;  2VKD A;  1O3X A;  5APT A;  3WUT A;  3AXJ B;  1MMN A;  2OYI C;  1HXX A;  5CCG C;  4C4V A;  1GZL A;  3V6I A;  1LVF A;  1SQQ K;  5DJU B;  5HWX A;  3CXH E;  3AE9 C;  5KMG P;  3WUU A;  3U78 A;  3B57 A;  2CRB A;  4PJ0 E;  5KAF H;  1K8A Q;  3N5L A;  4ZI3 C;  3C64 A;  2NPS C;  4U72 A;  3BS0 A;  3NSG A;  2P58 A;  2FYU J;  2E5V A;  2BCC D;  3L74 J;  2NR4 A;  2W67 A;  5AVR B;  2IBZ D;  1S9K E;  2P10 A;  1NTK E;  3H1J G;  1IZN B;  3AE5 C;  3DJB A;  5EK3 A;  3A2A A;  1KOR A;  1N2D C;  1WLX A;  3C4W A;  1ORM A;  4PUX A;  3WU2 O;  5CA0 E;  1GU4 A;  3VP9 A;  1SLQ A;  3FBZ A;  5APU A;  4ZZB A;  3TZG A;  3L70 G;  2W2U A;  2GUS A;  3V2R A;  2EHO B;  2HPL A;  1SQQ G;  4HKA A;  4UF0 A;  1G1I A;  2A06 D;  2WDV A;  4WNK A;  1SQP K;  1L4A B;  3CWB E;  4CN4 A;  1ZR2 A;  3VN0 A;  1YD8 G;  4I2L C;  2N1T A;  4OHF A;  3O6Q B;  1S35 A;  5PRN A;  2RPA A;  4H63 H;  1KYO I;  3TLW A;  1VL2 A;  1NTZ K;  4PD4 H;  1J5W A;  2FY8 A;  1DX7 A;  3PUQ A;  3LK2 A;  2J4U P;  3RL0 C;  4RLC A;  5AFU K;  4AKR A;  2YKO A;  4CZZ B;  2IML A;  2PRR A;  4AQG A;  2XQ6 A;  1J5E T;  3L71 D;  5JDM A;  3QOF A;  5AVU B;  1SQP G;  4IRE A;  2YU1 A;  4AUI A;  2Q3I A;  2KIN B;  2XQ4 A;  3F2E A;  3VYI A;  1FJK A;  3CCM P;  3F5H A;  3RQU A;  4N74 A;  5F5W A;  3FZM B;  3IHR A;  1NJI Q;  3P8M C;  5IYU A;  3U59 A;  1LWU C;  2O1J A;  3CX6 B;  3AA0 A;  3JCU O;  2WWV A;  3BQK A;  3KVB A;  1NAY A;  2VVS A;  1NTZ G;  4W7Z A;  5ABF A;  2I1K A;  4WVZ A;  2BZB A;  2V8S V;  3OPC A;  4PJJ A;  1CI6 A;  2H89 A;  3SS1 A;  5AFU L;  1FJG T;  4KRA A;  2N1T D;  5ADX K;  2X66 A;  1KN7 A;  3J7Y q;  2X67 A;  1YXR A;  1FZA A;  3LK3 A;  2B88 A;  5BVZ A;  1X79 A;  1PGQ A;  4DVD A;  2WSF H;  4QH5 A;  3NZQ A;  1H0T B;  2D9D A;  2BDE A;  2XAF B;  1BCC J;  3PQU A;  2R44 A;  2KDY A;  3AE3 C;  1QJ9 A;  2CMR A;  2W6J H;  2CE7 A;  4ZMD A;  3AEF C;  4DID B;  3L72 J;  2OTJ P;  1QVG O;  1AVY A;  3AE1 A;  4B3T T;  3G06 A;  3ONJ A;  1SFC C;  2ZYA A;  3EDU A;  1AA0 A;  2XDJ A;  5ADX L;  3RGU A;  1NTM E;  4YSY A;  4I1L A;  3PJS K;  4HH2 A;  5AQH B;  5AQS B;  4CXX A;  4LSI A;  4LC1 A;  3TDK A;  4KMC A;  5DL8 A;  1BGY G;  4BUM X;  3RIF A;  5KAF E;  3FXD B;  3MUD C;  2LR2 A;  4IFM A;  2OYI B;  2YEV C;  4TV8 E;  3HKD E;  5M1B A;  2ZYG A;  1URQ B;  3PGU A;  2YDR A;  4XE5 B;  1L0N D;  3A0H E;  6PRN A;  3KZI O;  