1IZNB

Crystal structure of actin filament capping protein capz
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CapZ: structural basis for actin filament barbed end capping
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords CapZ alpha-1 subunit
total genus 88
structure length 270
sequence length 270
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 1iznB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1iznB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 1iznB02
3AAEB 3AA7B 3AAEA 3LK2B 3LK42 2KZ7A 3LK2A 2KXPA 2KZ7B 5AFUK 3LK3A 4AKRB 5ADXK 3LK41 4AKRA 3AA0B 2KXPB 3AA6B 3AA7A 1IZNB 3AA0A 1IZNA 3AAAB 3AAAA 3LK3B 3AA1A 5AFUL 5ADXL 3AA6A 3AA1B
chains in the Genus database with same CATH superfamily
3H1JG 1GMJA 2R88A 1QVGO 3K3OA 4HFIA 5EK4A 2D2CB 2XQ7A 3NRYA 4XFJA 2P10A 4RJXA 1BE3J 2Y6XA 1Y8AA 2R3SA 1GU5A 3QWOC 1G1IA 2EHOC 1J1JA 5L2LA 3L72J 4U3CA 5AQKB 3WI3A 1XMQT 1SQXK 3O1HA 4UEMA 2QA7A 1LT1A 5A1LA 1NENA 2L91A 1KYOH 1URQB 1BE3D 3L74J 1IBKT 1M1JC 4IDOA 4XA4A 1Q2NA 4X20E 2I1JA 4I0UA 4B3ST 1SQQE 2PGDA 5JQGE 4O4JE 3A0HE 1VRBA 5GONE 1ZOYA 3D70A 3EVYA 2XM1A 3V4QA 4OYKA 1LTIC 2Y8DA 2D2SA 5AVUB 1N7SA 4PJ0O 4YJ3E 4H9SE 3NMDA 4X64T 4B3RT 3AA0A 3PUQA 1UURA 2LFUA 2WSFJ 2A06E 3R2PA 4BXLA 2VVSA 5H6RB 2LXCB 5KAIE 2JQYA 3CCUP 1MMNA 4PUXA 3V5SA 3LW5J 2D9DA 3A7MA 3ZJ1A 4I4TE 5LMUT 3CLQA 1GW3A 4Y28J 3AVRA 3RKGA 3PV0F 2Y9ZA 2V4HA 5HXCA 2WMOA 1BDCA 5JH7E 2DWKA 4J2CA 4E7SA 4WB4A 1LT9B 2WY2A 4DNDA 3DZMA 3DWOX 5KLVD 2QG4A 1O3XA 2VKDA 2WJQA 4JI8T 3G9RA 1HNWT 5FY0A 4FSOA 1NU1J 5HWYA 3ZMTB 1BR0A 4PJNA 2ACZA 3N2KE 4PV1C 2E43A 4RKUJ 2CBJA 4OHFA 4HFCA 2AXTE 4JBZA 2Z5IA 2P2UA 2ZYDA 1JCCA 3UUNA 2LRKA 2PP6A 4DUYT 4UVAB 3GG2A 1PIXA 2B9BA 2V7MA 2H89C 5K5GB 3CCVP 3V2QA 2LM2A 4HFVA 4CXYA 3ONXA 3AE7A 5KJ7C 3L71G 5DQVA 3MTUE 3UU3A 2HHHT 1HF8A 1MIYA 2W81C 4U9CA 6PRNA 3GWHA 4H9PC 3SFDA 1ZHXA 2R5BA 3NBXX 3FYXA 3II6A 3KZIO 2F1CX 3KZIH 3SYBA 4AKHA 4X1KE 2YN6A 4PD4E 4MFRA 1N7LA 2R6GF 5E0OA 4C7NB 4U2YA 1LTBC 3L35A 2V7JA 3CX5H 4DCKA 4LFAT 5L3DB 2PORA 1JY3N 4AFKA 4YSXA 3DWNA 3PQSA 3AE2A 1KQFB 2FGRA 1QUUA 1NWQA 4PNIA 4FJOA 3N9OA 4RLBA 2X27X 5AQQB 2BEQD 1NOHA 2R5DA 2RP4A 4DV7T 4NPDA 3OJAB 4AISA 5B66H 4H44C 1MMDA 3SS1A 4EYUA 1SQBD 1OVVA 3R4YA 4L75A 1L4AB 2J62A 2L3LA 3AA6B 2K88A 2QRXA 5AW8B 1IJ5A 2W6BA 2N9DA 2WSSV 2MPKA 2WZIA 3H1HJ 3PE0A 2YO3A 3PURA 4GIWA 4CZZB 1LJ2A 1XDOA 3BRYA 3RIAA 4A56A 3H1LG 4KI0F 3VY9X 4YTNA 2WDRA 3A0BH 2WSFH 3ETVA 2Y0CA 4OX9T 1JCDA 4LFCT 3SFEC 4KMCA 1MM4A 1RE3C 2JKVA 1CUNA 2K4TA 2B1EA 1T8ZA 4IE7A 2M07A 1BSNA 3O8ZA 5AW4B 2NR4A 2ACXA 3GMAA 4H9OC 4D6TJ 5HXEA 3MGNA 1HNXT 1Q9FA 1NU1K 4QXBB 2JMMA 5DL5A 5HXRA 3MHVA 4UB6O 1OEDA 4QXCB 2VK9A 3NSGA 1SQPD 1BCCG 4DIDB 3UU2A 3WMM0 3D6ZA 2G0UA 2BG9A 1X22A 2W6JH 4MLKA 4KR4A 2FYUG 2HN2A 4I43B 1M57D 1H0TB 4ASKA 1KB9D 1OZHA 2GUVA 1ZR2A 2KMFA 5E79H 4BAYB 4AUIA 1RF1A 1QL2A 4AYNA 4FSPA 1YS5A 3AE6A 4XE5B 4KHZF 5IWAT 3H1KJ 3IFMA 3M9HA 1T7SA 3C5OA 1UIXA 1YQ3A 2KLQA 4O4IE 4UV8B 2J4UP 2JQQA 2XDJA 2FFDB 2IYPA 3CC4P 5HCJA 5AVRB 3JC6D 1NTME 1GDTA 5AW9B 1YKEB 2Q9QC 2PFXA 2ZXEB 1L0LK 2L8KA 4ILBA 5CA0E 2V26A 2CWYA 1XNRT 3WUVA 2ZM6T 1HJ0A 4B6XA 1HXXA 2D0UA 4QHOA 5KKZB 3ONLC 1HG5A 1X9BA 4QXHB 5HEJA 2NTXA 1NYHA 2QJKB 5AW6B 4ZXLA 3H3MA 4WZXA 1QGKB 4CXXA 4DV5T 2OYIC 2JR8A 1VQ6P 3H1JJ 4JF7A 3FZMB 4JYBA 1YBKA 4ZI7E 4A98A 1KILC 2MAWA 1EZVD 2FYNB 3SWKA 5FMNA 2NW9A 4PR7A 3CX6B 4CXWA 3VKGA 1NJIQ 3SY9A 3H32B 2BBHA 2ZT9B 2KDYA 1XTCC 4AXPA 3AAEA 1ZRTE 3BK9A 2NOXA 3Q5PA 3V5UA 2ODUA 2Q6QA 2E5VA 4COFA 4AKRB 1SQVG 4UB6H 1RF1C 4HB1A 2E75B 1KQLA 2OLTA 