2HHH T;  3BCC J;  3V8U A;  2ZM6 T;  5GTI E;  1NAF A;  2E5Y A;  5FVK A;  1YTZ T;  1P84 I;  4A5X A;  3CCQ P;  4PK4 A;  4Q25 A;  4KR8 A;  4BAY B;  1RF0 C;  1JY3 O;  3AE4 A;  3ZC0 A;  2BS2 A;  2XAJ B;  4L0R A;  2OLT A;  2IAK A;  3AEA C;  1KNR A;  5JDF A;  4UV9 B;  3PRN A;  2BG9 B;  4YXW H;  4ZKU A;  1H8A A;  3IFM A;  1GQE A;  4JLE A;  3CC2 P;  1IBL T;  3PQS A;  2I1J A;  3AA7 B;  1YHQ P;  2R4O A;  1G8X A;  3AEB A;  5CJ4 A;  2NW7 A;  1KMI Z;  4A98 A;  1LKX A;  3AAE A;  3SFE C;  5LOV E;  4U74 A;  3FWN A;  3A7O A;  4WBA A;  3KVD D;  4DV5 T;  2A3D A;  3UTK A;  2QG4 A;  1PP9 J;  4LSE A;  1XZY A;  3ZN0 B;  4E1T A;  4GCP A;  5AVQ B;  3N2K E;  3E7K A;  1ZW0 A;  5L3D B;  3AED A;  2N2N A;  3U1A A;  3L75 G;  3V5S A;  4I55 E;  5G26 A;  2OAR A;  4A7P A;  4C46 A;  3VE1 A;  2BS4 A;  2PFV A;  2UXD T;  2M07 A;  4COF A;  4PK5 A;  3OW2 O;  1JO5 A;  3Q2Y A;  1OED C;  1LWU B;  3RX6 A;  4ERR A;  1JUN A;  2OTL P;  2MOZ A;  2LOS A;  3RBZ A;  2E75 D;  5KLI C;  1GL2 D;  4N78 E;  2V7Q J;  3MGN A;  4AYN A;  4UB6 H;  2YMY A;  2WSS H;  2BVM A;  5AQO B;  2VQE T;  4FZN A;  5AQT B;  2KWH A;  2OYH B;  2I6H A;  3FWL A;  5GTH E;  1UGO A;  1OIP A;  4MBQ A;  3CX5 E;  1Y9B A;  5HXH A;  3VMA A;  4B3R T;  5L3C B;  4U3F E;  3EWK A;  3GF3 A;  1HG5 A;  1CSB A;  5IHY A;  4BWN A;  4GOU A;  1ZRT D;  5HEJ A;  1KQL A;  2XAG B;  4DV3 T;  1HTJ F;  2H7H A;  2WMO A;  1CUN A;  3LK4 2;  5IWA T;  1HXT A;  4YFS A;  3V2N A;  1L0L J;  1X9V A;  1BDD A;  3RRC A;  3SY7 A;  2J1D G;  3ABV C;  3MTU E;  4O3W A;  4XNK A;  3HD7 C;  1BE3 E;  1PPJ D;  2QIW A;  1SFC B;  1KB9 E;  5ABE A;  2WDR A;  1LVK A;  4WY4 C;  3RKG A;  1BT9 A;  1PHO A;  2XE2 A;  2FJE A;  4NUV A;  4H0L D;  4X1K E;  3RYF E;  5B5E H;  5KX5 E;  4X20 E;  1JMB A;  1Q9F A;  1BDC A;  3B5M A;  2UUC T;  4LSH A;  1Z0P A;  2K5B B;  5K5G B;  4E7S A;  5CJ0 A;  1GW4 A;  3LG7 A;  4XA4 A;  2AEM A;  2UXN B;  2Q9Q C;  1RY3 A;  3VR9 A;  2UU9 T;  3UAQ A;  3L73 G;  1VQ4 P;  3ZMT B;  3TYY A;  4TWD A;  3OAK A;  1N73 B;  4JF7 A;  1X9B A;  3FZH B;  2C9L Y;  4EB6 E;  2NP9 A;  3SFD C;  5JDQ A;  2XZE A;  1THQ A;  2XE1 A;  2YNK A;  1LTB C;  4D6T J;  2VUR A;  3RL0 g;  3HKE E;  4BA9 A;  2FYN C;  3PUS A;  1H6S 1;  1AVO A;  1SQV D;  1HCI A;  5KAF O;  1K05 A;  1SQB K;  3UUB A;  4YLH A;  1YIJ P;  4F8H A;  1JTH B;  2IPP A;  3HUS B;  2KYV A;  