5CGMA 2LHNA 3HKBE 1MM5A 2K5BB 2KK7A 4X65T 4OH8B 3AAAA 1SS1A 3CX5D 5L4EA 5ADXL 4ZNCA 1BR4A 2V7LA 4PK5A 3AEGA 3FXEB 1K05A 2QE7H 5AW5B 2YO2A 3GN5A 1UK5A 3TKLB 3MUDA 4NPPA 2D2CD 2KOGA 1USDA 2BS3A 5KXJA 3VMZA 5TISE 3VMXA 1YKHB 5L8RJ 2R4OA 4UIGA 1MIVA 4DV6T 1SA0E 5ETWA 3HTKA 4G75A 2C5JA 2HH7A 4U33A 4BA9A 2J5UA 1IO4A 2WU2A 4EYYR 5AW3B 1VQMP 3I9YA 1T98A 4CN6A 2A45I 4Z1MH 3H1LE 3G71P 3FB2A 3JADA 3P32A 1GK6A 3ZN0B 2DHRA 1NTZD 4TV8E 4FESA 3UU4A 4IFMA 3B5ND 3PUWF 3UUBA 5LBQB 1LTAC 1KNPA 4IHJE 1JNRA 2VWAA 1NTZE 4GYRA 5GV0A 3LIDA 4PJ0H 2DL1A 2YNKA 2KZ7B 3J7Yq 1MUUA 4N59A 2E76C 1M62A 1YD8G 1QX8A 2X67A 5HYAA 3QNUA 4GCSA 3R84B 1S72P 5DJTB 1KMIZ 2YIUB 5EE2A 4HEAA 4FRTA 4DBRA 1KNZA 5LGUB 3HUSB 2JMHA 2EHOD 2MBGA 2WDQA 1YJWP 3L72G 4E7ZA 3RI5A 2JPFA 5IYZE 1DEEG 4DMWA 2SPCA 3IR9A 5AQLB 1MNEA 1J2JB 4YSYA 3L3PA 3RYHE 5F3JA 4UB8H 4I6MC 2LSYA 2ZT9D 3OJAA 1JY2P 2O1KA 4IL6O 5KAFO 3HA4A 2IUBA 1VQOP 3UQ4A 2Y0DA 2JRKA 2MYSA 1ZN5A 4QQ1A 4E1SA 1FEWA 2WPRA 3Q5DA 1JM0A 1L0LG 5JDNA 2FXPA 2E75D 4H44D 3TSIA 5AQVB 2CXFA 3PP5A 1N7SC 2KUBA 3H37A 3AEDC 3PJSK 4FI5A 1D1AA 4CTDA 2V1DB 4JUYA 1GL2B 5M4YA 4AKRA 5AVVB 3O9XA 4AKLA 2AXCA 4IDNA 2LT3A 3C4ZA 2JO1A 1L0NE 1GL2A 3NZQA 5GTHE 5FXXA 2Y0LA 2YMKA 2Z4EA 1KILE 2YDQA 3P8CE 3AE3C 1FZCC 3S4RA 3L70E 1SQPJ 2W4XA 2CWOA 1ZLLA 5KTBA 2HPJA 3S4UA 2E5LT 5LMNT 3BS0A 4HFBA 4CN1A 5G39A 5LYJE 1AV1A 1BCCJ 3OYZA 2M6IA 4H44B 4HH2A 5KKZC 3LK3A 3RC3A 2XAGB 2G3AA 5DL6A 3B5NB 1GW4A 5AVSB 4WY4B 1U5PA 3ANWB 3LK3B 1YQ4C 1LTJB 4CI3B 4H9RC 1PP9J 5AVWB 2YPVA 3HE4B 1G2CA 2WQYA 4GOUA 2Y48B 1Q86Q 4WY4A 5CBOA 4O4UA 2C0WA 3RH3A 2UXBT 1BXWA 1BSHA 2QYWA 2M8RA 3LK2B 2VRSA 2KNCB 5C39A 4HWCA 5KLVK 1H89A 1N8RQ 1E1HB 3FZKB 3IAOA 4HWHA 3AA0B 1YTZT 3SSUA 2UUCT 1IAPA 5GTIO 1VQPP 3UIAA 3F5HA 1FZCB 3OVUA 3KVBA 2WCAA 1D0XA 4TWDA 3BQLA 3KFWX 4AQFC 3TLWA 2M06A 2UXCT 4I2LC 3POUA 1NTMK 4DV1T 3LBXA 5LGTB 3GF7A 3CD6P 3BQIA 4AYID 1SQQK 5AVZB 4TWHA 4IL6H 5J1GA 1PRNA 2M5AB 3DA3A 4KP3C 2YMYA 1RF1B 1SQQJ 2KT9A 1M90Q 2PJQA 4QKNA 5ABFA 2BG9B 4D65A 2QJPB 3AEFC 4O9BA 2K3WA 4H63H 4JI7T 2FKWB 5GTIH 1MZ9A 1VQ4P 5BVZA 5G38A 3CX5I 1FDOA 3A7OA 3D6YA 2C5IT 4K3AA 2JMKA 4XNKA 3AAIA 5L3EB 1ZP0A 1EZVE 2IFMA 3AEBC 3OYXA 4LSEA 3H1LD 4UV9B 4YTMA 2H88C 3H1JD 3BCCD 1RE3A 2B89A 3L71J 1L0NK 1EC5A 1PZQA 3OA7A 3QB5K 2IDBA 2PFVA 4C00A 3LBXB 3BRZA 2FY8A 2P67A 3JCUH 4P0AA 2IW5B 2A9UA 5JRCB 5KDMC 2ODJA 3NVOA 3Q2MA 4LLHA 2LXBA 1N32T 2QJYB 2QJPC 3CXHE 5LB7B 4O2BE 5FNVE 2Q9QB 1NU1D 1HTJF 2E5TA 1YJNP 3ESLA 2BG9C 5DJQC 5JR9B 5APUA 4UF0B 4L76A 3CWBJ 1SQPK 2X9YA 5DJUB 3F2EA 3O4XE 4H9NC 3RL0B 4JQ0D 1N36T 2CPSA 3BATA 3MZKB 5JR9A 2I59A 2H43A 2NPSC 4ZI3C 3V2RA 3S9OA 2C0SA 3G06A 2DI4A 1G8XA 3AE5C 2C0XA 2M0BA 1OEDE 3AA1A 5LBMA 4N58A 3VRAA 3GLMA 3OKQA 1J1EC 4KR8A 3A0HH 1W0BA 1S9KE 3SOLA 1NH4A 5CB4E 5KJ7D 4LF9T 1EDLA 5LXTE 2WBLA 2DCFA 2RPAA 1IFMA 5AVYB 3CWBG 1G73A 2XMXA 3PRJA 5APQA 2Q9QA 1NKNA 2FFDA 2KLUA 1FZFA 3EFGA 4DV2T 2I6HA 3ZT6A 4RJTA 2NTYA 3AEBA 3RBHA 4TLFA 5BU5A 4PD4D 1H88A 1NTKJ 3EI0A 5J2UE 4KRAA 3KV6A 4PAGA 5LOVE 2PTFA 5BMVE 4QWNB 5JDHA 3H1HE 4HKAA 4HTEA 4JYCA 2XZRA 3NFQA 1ORMA 4FZLA 2QVAA 5TJHA 5APSA 1KYOD 3FWNA 1BT9A 2WU5A 2YINA 1SQXG 3KDPB 1UUSA 1LTGC 1BE3G 2I8DA 1GFPA 2V6YB 5CCGD 1IFPA 5AQRB 4JI2T 5ADXK 4LMJA 4RESB 4W7ZA 5AQTB 2EHOA 3WAJA 1JMBA 5J0ZA 3CC7P 1Q7YQ 1VQNP 3IA3A 2XASB 2K9YA 2F1TA 2W61A 2J1DG 3ZSTA 3CI9A 3T97B 1MMAA 5HXHA 2CMRA 3T1HT 3UT5E 2X9XA 2JDIH 1LT9C 4JBWF 2GK9A 3I1AA 3L75G 2LSJA 3U59A 4IE4A 2JQKA 5JR9C 2XQ4A 2A45H 1L0LE 1D7MA 3F57A 4AKMA 1N7SB 4G76A 2CLYB 1KQSO 4B61A 1HGZA 1SQBK 2R44A 1SQVK 2Z6EA 1GFNA 2N2MA 1M1JB 4H13C 3CQGB 2YKOA 3ZC1A 1QJ9A 3Q2YA 1Q82Q 4R4MA 2KYVA 4C7RA 4EI2A 4HFEA 5HEGA 4ADZA 5TISO 4AYDC 4GYSA 2N2LA 3RYCE 2YKPA 2N1TD 3L72E 1PPJE 5APVA 3FX0A 2LLYA 2HPCB 2LRLA 3ABVA 3H1KE 4UB8O 2FFDC 4PW8A 1RQUA 2XY8B 4LF5T 2VVNA 5FXWA 4F8HA 3WU2O 2R4PA 4YT0A 1MKMA 1HBWA 4ZMDA 1ZP0C 4PK4A 5C2TA 4HFDA 4U31A 2ZM0A 2K1AA 4ZKPA 3B5NA 3EWKA 3HOLA 2C5KT 4GHBA 1NTZG 3L09A 4U7YA 4EGWA 1X79B 3MZWB 1ZHCA 1SFCD 2BCCJ 1PHOA 3QUJA 1MFZA 4DVDA 5AQOB 5AQMB 4LF6T 3L75D 4WW0A 1LVKA 3Q9DA 4YHHT 3U78A 1AVYA 4YXDA 1EDJA 1S94A 1VOMA 2ZFGA 2Q5UA 5PRNA 2L9QA 2XM2A 3LDQB 4WY4C 3JCUO 4PJLA 2X9HA 5L3FB 2AXDS 4X1IE 3C51A 5D5DA 1L4AD 1JMMA 2KSJA 3SZDA 3W67A 3RRWA 5L3CB 5DL7A 1NU1E 3CKDA 1K04A 2LR2A 3K5BA 3MIWA 5FVLA 5HEHA 1W09A 1L0LJ 2RH0A 2V7KA 2WMNA 2YOEA 4MBQA 1FBMA 4D5UA 5BU8B 3KPEA 1MMGA 4CPGA 2FGQX 1CW5A 1SQVE 2E74D 2D0TA 3BCCE 4PJMA 4G2AA 3JTYA 3PGRA 4GODA 1URQC 3FBZA 1PGQA 3RL0C 4HN9A 3N7NA 1OXZA 1L2PA 3L37A 5L3GB 2YNYA 4GCPA 2NZ2A 4N74A 5AQNB 2OARA 2FXOA 5CA1E 1WYBA 2WVPA 4ISSA 1DD3A 2W90A 2K0LA 2M5AA 1LGHB 1ZV4X 1EZVI 1I94T 4FOZA 4B3MT 1FZCA 3AE3A 2V8SV 1US7B 4IFDK 4K3BA 2E42A 2CRBA 5APWA 1AFOA 4DR3T 5FL0A 2A2FX 4YJ2E 4OWFA 4WVZA 3C64A 3M9BA 1YXRA 1FMVA 3ZSSA 1HS7A 2BCCD 1T6AA 2POHA 3HR0A 3VR8A 3JSVC 3LK42 2Y9YA 2LSGA 1VF5C 2IZ0A 4ZZBA 1R8IA 2QSIA 5APYA 3E08A 5AQSB 2KSRA 2BCCE 3CCMP 1VL2A 2K24A 2VURA 3UFGA 4EEBA 2HODB 4GIFA 3ZYKA 3HE5B 2KB7P 5IHYA 1E54A 1D0ZA 4PD4I 5CHXA 1KQGB 3KINB 1OSMA 2ZM2A 1FU1A 2HODA 3G7GA 2JEEA 5FYMA 2CPBA 4HWIB 3ZMUB 4EB6E 4DUZT 3M9QA 3KBUA 3JAFA 3ITKA 5JREA 2YXRB 3TZGA 1UIIA 3SY7A 3GP6A 2YKSA 4IGUA 1X8YA 1IBMT 4EOTA 3VKHA 2Q3IA 4FMSA 4H0LB 4BJNA 3SWYA 1J1DC 2LOSA 2B87A 1KN7A 1Q90D 1M7KA 3CL3D 5G3AA 3HRNA 4PV1B 4G63A 1VQ9P 1WCRA 1CI6B 5FP3A 3A2SX 3QRAA 4JEUB 3MP7B 3BCCJ 3BQKA 4AI6A 5CMZA 4DO0A 4P09A 2Z5HA 3AE1C 3VOPA 1N73B 1J5ET 3AXJA 3VYIA 3P4RA 1CI6A 4YFSA 5JDQA 1KYOE 4LF4T 3ETUA 3CWZB 3H1KD 1OW8A 1E79H 3H1KG 2KWIB 5FL1A 2OTLP 1S2EA 5ABGA 2XTRA 2V7QH 1PPJG 5B5EH 4CI2B 3FBLA 4D64A 2P9BA 3AA1B 3SZVA 3OW2O 4CQIA 4PJJA 1VCTA 4Q25A 4DR7T 1T72A 1SVFA 1P84H 4JEHB 4JI1T 4X62T 1K8AQ 2H89A 3NRXA 1L0VA 3HWBA 1DIPA 2X9KA 3RIUA 3Q3DA 3JCFA 4KBMB 1L0ND 4FUVA 3G3ZA 1NO4A 2VL8A 3AAAB 3L75E 3RHWA 2W83C 1NTKD 2FJEA 5EK2A 3VTPC 2V6YA 3A5XA 3UAQA 3AE9C 4NUVA 4PFPA 3RLFF 1M1JA 3AEGC 2LOPA 1HXTA 4F4BA 2OYHB 4Z90A 3N5LA 3P4SA 2E76B 3B4SA 1FZGA 2XE3A 2WPQA 2CM0A 3ZMZB 3L70D 2P7JA 2XNDH 3NWIA 2A3DA 3VP9A 5AQHB 1FDMA 4W7YA 2LKHA 4UVCB 1VCSA 3JC22 5AW1B 5HWXA 2LE8A 4DV3T 3MKDA 4IE5A 3PUYF 5FKYA 3T20A 4N78E 3AECC 2CHOA 1MFTA 5F5WA 4AQYT 3HD7B 5KAFH 2KC0A 2J4GA 2ZYAA 2V7QJ 5FVNA 3N9MA 1K73Q 1CSBA 4I1LA 2BDEA 2FBWA 3PUAA 5LGNB 1WRGA 2OTKE 3EHZA 1SE7A 5LA6E 2VKJA 1JEKA 3P4PA 1J1DB 3E1IA 2QIWA 2VQFT 2VQET 3RQWA 4RJWA 4ERRA 5KAIH 3S1KA 1AJ3A 3CMAP 4P0BA 1UX4A 2IAKA 2DW3A 2FUPA 4TZ4C 4N75A 3C50A 4ILUA 2KWHA 1E5WA 3HD7D 5CBNA 1YHQP 4ASWA 2A06G 1H8AA 3H1LJ 2J47A 4H13D 2M6BA 3WI5A 1RF0A 3HD7A 1TU3F 4JYAT 3AE9A 5LCYA 2XE5A 3I0QA 3ZMSB 3RK2D 1LT9A 1B7TA 2GA1A 3UU5A 4OGQD 4LSIA 1ZRTD 3HTKB 1URQD 3TGUE 1ZXGA 2CA5A 1FZAA 2AXTH 4KJMA 2H3RA 4OK0A 4AYCA 3ZYLA 3FWLA 1K9MQ 2ZLYA 3GHGB 1S9KD 3OBVE 1JTHB 5CCHD 1SQQG 2OYIB 3PU3A 3MUDC 1SQQD 2KXPA 1HJBA 3CQXC 1YQ3C 3GHGC 4EYYQ 3C4XA 3CX8B 5C3JA 4IE6A 2LEHA 4HWDA 5C8YE 5CCHA 2E8IA 1A02J 5KLIC 1WR0A 3QC9A 3ZJ2A 2NW8A 2MOZA 1JOCA 4MALA 1VQ8P 4YLHA 1L4AC 3DP7A 3CCLP 3ABVC 3PUSA 2OQQA 2IC9A 2XHEB 3B5MA 3M65A 3TLSA 1T2KD 2AXTO 1JY2O 3K3QC 5H6QB 4YY3T 2ZAEB 1DX7A 2CHNA 1UX5A 1DEBA 2YU1A 3FZLB 2D2CC 3ZPOA 5E79E 4TV9E 1M7LA 1KV4A 5IYUA 1T3UA 1X0TA 