3K3N A;  3IF8 B;  5E79 H;  2WPV B;  2PAJ A;  5AQR B;  2WJR A;  3A0H O;  2KZ7 A;  3J9X 1;  4TNW A;  2ZM0 A;  2C5I T;  2Q1K A;  2HH7 A;  5GTI O;  3Q3D A;  2H7V C;  1MFZ A;  1T6A A;  3ZCI A;  5C3J A;  1GTW A;  1LTJ B;  1HR0 T;  1T98 A;  3NKZ A;  4IE0 A;  1VQM P;  3EVY A;  4GYR A;  3VY8 X;  5KAI E;  4HN9 A;  2IX7 C;  3CL3 D;  3ZMU B;  3MP7 B;  4IT4 A;  1SQB G;  4LF9 T;  3VKH A;  3RBX A;  1MPF A;  4IOI H;  5CCG A;  3TLV A;  2IWV A;  1D0Y A;  3AE9 A;  3GW6 A;  2XTQ A;  4Z1M H;  1KFN A;  1E2A A;  4O4I E;  3M9H A;  4Z91 A;  5LG4 A;  2NPS A;  2JP3 A;  4D6T D;  2BCC E;  3TK1 A;  2VKJ A;  2DWG A;  2IBZ E;  3EDV A;  1MND A;  3AE5 A;  3BVH A;  1VF5 C;  2BEQ D;  3ZMV B;  5G3A A;  1OFC X;  2HPC B;  1W0B A;  1YQ4 C;  3UU2 A;  5KLI B;  1M90 Q;  4F4B A;  3CQC B;  1EZV G;  2LXC B;  4FQE A;  2GK9 A;  3PJA J;  4UEM A;  3CCU P;  2X9H A;  4IHJ E;  4DR7 T;  4AFK A;  2A06 E;  1IK9 A;  3LBX A;  2FBW C;  1RF1 C;  3FHN A;  4GK5 E;  4K0K T;  4BXL A;  1QL2 A;  3PJA A;  2XSB A;  2Y0D A;  4ZZC A;  2YOE A;  1Q90 D;  4UEL A;  5AVY B;  5CCG D;  4U2Y A;  5KJ7 C;  2FFD B;  5LYJ E;  3T24 A;  1VPC A;  1LTG C;  3WU2 H;  4JI5 T;  1NTM J;  2AXD S;  3MA9 A;  5B5E E;  1MIW A;  1L0V A;  4ZI3 D;  5AQG B;  2NPS D;  1AQT A;  1PGJ A;  4PR7 A;  2N1G A;  3CKD A;  3EAM A;  3JAE A;  2K9Y A;  3L73 D;  5GTH O;  4NPD A;  1LT9 C;  3L71 E;  5JR9 B;  2HOD A;  4AQY T;  5B66 E;  3L74 E;  1VQP P;  2E9X B;  1KNP A;  2JR8 A;  3EFG A;  2UWJ E;  3CCS P;  2XMX A;  4ADZ A;  4ZOL E;  4HFH A;  4IL4 A;  2E2A A;  2LJL A;  3G71 P;  2Q9Q B;  4DUZ T;  2FXM A;  4AXP A;  1FS0 E;  2MPK A;  1KIL C;  3KV6 A;  2K1A A;  2M6I A;  1D7M A;  5L3G B;  4Y28 J;  4DOJ A;  1G90 A;  1ZHX A;  3AE7 A;  3GLM A;  4EYY Q;  4GT1 A;  4G76 A;  3H1L D;  3RPU A;  3P7I A;  2Q7C A;  2Q3E A;  4K0U A;  5AW2 B;  4EOZ B;  1JY2 N;  3E1I A;  2W62 A;  1UIX A;  3IA3 A;  2R4P A;  2CWO A;  1OW6 A;  3M0A A;  3V5B A;  3VHL A;  4ZHQ E;  3I9Y A;  3RL0 D;  4EZ4 A;  4L74 A;  3AE3 A;  2BKP A;  2Y2X A;  4JCH A;  3UU8 A;  4WB4 A;  3AEF A;  2DI4 A;  4AKI A;  4KT0 J;  3CX7 B;  2YDS A;  4JBZ A;  2E74 B;  4DR4 T;  3IBP A;  1SFC A;  2W00 A;  3ITK A;  5CBO A;  3CMA P;  2MKV A;  2KLQ A;  1X8Y A;  3QB5 A;  2OYO A;  1N34 T;  3H1K G;  4U2Z A;  2BVL A;  3DA4 A;  5JQG E;  5L3B B;  3W67 A;  2AEF A;  5LB7 B;  2H8P D;  1GFO A;  3MXZ A;  2JQY A;  2D2C B;  3B8E B;  3MUD A;  4DR1 T;  1A02 J;  4JI3 T;  3A2S X;  3WI3 A;  3RK3 B;  3VRB A;  1T3U A;  2A45 G;  2F1T A;  2WZ7 A;  2NOX A;  4TX5 A;  1LTT C;  4O8S A;  4PAG A;  1L0N E;  2B9B A;  5LG3 A;  1HH0 A;  5AVX B;  4C69 X;  4DZO A;  1KYO D;  3H1I G;  4L75 A;  2V7Q H;  2BEZ F;  1V9D A;  5E0O A;  1ZHZ A;  5J1G A;  2O01 N;  4DBQ A;  1RF0 A;  4UVC B;  2KS1 B;  1VQ8 P;  2Y48 B;  5KKZ C;  1SFC D;  2O3J A;  4X64 T;  3L72 E;  3X1D A;  4EAH A;  4JYC A;  1HNW T;  5FY0 A;  3T1H T;  3AVR A;  4U3F J;  2UXC T;  4BRY B;  4GKK T;  1RF1 B;  3S4R A;  4L5G A;  2D0T A;  2NW9 A;  3K19 A;  3SFE A;  2LM2 A;  2FXO A;  3VZU X;  3HR0 A;  1T8Z A;  4N59 A;  2KNC B;  5LCY A;  3PE0 A;  1BSH A;  1M57 D;  5AQU B;  2H3R A;  5LXT E;  2UUB T;  2RP4 A;  3UT5 E;  1RH5 B;  5FVN A;  2YPV A;  4GK0 E;  4HKZ H;  3FXE B;  3CXH H;  1YS5 A;  5AVS B;  5FXX A;  1QLB A;  4PJM A;  1Z56 A;  1PGP A;  2ODU A;  2JWD A;  4PJ0 H;  4GCQ A;  2WMN A;  3RH3 A;  3BK9 A;  4RL9 A;  1YQ3 C;  3ZDM A;  2KLU A;  1YIT P;  2POR A;  2Y0H A;  2LSY A;  3ZJ2 A;  5KLV K;  2B76 A;  2LT3 A;  1Q86 Q;  4PV1 B;  2EHO C;  4IE6 A;  1R8I A;  1IFJ A;  3GA8 A;  3P8C D;  1OED A;  2I59 A;  1L4A C;  5C2T A;  5B5E O;  2N9B A;  4IDZ A;  1U5P A;  3K3O A;  4GOE A;  3KBU A;  2YNY A;  2HPC A;  1BSN A;  1KIL B;  1WFD A;  5JDG A;  3TLT A;  5JRC B;  1XDP A;  3WI4 A;  4XBF B;  4LF8 T;  1HS7 A;  1ZN5 A;  2R32 A;  1UX5 A;  2LEH A;  1FE6 A;  1W9R A;  2XU6 A;  3M06 A;  2IC6 A;  3ZT7 A;  3HRN A;  5EK2 A;  1FU1 A;  1MMD A;  1X0T A;  5KLV G;  3H25 A;  3CML A;  2ITA A;  4O2B E;  1IC2 A;  4H9O C;  1NU1 K;  3VTP C;  3VZT X;  2WSS V;  3PU3 A;  3M65 A;  1ZRT E;  4AIU A;  4DND A;  2QJY B;  4H9R C;  4FOZ A;  2K9A A;  3ZT6 A;  3T1Y T;  3E0Z A;  3ABV A;  3OJA B;  1PPJ E;  3HD7 A;  1YKE B;  3A3Y B;  1XNQ T;  1P84 D;  4IGU A;  2PRN A;  4WY4 A;  5JDN A;  1PZQ A;  2FYU K;  3CCJ P;  2XE5 A;  1S1C X;  4ILB A;  3H1I D;  3TGU G;  5AQM B;  3AAA B;  1G2C B;  2CCQ A;  1NU1 G;  5F8P A;  5FNV E;  1ZEE A;  4B3M T; 
#chains in the Genus database with same CATH homology