4WBOA 3PUZF 4UR9A 2AEFA 2KS1B 1PP9G 5ABFB 2XAQB 3ANWA 3MA9A 2H8PD 3PTRB 2QA4P 1JNZA 2J59M 3GF3A 2R4NA 8PRNA 4HYTB 1NGMB 4Z3TA 2H7VC 4UELA 3RK2C 3CCSP 1SP4A 4NXNT 2RKLA 2ZFCA 3KHUA 3TNUA 4ZZCA 4IT4A 2XTLA 4WNKA 3POXA 4YTPA 4TX5A 1MV8A 4C7NA 4BUMX 3HD7C 2N1TB 1L0NJ 1KEYA 4O49A 1AA0A 3AEAC 2FYUK 4LF7T 3EUHA 1OMIA 3CXHH 3I56P 1EXJA 4DV0T 2WT7A 4EZHA 2IWVA 1D0YA 2F1VA 3M0DC 1EDKA 3BASA 2V5CA 1NKZB 3Q5WA 3IBPA 2O4VA 1IJDB 4UF0A 3EDVA 4U3FJ 5JDLA 2I0MA 2PG8A 2E9XA 2ZXXA 3ZYMA 2L5GB 3NKZA 2X68A 1URQA 3PH0A 1EQ7A 3RKOA 3H32A 2DWGA 2JQ9A 4C46A 5DQWA 2XJ7A 2X0LB 4BWNA 2RN0A 1GL2C 1VPCA 1L0NG 3EFFK 1H0TA 1DD4A 3ZMVB 2E9XD 3PU8A 1KYOI 2KZJA 4I7ZC 1X9VA 4UB6E 2Q7CA 2LSIA 1PGJA 3B71A 4JLEA 3JAEA 4C69X 5KLVJ 4U72A 4JI5T 2QJYC 2JWDA 2HR3A 3AEEC 1P4TA 1GU4A 3PJAA 1U7MA 3IEEA 4O3XB 1JUNA 1KD1Q 1WT6A 3LFMA 3K1SA 3L71D 3B8EB 1FZBA 1NTMD 1FJGT 1QJPA 3FZFB 1VQ7P 2ERVA 2WSEJ 1YQ4A 3PF1A 5APXA 3QB5A 2N9BA 2CEAA 5G26A 1EXIA 4N6JA 1HGVA 4NXMT 5KAIO 1KZUB 2WSCH 3UPGA 3A5TA 3USSA 4AIUA 2R32A 5AW0B 3A8YC 1ZR4A 5TAOA 2NRGA 3WUUA 1FJPA 5B5EO 4JPZB 1KFMA 3FGAD 3CCJP 4A97A 3H1IJ 3Q5EA 3RIFA 4O2AE 1QLED 1J1EB 1ZOYC 3A0BE 1Z0PA 3MXZA 2YK0A 1JNMA 3V4WA 5F8PA 5KLVG 2E5YA 5LHGB 3E7KA 4QMAA 3TGUD 3N9QA 3EMNX 4O3ZA 1HFAA 2E9XC 1DH3A 3AE4C 1H6S1 4D6TE 3ZT7A 4B3TT 2WWWA 1ZHTA 3SYSA 4IL9A 5CCHC 2MKVA 3AE8C 5AQGB 4U3FE 4K0UA 2FXMA 2E2AA 3P50A 4DR6T 4K0KT 1SFCC 5LG4A 3VE2A 3V5BA 3HUSA 3CX5E 2A06D 5EK3A 4RL9A 1IJ6A 3RQUA 2XV5A 2FJBA 4AKGA 2FBWC 1JY2N 4GDOA 4DBQA 2CLYC 4U3FG 5TISH 4V1Av 5B66E 5AQJB 1IC2A 5CCGA 5KLVE 1OEDC 3C4WA 4H63V 3KXDA 5JDGA 4GF4A 1BCCD 3E0ZA 3UFEA 2Y0HA 2XZEA 3CX7B 2R4LA 1P84E 1U57A 4IOIH 5FXZA 2ZJSE 3RX6A 3SFDC 2FYUJ 2W2UA 2W6AA 2OYHC 7PRNA 2HLOA 1LNQA 1S1CX 4GCQA 4BJMA 2VASA 5AVQB 3OAKA 1RE4C 4U7JA 1YITP 1ZKEA 4FQEA 3QK6A 3ZLIA 2PRNA 3AE6C 1NHLA 3CXHD 4C91A 4L5GA 1S4XA 2J58A 3MACA 3AE2C 5CFBA 2YEVC 2OMFA 3M0DA 3L73J 1RQVA 1FAVA 4NUUA 3VE1A 1NAFA 2G8YA 2Y0EA 5LHHB 1FS0E 3WU2H 1OEDB 2OV9A 4ZHQE 2KI7B 4QH1A 2ZVOB 1LP1A 2R8AA 3Q5RA 4TNVA 4EAHA 3O1JA 2E74B 1KFNA 3KVDD 3GN5B 1T2KC 1HCIA 2HG5D 2ITAA 2BEZF 3UU8A 3MJXA 1E2AA 2N1GA 2BS2A 4YSZA 4DZOA 3HKEE 3O0EA 3AECA 3L73D 5LP6E 4C4VB 3AEFA 1G2CB 2RMZA 3TF5A 2YU2A 3Q5SA 2B76A 1FOSF 1KF6A 3GMIA 1NTMG 3B5NC 4IDQA 5EZYE 4EEDA 3IN6A 1VQKP 4EV6A 2MJZA 3EDUA 2LSKA 3D0TA 4IIJE 3PHLA 4NPFX 2H88A 5AVTB 2FYZA 3I9WA 3TNUB 2ZLDA 2KXPB 1GQEA 4LSHA 2FJAA 2XNXA 3N9NA 2W0GA 3KBTA 1FZEA 2LKGA 4OFZA 3D71A 1AQTA 3GW6A 2WTYA 2V6XA 1R5SA 2OYHA 3VZUX 2HPCA 2WPVB 5GTHH 2JQHA 2GM4A 3ZT5A 2RA1A 5AW2B 3RRCA 3P7KA 4IL4A 5LJMA 2OGUA 3RBXA 1OFCX 3AEAA 3NJTA 4C4VA 3BCCG 3B57A 3L70J 1YYCA 5AVXB 2IHR1 1MPFA 1KB9H 1M8OB 3L8RA 3T97A 2QEXP 1S3JA 3QH9A 1NTKG 2BG9E 2K9JA 4QX8B 3AA6A 4DR5T 1ZEEA 3AE5A 1IFJA 2E75C 3BRVB 1YTZI 4GKKT 4AQFA 1NU1G 2HYNA 3ZEFB 2VL0A 2QM7A 2H7OA 4ZS2A 2XG6A 1NVOA 2YKQA 1PP9E 3GHGA 3CCQP 1IFIA 2WDVA 1QVFO 1VDFA 3OPCA 2IBZG 5T5FA 2WMMA 1QJ8A 2R3CA 1IK9A 2XQYA 3HUSC 2BZBA 3H1ID 4GOEA 3VR9A 1Q9GA 2NWBA 4L9IA 4WBNE 2IIUA 2CBIA 3CMLA 2CK3H 2CPTA 2X51A 2P1JA 3PUVF 4O3YA 1KORA 2QM8A 1BGYE 2JWAA 5L47A 4H0LC 5EFWB 4GKJT 3KV5A 3FXDA 3CWBD 3V8UA 1VF5D 4LMLA 2PRRA 3ZN1B 1KILA 2W66A 5B5EE 3I5CA 3RYFE 2WAUA 5HCMA 1NEKA 3FXDB 3N4XA 5H2FE 2OA5A 4FT6A 1CHUA 1KILB 4IE0A 5LJNA 2W80C 2A45G 3TGUG 3KV4A 4K3CA 2XQ3A 2WITA 3RGLA 2WJRA 5GTIE 4AKIA 4YTPC 1LTJA 1RE4A 4OYJA 3P4QA 1WLXA 1SQXD 3HE4A 4EOZB 3H6PA 2Q3EA 1IFNA 2X0YA 3K19A 4U2ZA 3L36A 3PUXF 1KB9I 5AQIB 3PGSA 4LSFA 3L71E 3WUTA 2SPZA 3RL0D 4AUWA 3PTZA 4Z8XA 2UUBT 3W68A 3LSVA 3GA8A 3C9IA 4GT1A 4Y99C 2CXDA 1SQPE 1JO5A 4U3FD 2W62A 3TLVA 4O4LE 5HAXA 3SRZA 5KMGP 1M56D 2XQ6A 4X66T 3M91A 3AE4A 3F89A 2M3EA 5AW7B 4FRXA 5JDPA 4ANJA 1N34T 3AXJB 1XDPA 1MNDA 2LHFA 4HWFA 2QTKA 3KV9A 1OW7A 4ZI2D 1HG2A 1V9DA 2XTQA 2V5DA 4QH5A 1SHZC 4O8SA 2FYUD 1IZNB 1SQVD 2FJDA 1AVOA 2UUAT 4LC1A 5KLIB 1A02F 3N9PA 5KX5E 1P84D 4UVBB 4AZLA 3L74G 1VQ5P 1Q81Q 1G90A 5DL8A 2KNCA 2K9JB 2LM9A 1GFQA 1BE3E 3N2GE 1SQXE 3WAKA 4WWIA 3N9LA 4OGQB 1E7PA 2XQ5A 4ZS3A 4JCHA 1H7CA 1WR6A 1GL2D 1QEXA 3AVSA 1HX1B 4AYMC 1S5LX 4W80A 1BGYJ 3PRNA 1HNZT 3RF1A 4ILAA 1LRZA 3L74E 1XNQT 1AJYA 3RGUA 1N7SD 3KZIE 4OVNF 1FDIA 3BVHA 1P84I 1SLQA 2X9WA 4PD4H 4EIWA 4E1TA 5LNKA 3HOEA 5FY7A 4DT0A 2C9NY 4IL6E 1THQA 3U1CA 2WB5A 1T8BA 2WZ7A 1N33T 2WS3A 4CN4A 3AA7B 1Y47A 1CZQA 3IHRA 1FE6A 4KX6A 3V2PA 4ASVA 2Q1KA 5GTHO 2I1KA 4IDPA 4HJGH 2ZT9C 1KFYA 4XAXB 5AFUK 1W5CE 2E9XB 3LIEA 1OPFA 3TLUA 3FHNA 1SQPG 5HEUA 4RLCA 5L4HA 3POQA 1LVFA 1XZYA 4XNLA 1S5LE 3A0BO 1LTTC 2WZHA 1EZ3A 1LWUB 4DR4T 1SQBJ 4RO0A 1NAYA 3H1JE 2N2NA 1T3JA 3HL6A 2YIUC 1GK4A 2C9LY 4UXNB 1HVVA 4X5TA 2QJKC 2W27A 5ABEA 2IFNA 4BRYB 2OTJP 2K9AA 4M3LA 1Y64B 3JCUE 3LK2A 3L75J 5AQUB 2VKOA 1FOSE 2CCQA 3UUXB 1FC2C 4GOFA 3AE1A 5LHIB 2MNHA 2E74C 3AA7A 1ZMEC 2LJLA 4I55E 1IBLT 3N2OA 2ES0A 4IREA 5HXSA 3M0AA 4U7IA 2NP9A 1PGPA 4NPEA 5ABHA 4TNWA 2XAHB 2O3JA 2IDOB 4DV4T 2BKPA 3K3NA 4H13B 4JV5T 3P7IA 3NZPA 4LF8T 4JI0T 3EAMA 1BGYG 3ZDMA 5E79O 1DU2A 3U3IA 3F31A 1W2EA 3DA4A 1LWUA 1SQXJ 3C8VA 5CCGC 4HGAA 1YJ9P 1QSDA 3X1DA 4X1YE 2Y7SA 3RBZA 2M3BA 4ISTA 4EDFA 3A2AA 1PGOA 1NTKK 2WSEH 2KINB 3A3YB 1IZNA 3RIUC 2LHRA 4XBFB 5CJ0A 2WQYC 2J1NA 2O1JA 2BS4A 2IBZE 3T0SA 2NPSB 3W15B 3C98B 2XPKA 4HE8A 4YPCA 2FYNC 1R8EA 1HWTC 2BBJA 1R5LA 1ZHWA 4KHXA 2WWUA 4O4HE 3ZCJA 2IZ1A 1KK7A 4KT0J 1GFMA 4ZEYA 1RH5B 4HKZH 1T16A 2BCCG 1EDIA 3RK3B 2KP8A 3P4WA 3A0HO 3DJBA 1RHZB 3PLNA 2R89A 5CJ4A 1NTKE 2N1TA 4EZ4A 1NTZJ 2X66A 3ZC0A 1X79A 3J9X1 4D6TD 3HKCE 3WU2E 3TLTA 5BR8T 2BASA 3TK1A 3FXEA 1HTLC 3H1IE 1SQBE 3RK3E 2Y2XA 1OWAA 2EHOB 2NPSD 4ZI3D 2YDRA 2O01J 1SUMB 1KILD 1Z8UA 2NW7A 2W67A 2XAFB 4N3YB 5M1BA 3L72D 1G1JA 1BGYD 2DLRA 3LK41 4AYEC 2WSSH 1WFDA 2KZIA 3TGUJ 1LKXA 2BVMA 3RK2B 2JJ9A 4Z91A 2A72A 2KIKA 2AE9A 2WWVA 4AQRD 1LWUC 3CPZA 4EIJA 3AAEB 4JI4T 4O3WA 1KC8Q 1W2BO 4JFBA 2KSEA 1M1KQ 1SQVJ 3L70G 3PORA 1PV3A 1D1CA 4PK6A 2IYOA 3T1YT 2HFED 1XWMA 5HEOA 5LG3A 1Y9BA 5AQFB 3VP8A 3SWFA 2HPLA 1JTHA 3O6QA 1U4QA 1ZHZA 5AFUL 1ZW0A 1RF0C 2OYOA 4QH4A 3B13A 1PPJD 3LJCA 4YHJA 1LP1B 1OVUA 4LGDE 3V6IA 1D1BA 3KVAA 2W00A 3O6QB 2IPPA 3G6EP 3ZKRA 1ZV8A 1JB0J 3UULA 3KDSE 5APTA 3RPUA 5AQPB 3IF8B 1VF5B 2E76D 3UU6A 4ZI2C 1KB9E 1HX8A 3SWHA 3CCRP 1YIJP 1JY3O 3RK3C 2UU9T 3QRCA 4HFHA 1NTMJ 2JIWA 3M3ZB 3EQ2A 1BR1A 3NXSA 2VB6A 4A5XA 4JI6T 3IF4A 2O01H 3L4FA 3UQ7A 1YW0A 1WRDA 1S35A 2M67A 3DTOA 4KHPT 1KNRA 3L73E 3AEDA 1BH3A 2ZMAA 3HKDE 1N2DC 4DOJA 3VZWX 4IL6X 1W0AA 4GK0E 4FZMA 2XKMA 3LW5H 2ZYGA 2MHLA 2VKHA 2Y0KA 4A7PA 4DMVA 2XU6A 2XUEA 5FVKA 1GFOA 3CC2P 1GZLA 3AEEA 3L73G 2YDSA 2LKMA 1HH0A 3CQCB 1FJKA 1XMOT 3CVRA 4GKGA 1JY3P 4MHCA 1LTSC 3H3AA 4Y99B 1HXUA 4ILCA 4QX7B 2XSAA 2D5UA 2JP3A 3RYIE 2IWWA 3CIRA 1IK7A 2UWJE 1T1LA 4WBAA 4WYVA 4OGQC 2KS1A 4L73A 4NIQA 4YXDC 5H2FO 3CCEP 4O4XA 5H2FH 1OX3A 3T8OA 4TN7B 3T24A 5KJ7A 1GD2E 4IDZA 4PFOA 4AQGA 2ODVA 3HI2A 4LMKA 2Q9IA 3CXHI 1ZHYA 5FY1A 4I50E 4UB8E 1N73A 1WMKA 2W63A 3K8PC 3MK7C 1FMWA 4D6TG 1GTWA 2XAJB 1LTJC 5KAFE 1SFCB 2WVRA 3OTOT 4LFBT 2HN1A 4DR1T 2AEJA 4GK5E 3TDKA 4XZCA 2K48A 5JRCA 2N1TC 3Q5XA 3WI4A 3VHLA 1BR2A 1OW6A 1PP9D 3L39A 1AQ5A 5JTGA 5JDMA 1OVRA 1L0LD 2WT7B 2XQ9A 1USEA 3VZTX 1WYCA 2X0HA 2GUSA 3H1HD 3UTKA 3PUGA 