 3HKC E;  3RYH E;  5DL6 A;  1MM5 A;  4X1I E;  3EDU A;  1HF8 A;  4MFR A;  3ETU A;  4P09 A;  3RKO A;  5ADX L;  5HXS A;  1SA0 E;  4AKH A;  1OPF A;  4FRX A;  3KV5 A;  3SRZ A;  4RLB A;  2XAQ B;  3UUL A;  1ZV4 X;  3R6N A;  3VZW X;  4CXX A;  3E08 A;  4LSI A;  4E1S A;  3ZEF B;  5DL7 A;  3NBX X;  4KMC A;  5DL8 A;  3RRW A;  4BUM X;  3G7G A;  3FXD B;  4DO0 A;  1EZ3 A;  4ILU A;  2HPJ A;  5H6R B;  2F1V A;  4TV8 E;  2YEV C;  3HKD E;  1FMW A;  2UXX B;  4HFV A;  3SYB A;  2ODV A;  2JQQ A;  1E54 A;  3AA1 A;  1MIV A;  5JRE A;  1OSM A;  3KV9 A;  4I43 B;  4AQF C;  3LK4 1;  5DJQ C;  2E9X D;  6PRN A;  2K4T A;  3KDS E;  3V8U A;  1D1C A;  1KNZ A;  5DL5 A;  3ZJ1 A;  2X0L B;  3O0E A;  1NAF A;  3ZYK A;  3OBV E;  3C4Z A;  3O1H A;  3I0O A;  2Y7S A;  3K8P C;  3F31 A;  2XTL A;  4JEH B;  4PK4 A;  3FBL A;  3N9P A;  4KR8 A;  4BAY B;  3SZD A;  2Q9Q D;  4G2A A;  5GON E;  2PBI A;  4UV8 B;  3ZC0 A;  4CI3 B;  2GE4 A;  2XAJ B;  3AA6 A;  4L0R A;  2J1N A;  2IAK A;  3PUG A;  2LHN A;  5JDF A;  4UV9 B;  3PRN A;  2ZLY A;  3QUJ A;  2X51 A;  1U4Q A;  3NZP A;  4JLE A;  2ZLD A;  3PQS A;  4UF0 B;  1YKH B;  3AA7 B;  5LNK A;  3N9Q A;  1G8X A;  3NRX A;  5FP3 A;  2NW7 A;  3POR A;  3GMI A;  3AAE A;  1LKX A;  5LOV E;  4U74 A;  3KVD D;  4KR4 A;  3HOL A;  2A3D A;  2JRK A;  3UTK A;  1GFM A;  2MHL A;  4JEU B;  2NWB A;  2K0L A;  2X27 X;  5JVD E;  2V7K A;  5FXW A;  5HAX A;  4LSE A;  2ERV A;  4D64 A;  3ZN0 B;  5JDL A;  1ZKE A;  2XAS B;  4UIG A;  4RJW A;  4E1T A;  5DAB A;  4GCP A;  3N2K E;  5L3D B;  1UX4 A;  5EE2 A;  4YHJ A;  2N2N A;  3LK2 B;  5LA6 E;  3V5S A;  2V7I A;  4LSF A;  5LHI B;  1Q9G A;  7PRN A;  1IJ6 A;  4I55 E;  4AKR B;  2KC0 A;  3SYS A;  5G26 A;  3Q5X A;  3MZK B;  4CI2 B;  3ZYL A;  2O4V A;  1MNE A;  3VE1 A;  4MHC A;  2PFV A;  2M07 A;  3L09 A;  1BR1 A;  2CXL A;  4PK5 A;  5A1L A;  4AYI D;  3RX6 A;  2ZM2 A;  2SPC A;  4ERR A;  2MOZ A;  2LOS A;  2XE3 A;  1WYB A;  2CM0 A;  3KIN B;  2WBL A;  3AA0 B;  4FRT A;  4AYN A;  5LBQ B;  2BVM A;  4WBN E;  4FZN A;  2KWH A;  3HW9 A;  5HWY A;  4TZ4 C;  4MBQ A;  2A2F X;  2L3L A;  4QX7 B;  3CX8 B;  5HXH A;  3LK3 B;  4QWN B;  1SHZ C;  4O2A E;  2ZFG A;  3IEE A;  5L3C B;  3OYZ A;  4H9N C;  1HG5 A;  1BH3 A;  5GV0 A;  4AI6 A;  5IHY A;  4FT6 A;  3ANW B;  2VB6 A;  3QRA A;  4GOU A;  4D5U A;  2N2M A;  2LSI A;  4WW0 A;  2XAG B;  1HTJ F;  2WMO A;  1QSD A;  3N9M A;  1CUN A;  1MMA A;  3LK4 2;  1HXT A;  4YFS A;  3O1I A;  3RRC A;  3SY7 A;  3KVA A;  2J1D G;  2XAH B;  4GIW A;  4HGA A;  1MM4 A;  4O3W A;  2DNX A;  3C98 B;  5JR9 A;  1LVK A;  5FYM A;  3I1A A;  2V7M A;  3WAK A;  1BT9 A;  2DCF A;  2E9X A;  3ZMS B;  1PHO A;  2XE2 A;  4NUV A;  4X1K E;  3RYF E;  3DA3 A;  5DQW A;  5KX5 E;  4X20 E;  1Q9F A;  2KMF A;  4QKN A;  4LSH A;  1Z0P A;  2K5B B;  3HA4 A;  4E7S A;  5LJM A;  3LFM A;  2Q9Q A;  2ZMA A;  2RA1 A;  3LG7 A;  4OYK A;  5L2L A;  2H7O A;  2Z6E A;  4IE4 A;  4H9S E;  2UXN B;  2Q9Q C;  4CI1 B;  3N9O A;  4AKM A;  2KXP A;  3DTO A;  3UPG A;  3PUR A;  3UAQ A;  4EXT A;  3ESL A;  4G75 A;  4L9I A;  3ZMT B;  3POX A;  4H9Q C;  4UVA B;  3AA1 B;  3GN5 A;  5L3F B;  2DLR A;  3CQG B;  3U3I A;  2VKO A;  1BR2 A;  4CXW A;  3VKG A;  3O1J A;  2LHR A;  2IW5 B;  4EB6 E;  2NP9 A;  5JDQ A;  5ETW A;  1THQ A;  3C4X A;  2XE1 A;  4RJX A;  3E22 E;  5L3E B;  2YNK A;  3DP7 A;  3SOL A;  3HKE E;  4BA9 A;  2K48 A;  3PUS A;  3RYI E;  1H6S 1;  2W80 C;  1HCI A;  2Y0K A;  1YW0 A;  3RYC E;  3AVS A;  2NW8 A;  3N9N A;  4PJL A;  4PJN A;  3VY9 X;  4Z3T A;  3JC6 D;  4YLH A;  4IIJ E;  4OYJ A;  3OYX A;  4I4T E;  3T20 A;  3AA6 B;  2K24 A;  2V1D B;  2D0U A;  3K3N A;  3OKQ A;  3IF8 B;  4A56 A;  2OMF A;  2KZ7 A;  2CEA A;  3J9X 1;  2ZM0 A;  2C5I T;  2HH7 A;  3I0Q A;  3ZYM A;  2H7V C;  3ZCI A;  1D0Z A;  4AZL A;  4AYM C;  3C5O A;  5EZY E;  4I50 E;  2ODJ A;  2B1E A;  2V26 A;  4DMV A;  4J2C A;  3D0T A;  5TAO A;  3AAE B;  3VE2 A;  1T98 A;  3O9X A;  2VKH A;  4IE0 A;  4QX8 B;  4PK6 A;  2XG6 A;  2QA7 A;  3EVY A;  3RBH A;  8PRN A;  2XTR A;  4BJN A;  2JPF A;  3AB3 B;  1ZHC A;  4GYR A;  3VY8 X;  4HN9 A;  4TUY E;  3ZMU B;  4OK0 A;  3VKH A;  1MPF A;  3VZU X;  3ETV A;  1OXZ A;  4AKG A;  2DHR A;  4MLK A;  1D0Y A;  2ES0 A;  2QTK A;  2MTQ A;  3CVR A;  3F57 A;  4GCS A;  3Q9D A;  2W0G A;  4TN7 B;  2XTQ A;  3GP6 A;  4O4I E;  4V1A v;  5LG4 A;  3CPZ A;  1GFQ A;  2X9Y A;  4O4L E;  3L3P A;  5CB4 E;  4QXC B;  2VKJ A;  2XHE B;  1P4T A;  1FIO A;  2DWG A;  3EDV A;  4AKL A;  1MND A;  2WM9 A;  5HXC A;  2CLY B;  4AYD C;  3W15 B;  4B6X A;  3ZMV B;  5FXZ A;  2MBG A;  3ZPO A;  3UU2 A;  2MYS A;  4KUM B;  4UXN B;  2X68 A;  3QRC A;  4F4B A;  3CQC B;  4ZS2 A;  4PW8 A;  1QJP A;  2GK9 A;  5C8Y E;  3ZMZ B;  4ZI2 C;  4DBR A;  4UEM A;  4D65 A;  3PUA A;  2X9H A;  4IHJ E;  4KP3 C;  4AFK A;  5CA1 E;  3LBX A;  3FHN A;  4GK5 E;  1BR0 A;  4P0B A;  3KFW X;  4QXH B;  1IZN A;  2CLY C;  2D2S A;  5J2T E;  1KK7 A;  1BR4 A;  3RC3 A;  2MNH A;  3UUN A;  4UEL A;  5EK4 A;  2LSJ A;  2JMM A;  4GHB A;  2M67 A;  