4IFFA 3V2NA 3AE8A 3H1HG 1HUCA 2JJLA 2UXXB 2UXNB 3P8MC 1FIOA 2BKOA 1PFIA 1HF9A 1NWMX 2Q9QD 4P1NA 3JC6C 2ZM8A 4TWFA 1I6ZA 4PV1D 3HE5A 1L4AA 3Q1MA 1YI2P 4U74A 4M1PA 2IX7C 2PBIA 4L0RA 1PL5A 3VN0A 3M06A 2IBZD 2IC6A 3CWBE 1N86A 1BDDA 1U7JA 3EABA 2O01N 1OIPA 3VMAA 4L74A 3SFEA 5JVDE 1SQBG 3H1IG 5J2TE 2XQAA 3R6NA 2B88A 3VU7H 2H7HA 3RL0g 3U1AA 2AEMA 1QLBA 4CI1B 4B86A 3PGUA 3KYQA 2CXLA 2KLVA 2DNXA 4H9QC 2QGSA 2B87B 1KTMA 2KNDA 3QOFA 4MN4C 4BRYA 1Z56A 2XQ8A 2P58A 3AE7C 4I7ZB 1N73C 2IBZI 4KUMB 3ZCIA 3CK6A 4DR2T 5IUXA 2ZVNB 3VY8X 2BKNA 3O1IA 1RY3A 5JDFA 2MTQA 5FXVA 3NTNA 4R4LA 3PQUA 5L3BB 3RK3D 3E1RA 4YXWH 3H25A 3LG7A 3PDYA 2WPSA 1J5WA 5B66O 4ZOLE 3TYYA 3AB3B 4TT3H 3ONJA 4H0LD 4TUYE 3BRTB 2NPSA 3RC8A 1S5LO 1XTGB 2CE7A 4F6RC 1S5LH 2GE4A 2W8ZA 3C1LA 3VMYA 5DABA 4WY4D 3I0OA 3UUMA 1QL1A 2UXDT 1MIWA 4FZNA 2N9YB 3CMEP 2BVLA 3MD0A 3E22E 2XSBA 2FYUE 1EZVG 4K35A 1W9RA 2WSCJ 2V7IA 2K3RA 1SFCA 1BCCE 3I55P 1HR0T 2PAJA 2YXQB 4ZKUA 4N78D 1NTZK 1UGOA 1IFDA 4C90A 2F4VT 2KZ7A 3KQGA 4EXTA 2XE2A 2WM9A 3HW9A 3PJAJ 4PJ0E 3CPWO 2WP9A 3VRBA 4JI3T 2OYIA 3L74D 1Y01A 3P8CD 2XE1A 1UCUA 1VQLP 3G4SP 5CJ5A 2IMLA 4DJGA 3FZHB 2K37A
chains in the Genus database with same CATH topology
5KMGP 3LBXA 5LGTB 4ERRA 4RJWA 3BQIA 3K3OA 5EK4A 4AYID 1AJ3A 3NRYA 4P0BA 4FRXA 5J1GA 5JDPA 1PRNA 1UX4A 4ANJA 4KP3C 2IAKA 3DA3A 4RJXA 1MNDA 2Y6XA 2LHFA 2KT9A 4TZ4C 2QTKA 3KV9A 3C50A 4ILUA 2EHOC 2KWHA 4ZI2D 1HG2A 1V9DA 5L2LA 3WI3A 2XTQA 2PJQA 4QKNA 3WI5A 3O1HA 1SHZC 4UEMA 2QA7A 4O8SA 4D65A 1IZNB 5A1LA 4H63H 5KX5E 3N9PA 5LCYA 2XE5A 3I0QA 4UVBB 4AZLA 1G90A 3ZMSB 5DL8A 1B7TA 2C5IT 2JMKA 2LM9A 4LSIA 4XNKA 3AAIA 4X20E 5L3EB 1GFQA 3N2GE 3OYXA 3WAKA 2CA5A 4OK0A 2H3RA 4UV9B 4O4JE 1VRBA 3ZYLA 5JQGE 4LSEA 3N9LA 5GONE 2ZLYA 4ZS3A 3OBVE 4JCHA 1H7CA 1WR6A 3EVYA 3AVSA 3PU3A 4OYKA 2Y8DA 4AYMC 2D2SA 2KXPA 3PRNA 2PFVA 3CQXC 3LBXB 1LRZA 4YJ3E 3C4XA 4H9SE 3CX8B 4P0AA 4IE6A 2IW5B 2LEHA 3PUQA 3AA0A 2LFUA 5JRCB 5KDMC 5C8YE 2ODJA 2E8IA 2X9WA 3Q2MA 3QC9A 4EIWA 4E1TA 5H6RB 3ZJ2A 5LNKA 2NW8A 1MMNA 3HOEA 2MOZA 3V5SA 5FY7A 4PUXA 4MALA 4YLHA 1THQA 3DP7A 4O2BE 3ZJ1A 4I4TE 5FNVE 2Q9QB 3PUSA 1HTJF 2IC9A 2XHEB 3AA7B 3AVRA 3ESLA 3M65A 5DJQC 3IHRA 5JR9B 4UF0B 5HXCA 3K3QC 2WMOA 5H6QB 5JH7E 2DWKA 2X9YA 4J2CA 3F2EA 3O4XE 4H9NC 4E7SA 2YU1A 1UX5A 4DNDA 1O3XA 4XAXB 3ZPOA 2VKDA 5AFUK 2E9XB 1OPFA 4TV9E 3MZKB 5JR9A 3FHNA 2I59A 4RLCA 5FY0A 4FSOA 5IYUA 4WBOA 4ZI3C 1LVFA 3POQA 5HWYA 3ZMTB 2C0SA 1BR0A 4XNLA 2DI4A 1G8XA 2XAQB 3ANWA 3MA9A 3PTRB 4PJNA 3N2KE 1EZ3A 3AA1A 5LBMA 4N58A 4OHFA 3OKQA 8PRNA 4KR8A 3UUNA 2N2NA 3HL6A 4Z3TA 2H7VC 4UELA 4UVAB 3SOLA 5CB4E 2V7MA 4UXNB 5LXTE 4HFVA 4CXYA 2WBLA 3ONXA 2K9AA 2XTLA 5DQVA 1Y64B 2DCFA 4WNKA 4U9CA 1HF8A 1MIYA 2W81C 3POXA 6PRNA 4TX5A 3GWHA 4H9PC 1G73A 2XMXA 3LK2A 4BUMX 2VKOA 3NBXX 1ZHXA 3FYXA 2CCQA 3UUXB 4O49A 4AKHA 2Q9QA 4X1KE 5LHIB 3SYBA 2MNHA 4MFRA 3AA7A 2LJLA 4I55E 5E0OA 3EUHA 2ES0A 3N2OA 5HXSA 2NTYA 2V7JA 2NP9A 3RBHA 5L3DB 2PORA 4KRAA 4AFKA 5J2UE 2XAHB 3KV6A 4PAGA 5LOVE 4EZHA 5BMVE 3PQSA 4QWNB 3K3NA 5JDHA 1D0YA 2FGRA 1QUUA 4HKAA 4PNIA 4FJOA 3N9OA 4HTEA 1ORMA 2F1VA 3P7IA 2X27X 4FZLA 4RLBA 3NZPA 3Q5WA 3IBPA 2RP4A 3U3IA 3F31A 1BT9A 2O4VA 3DA4A 2YINA 1MMDA 1GFPA 3SS1A 4UF0A 4HGAA 3EDVA 4EYUA 1QSDA 4X1YE 5JDLA 5ADXK 2Y7SA 4ISTA 2L3LA 2PG8A 3AA6B 2E9XA 2KINB 2EHOA 1IZNA 1IJ5A 3ZYMA 3WAJA 2LHRA 4XBFB 2X68A 2J1NA 2N9DA 2WSSV 3RKOA 3PE0A 2XASB 3PURA 4GIWA 3T0SA 4CZZB 2DWGA 2F1TA 3W15B 2W61A 5DQWA 3C98B 4HE8A 2J1DG 2X0LB 1MMAA 5HXHA 4A56A 2CMRA 3UT5E 2X9XA 1ZHWA 3VY9X 2WWUA 4O4HE 2E9XD 3ZMVB 2GK9A 3PU8A 3I1AA 3ZCJA 2LSJA 3ETVA 