1MMG A;  2KWI B;  5LYJ E;  3T24 A;  2W61 A;  2EHO A;  5FXV A;  2W81 C;  4N78 D;  3K3Q C;  3HOE A;  4KBM B;  3MA9 A;  5HYA A;  3FB2 A;  5JDH A;  2WAU A;  1MIW A;  2CWY A;  3C51 A;  3N2G E;  5FY1 A;  1Y64 B;  4YJ2 E;  3SY9 A;  3WI5 A;  4ZI3 D;  4NUU A;  3UFE A;  1HFA A;  3UUM A;  1GFP A;  1B7T A;  2N1G A;  3CKD A;  2YIN A;  5DQV A;  2OA5 A;  2X9X A;  3C50 A;  4G63 A;  3AAI A;  4M1P A;  5JR9 B;  2W63 A;  5JDP A;  2E8I A;  3H37 A;  2E9X B;  1WR6 A;  2PJQ A;  3TKL B;  3QK6 A;  4O49 A;  1D1B A;  2XMX A;  3JTY A;  4ADZ A;  2Y8D A;  2CXF A;  4JUY A;  2A72 A;  4ZOL E;  3ZC1 A;  1S94 A;  2LJL A;  2Q9Q B;  3HL6 A;  3ONX A;  4AXP A;  3JC6 C;  3B13 A;  5JRC A;  5HXR A;  5JR9 C;  4QHO A;  1BXW A;  2IC9 A;  2KXP B;  2E9X C;  3GWH A;  3KV6 A;  2YU2 A;  5L3G B;  1G90 A;  1QUU A;  1ZHX A;  3SZV A;  2ACX A;  1ZHT A;  1E1H B;  2LSK A;  2PG8 A;  4Z8X A;  1PRN A;  4G76 A;  3GN5 B;  1IJ5 A;  3RPU A;  3P7I A;  1HG2 A;  3S4U A;  4K0U A;  2EHO D;  5FY7 A;  4AYE C;  2Y0L A;  5M4Y A;  2JMH A;  4EOZ B;  2V7L A;  3BQI A;  2JMK A;  2W62 A;  2ZM8 A;  4WBO A;  2CWO A;  3POQ A;  2XQY A;  4GYS A;  4C91 A;  3VHL A;  3QC9 A;  4ZHQ E;  5F3J A;  3I9Y A;  5LBM A;  3EUH A;  4EZ4 A;  5LGU B;  1VOM A;  2Y2X A;  4JCH A;  4PNI A;  3SWH A;  5AFU K;  3OJA A;  2KT9 A;  2DI4 A;  4AKI A;  3LJC A;  3CX7 B;  3VU7 H;  1WRD A;  4H9P C;  4MAL A;  4UVB B;  3IBP A;  2W00 A;  5LGN B;  4O4U A;  3A5X A;  2FGQ X;  2KZ7 B;  3PU8 A;  2YK0 A;  2KLQ A;  4FZM A;  4JFB A;  1AJ3 A;  4QXB B;  1H7C A;  4FJO A;  3AAA A;  3O4X E;  2X9W A;  2BVL A;  2WWU A;  4O4H E;  3T8O A;  3DA4 A;  2NTY A;  5JQG E;  5L3B B;  4FSP A;  3H3A A;  4CQI A;  1GFO A;  3MXZ A;  2XUE A;  4O3X B;  4B61 A;  3WAJ A;  1ZHY A;  4FI5 A;  5JH7 E;  3MJX A;  1IAP A;  1FMV A;  2LFU A;  3A2S X;  2Y6X A;  4O4J E;  3WI3 A;  2DWK A;  3UUX B;  5J2U E;  2QGS A;  2F1T A;  2NOX A;  4TX5 A;  4ZS3 A;  4O8S A;  4PAG A;  2CA5 A;  5FMN A;  4AQF A;  4C69 X;  3EMN X;  2LOP A;  1VRB A;  2FGR A;  1ZHW A;  5KDM C;  3CWZ B;  3HKB E;  1V9D A;  1D1A A;  4GF4 A;  4PFP A;  2LM9 A;  4XAX B;  2VKD A;  1O3X A;  2KND A;  5E0O A;  5J1G A;  4C90 A;  1ZHZ A;  4N58 A;  3Q5W A;  4DBQ A;  4O3Y A;  3BQL A;  4ASK A;  1MMN A;  2N9D A;  4UVC B;  1HXX A;  4ZI7 E;  1LVF A;  2Y48 B;  4TV9 E;  4U9C A;  5HWX A;  3MKD A;  1HXU A;  3HI2 A;  4DMW A;  5KMG