1KK7A 4IE4A 5JR9C 1GFMA 2LSIA 4JLEA 4C69X 3DJBA 3F57A 4AKMA 4KMCA 1MM4A 4U72A 4G76A 2CLYB 1CUNA 4EZ4A 4B61A 1P4TA 2K4TA 2X66A 3ZC0A 2B1EA 2Z6EA 1X79A 4IE7A 2M07A 3IEEA 3J9X1 1GFNA 2N2MA 4O3XB 2ACXA 3HKCE 3CQGB 4H9OC 3ZC1A 5HXEA 1QJ9A 1Q9FA 4QXBB 2JMMA 5DL5A 3LFMA 5HXRA 4AYDC 1QJPA 4ADZA 2ERVA 4QXCB 2VK9A 4GYSA 2N2LA 3RYCE 3NSGA 2Y2XA 1OWAA 2EHOB 4ZI3D 2CEAA 5G26A 3UU2A 2NW7A 2XAFB 4PW8A 2G0UA 3UPGA 5FXWA 4MLKA 2DLRA 3LK41 4KR4A 4AYEC 5TAOA 4I43B 4ASKA 2KMFA 4BAYB 4AUIA 1LKXA 2BVMA 4PK4A 4AYNA 2JJ9A 4FSPA 1YS5A 2ZM0A 2A72A 4O2AE 1Z0PA 3MXZA 3CPZA 2C5KT 3AAEB 3HOLA 2YK0A 4GHBA 3L09A 4O3WA 1ZHCA 4JFBA 5F8PA 3C5OA 3PORA 5LHGB 3N9QA 3EMNX 4O3ZA 1HFAA 2E9XC 2KLQA 4O4IE 1D1CA 3QUJA 4UV8B 4DVDA 2JQQA 1PHOA 1H6S1 2J4UP 4PK6A 4WW0A 3SYSA 1ZHTA 1LVKA 3Q9DA 3U78A 4K0UA 1S94A 1VOMA 2ZFGA 5PRNA 3JC6D 2HPLA 1U4QA 1YKEB 2L9QA 2Q9QC 5AFUL 5LG4A 1ZHZA 3VE2A 2L8KA 4PJLA 2X9HA 5CA0E 2V26A 3B13A 2CWYA 5L3FB 4X1IE 3LJCA 3C51A 4YHJA 5D5DA 4B6XA 3KVAA 1HXXA 1D1BA 2W00A 5EK3A 2D0UA 4QHOA 4RL9A 3SZDA 1IJ6A 3UULA 3RRWA 3KDSE 5L3CB 1HG5A 4AKGA 3RPUA 5DL7A 4DBQA 2CLYC 3IF8B 4QXHB 2NTXA 3CKDA 4ZI2C 1HX8A 3SWHA 3QRCA 4CXXA 4V1Av 1BR1A 2V7KA 2VB6A 2WMNA 4MBQA 4D5UA 4ZI7E 3C4WA 4H63V 1MMGA 2NW9A 5JDGA 5FMNA 2FGQX 3CX6B 4CXWA 3VKGA 4GF4A 3SY9A 1YW0A 3E0ZA 1WRDA 3UFEA 1S35A 2D0TA 2M67A 3CX7B 3DTOA 4PJMA 4G2AA 2Y0HA 3JTYA 3FBZA 5FXZA 2KDYA 4HN9A 1BH3A 3RX6A 2ZMAA 3HKDE 4AXPA 1OXZA 3AAEA 3BK9A 5L3GB 2NOXA 3VZWX 7PRNA 4GK0E 4GCPA 3V5UA 4FZMA 4GCQA 4BJMA 2ODUA 2VASA 5CA1E 2MHLA 1WYBA 2VKHA 4AKRB 2Y0KA 4ISSA 1ZKEA 4DMVA 3QK6A 2LHNA 3HKBE 1MM5A 3ZLIA 2K5BB 2XUEA 2K0LA 2PRNA 4C91A 4L5GA 3MACA 1ZV4X 1GFOA 3AAAA 2YEVC 5ADXL 2V7LA 1BR4A 2OMFA 4PK5A 4FOZA 3CQCB 3FXEB 1US7B 4NUUA 3VE1A 1NAFA 3CVRA 3GN5A 4MHCA 5LHHB 3H3AA 3TKLB 4ZHQE 1HXUA 2A2FX 4QX7B 4YJ2E 2D5UA 3RYIE 4EAHA 3C64A 3O1JA 1YKHB 1FMVA 3GN5B 3KVDD 1HCIA 1HS7A 4UIGA 1MIVA 3HR0A 3LK42 2LSGA 4O4XA 1SA0E 3MJXA 3T8OA 5ETWA 4TN7B 3T24A 4G75A 2C5JA 2HH7A 2N1GA 3E08A 4BA9A 4IDZA 4PFOA 2K24A 4AQGA 2ODVA 3HI2A 4EYYR 3HKEE 1ZHYA 5FY1A 3ZYKA 3O0EA 5IHYA 4I50E 1E54A 3I9YA 1T98A 1D0ZA 2W63A 3K8PC 3MK7C 5LP6E 1FMWA 3FB2A 3KINB 1OSMA 2XAJB 2ZM2A 3ZN0B 2DHRA 2YU2A 4TV8E 4FESA 3G7GA 4GK5E 5FYMA 3ZMUB 4EB6E 3GMIA 4XZCA 3KBUA 5LBQB 5EZYE 2K48A 4IHJE 5JREA 5JRCA 2VWAA 3TZGA 3SY7A 3EDUA 2LSKA 4GYRA 3D0TA 3GP6A 4IGUA 4IIJE 5GV0A 3Q5XA 3WI4A 3VHLA 2YNKA 2KZ7B 3J7Yq 1BR2A 3VKHA 4N59A 4FMSA 3I9WA 2ZLDA 2KXPB 4BJNA 4LSHA 5JDMA 1YD8G 2X67A 4GCSA 5HYAA 1WYCA 3VZTX 3R84B 2LOSA 5EE2A 3N9NA 2W0GA 3KBTA 4HEAA 3UTKA 3PUGA 4FRTA 4OFZA 4DBRA 2UXNB 2UXXB 1FIOA 4G63A 1KNZA 5LGUB 3VZUX 1NWMX 2EHOD 2JMHA 2Q9QD 5FP3A 3A2SX 2RA1A 3QRAA 3JC6C 2ZM8A 4JEUB 2MBGA 3BQKA 4AI6A 3RRCA 4DO0A 4P09A 4E7ZA 4U74A 2JPFA 5IYZE 4M1PA 4DMWA 2PBIA 5LJMA 2SPCA 4YFSA 3B57A 1MNEA 4L0RA 5JDQA 3ETUA 3L3PA 3RYHE 3CWZB 5F3JA 1MPFA 2LSYA 3OJAA 2IC6A 2KWIB 3HA4A 2XTRA 2JRKA 2MYSA 3FBLA 5JVDE 4CI2B 4QQ1A 4E1SA 1FEWA 5J2TE 4D64A 2P9BA 4QX8B 3R6NA 3AA6A 3AA1B 3VU7H 1ZEEA 3SZVA 5JDNA 4CQIA 4PJJA 4AQFA 4CI1B 3ZEFB 2CXFA 2H7OA 2DNXA 2CXLA 4H9QC 4ZS2A 2XG6A 2QGSA 2KNDA 4JEHB 3NRXA 3H37A 3HWBA 4FI5A 1D1AA 2V1DB 4JUYA 5M4YA 4AKRA 4KBMB 3O9XA 4KUMB 3ZCIA 5T5FA 1QJ8A 4FUVA 4AKLA 2VL8A 3VY8X 2LT3A 3AAAB 2XQYA 3C4ZA 3O1IA 5JDFA 2MTQA 5FXVA 3PQUA 2BZBA 5L3BB 3NZQA 5EK2A 1Q9GA 5FXXA 2Y0LA 3A5XA 3UAQA 2NWBA 3LG7A 4NUVA 4L9IA 4PFPA 3PDYA 4WBNE 3CMLA 2X51A 4ZOLE 2LOPA 4F4BA 1HXTA 4O3YA 3AB3B 2CWOA 3N5LA 2HPJA 4TUYE 3S4UA 3KV5A 2XE3A 5LYJE 3V8UA 2CM0A 3ZMZB 3OYZA 3RC8A 2CE7A 4F6RC 3ZN1B 3LK3A 2A3DA 2GE4A 3RC3A 5DABA 