P;  4EAH A;  4EZH A;  3U78 A;  5FY0 A;  3B57 A;  1D0X A;  3AVR A;  3N5L A;  4ZI3 C;  4XNK A;  3C64 A;  2VK9 A;  4U72 A;  3NSG A;  2C5K T;  1HX8 A;  5D5D A;  5HXE A;  4PUX A;  3MK7 C;  1MIY A;  3LBX B;  4L5G A;  2D0T A;  4HTE A;  4O3Z A;  2LE8 A;  4IST A;  2NW9 A;  3K19 A;  3DJB A;  1IZN B;  3PTR B;  5EK3 A;  1WLX A;  5LP6 E;  3C4W A;  3HR0 A;  4IE5 A;  1ORM A;  3NRY A;  3I9W A;  5LCY A;  4X1Y E;  5CA0 E;  4EYU A;  4N59 A;  3PE0 A;  2D5U A;  4OFZ A;  3R84 B;  3FBZ A;  2H3R A;  5LXT E;  4PFO A;  3TZG A;  2RP4 A;  3MAC A;  4HEA A;  3UT5 E;  5LHH B;  3HWB A;  4FZL A;  2EHO B;  2HPL A;  4HKA A;  2YPV A;  5FVN A;  4GK0 E;  4UF0 A;  3AA7 A;  3FXE B;  1US7 B;  1YS5 A;  5FXX A;  4PJM A;  4WNK A;  3FYX A;  4XZC A;  2ODU A;  4IE7 A;  4E7Z A;  4GCQ A;  2N2L A;  2WMN A;  5LJN A;  3RH3 A;  3BK9 A;  1YD8 G;  4RL9 A;  2POR A;  2Y0H A;  4BJM A;  4OHF A;  2L8K A;  2LSY A;  3ZJ2 A;  1S35 A;  1OWA A;  5PRN A;  5LHG B;  2LT3 A;  2LHF A;  4XNL A;  2EHO C;  4QQ1 A;  4H63 H;  4IE6 A;  4EYY R;  3GA8 A;  2CXD A;  3P8C D;  2I59 A;  4P0A A;  3PUQ A;  4IDZ A;  1U5P A;  1GFN A;  2VL8 A;  1LRZ A;  3K3O A;  3LK2 A;  2M06 A;  3KV4 A;  3KBU A;  2C5J A;  4RLC A;  4AKR A;  4FSO A;  4HE8 A;  4CZZ B;  4H63 V;  1NWM X;  3ZCJ A;  5JDG A;  4FMS A;  3T0S A;  4AQG A;  5JRC B;  3Q2M A;  5JDM A;  1FEW A;  1WYC A;  4XBF B;  3RC8 A;  4CXY A;  3POU A;  3WI4 A;  2YU1 A;  5T5F A;  4AUI A;  2KIN B;  4YJ3 E;  4FUV A;  3F2E A;  1HS7 A;  2LEH A;  1UX5 A;  2J4U P;  3PDY A;  3V5U A;  2IC6 A;  3IHR A;  3CQX C;  5EK2 A;  1MMD A;  5IYU A;  2VAS A;  3CML A;  4O2B E;  3CX6 B;  4H9O C;  3AA0 A;  3BQK A;  4O4X A;  3VZT X;  3KVB A;  4ANJ A;  1QJ8 A;  2WSS V;  2L9Q A;  3PU3 A;  1UCU A;  3M65 A;  3ZLI A;  4DND A;  1G73 A;  3N9L A;  4H9R C;  2VWA A;  4ISS A;  4PJJ A;  2BZB A;  2K9A A;  3SS1 A;  3ZN1 B;  5AFU L;  4FOZ A;  2G0U A;  4KRA A;  5ADX K;  2X66 A;  5BMV E;  3E0Z A;  3KBT A;  4F6R C;  3J7Y q;  1YKE B;  2X67 A;  4ZI2 D;  4FES A;  4IGU A;  5LGT B;  2PRN A;  3LK3 A;  5JDN A;  1X79 A;  4EIW A;  2C0S A;  5IYZ E;  5H6Q B;  4DVD A;  3ANW A;  3NZQ A;  2NTX A;  2JJ9 A;  3N2O A;  2BDE A;  2XAF B;  2XE5 A;  3PQU A;  2LSG A;  2P9B A;  2V7J A;  2KDY A;  1QJ9 A;  3AAA B;  2CMR A;  2CCQ A;  5F8P A;  2CE7 A;  5FNV E;  1ZEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...