2XAGB 3I0OA 3UUMA 3RYFE 5DL6A 4UVCB 2WAUA 1MIWA 3FXDB 4FZNA 2BVLA 2OA5A 4FT6A 1U5PA 3E22E 3ANWB 3LK3B 4IE0A 5LJNA 2W80C 5HWXA 3KV4A 2LE8A 4CI3B 4H9RC 3MKDA 4IE5A 2YPVA 3T20A 2V7IA 4AKIA 4GOUA 2Y48B 4O4UA 3RH3A 2KC0A 4N78D 4OYJA 1BXWA 1WLXA 4C90A 5FVNA 3LK2B 4EOZB 3N9MA 2KZ7A 1E1HB 4EXTA 3K19A 2XE2A 2BDEA 2WM9A 3AA0B 3PUAA 3HW9A 1IAPA 4LSFA 5LGNB 4Z8XA 3KVBA 3GA8A 1D0XA 5LA6E 3BQLA 2CXDA 3KFWX 2VKJA 4AQFC 3P8CD 2XE1A 1UCUA 2M06A 2W62A 3POUA 4O4LE 5HAXA 3SRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE B;  3AA7 B;  3AAE A;  3LK2 B;  3LK4 2;  2KZ7 A;  3LK2 A;  2KXP A;  2KZ7 B;  5AFU K;  3LK3 A;  4AKR B;  5ADX K;  3LK4 1;  4AKR A;  3AA0 B;  2KXP B;  3AA6 B;  3AA7 A;  1IZN B;  3AA0 A;  1IZN A;  3AAA B;  3AAA A;  3LK3 B;  3AA1 A;  5AFU L;  5ADX L;  3AA6 A;  3AA1 B; 
#chains in the Genus database with same CATH topology
 3H1J G;  1GMJ A;  2R88 A;  1QVG O;  3K3O A;  4HFI A;  5EK4 A;  2D2C B;  2XQ7 A;  3NRY A;  4XFJ A;  2P10 A;  4RJX A;  1BE3 J;  2Y6X A;  1Y8A A;  2R3S A;  1GU5 A;  3QWO C;  1G1I A;  2EHO C;  1J1J A;  5L2L A;  3L72 J;  4U3C A;  5AQK B;  3WI3 A;  1XMQ T;  1SQX K;  3O1H A;  4UEM A;  2QA7 A;  1LT1 A;  5A1L A;  1NEN A;  2L91 A;  1KYO H;  1URQ B;  1BE3 D;  3L74 J;  1IBK T;  1M1J C;  4IDO A;  4XA4 A;  1Q2N A;  4X20 E;  2I1J A;  4I0U A;  4B3S T;  1SQQ E;  2PGD A;  5JQG E;  4O4J E;  3A0H E;  1VRB A;  5GON E;  1ZOY A;  3D70 A;  3EVY A;  2XM1 A;  3V4Q A;  4OYK A;  1LTI C;  2Y8D A;  2D2S A;  5AVU B;  1N7S A;  4PJ0 O;  4YJ3 E;  4H9S E;  3NMD A;  4X64 T;  4B3R T;  3AA0 A;  3PUQ A;  1UUR A;  2LFU A;  2WSF J;  2A06 E;  3R2P A;  4BXL A;  2VVS A;  5H6R B;  2LXC B;  5KAI E;  2JQY A;  3CCU P;  1MMN A;  4PUX A;  3V5S A;  3LW5 J;  2D9D A;  3A7M A;  3ZJ1 A;  4I4T E;  5LMU T;  3CLQ A;  1GW3 A;  4Y28 J;  3AVR A;  3RKG A;  3PV0 F;  2Y9Z A;  2V4H A;  5HXC A;  2WMO A;  1BDC A;  5JH7 E;  2DWK A;  4J2C A;  4E7S A;  4WB4 A;  1LT9 B;  2WY2 A;  4DND A;  3DZM A;  3DWO X;  5KLV D;  2QG4 A;  1O3X A;  2VKD A;  2WJQ A;  4JI8 T;  3G9R A;  1HNW T;  5FY0 A;  4FSO A;  1NU1 J;  5HWY A;  3ZMT B;  1BR0 A;  4PJN A;  2ACZ A;  3N2K E;  4PV1 C;  2E43 A;  4RKU J;  2CBJ A;  4OHF A;  4HFC A;  2AXT E;  4JBZ A;  2Z5I A;  2P2U A;  2ZYD A;  1JCC A;  3UUN A;  2LRK A;  2PP6 A;  4DUY T;  4UVA B;  3GG2 A;  1PIX A;  2B9B A;  2V7M A;  2H89 C;  5K5G B;  3CCV P;  3V2Q A;  2LM2 A;  4HFV A;  4CXY A;  3ONX A;  3AE7 A;  5KJ7 C;  3L71 G;  5DQV A;  3MTU E;  3UU3 A;  2HHH T;  1HF8 A;  1MIY A;  2W81 C;  4U9C A;  6PRN A;  3GWH A;  4H9P C;  3SFD A;  1ZHX A;  2R5B A;  3NBX X;  3FYX A;  3II6 A;  3KZI O;  2F1C X;  3KZI H;  3SYB A;  4AKH A;  4X1K E;  2YN6 A;  4PD4 E;  4MFR A;  1N7L A;  2R6G F;  5E0O A;  4C7N B;  4U2Y A;  1LTB C;  3L35 A;  2V7J A;  3CX5 H;  4DCK A;  4LFA T;  5L3D B;  2POR A;  1JY3 N;  4AFK A;  4YSX A;  3DWN A;  3PQS A;  3AE2 A;  1KQF B;  2FGR A;  1QUU A;  1NWQ A;  4PNI A;  4FJO A;  3N9O A;  4RLB A;  2X27 X;  5AQQ B;  2BEQ D;  1NOH A;  2R5D A;  2RP4 A;  4DV7 T;  4NPD A;  3OJA B;  4AIS A;  5B66 H;  4H44 C;  1MMD A;  3SS1 A;  4EYU A;  1SQB D;  1OVV A;  3R4Y A;  4L75 A;  1L4A B;  2J62 A;  2L3L A;  3AA6 B;  2K88 A;  2QRX A;  5AW8 B;  1IJ5 A;  2W6B A;  2N9D A;  2WSS V;  2MPK A;  2WZI A;  3H1H J;  3PE0 A;  2YO3 A;  3PUR A;  4GIW A;  4CZZ B;  1LJ2 A;  1XDO A;  3BRY A;  3RIA A;  4A56 A;  3H1L G;  4KI0 F;  3VY9 X;  4YTN A;  2WDR A;  3A0B H;  2WSF H;  3ETV A;  2Y0C A;  4OX9 T;  1JCD A;  4LFC T;  3SFE C;  4KMC A;  1MM4 A;  1RE3 C;  2JKV A;  1CUN A;  2K4T A;  2B1E A;  1T8Z A;  4IE7 A;  2M07 A;  1BSN A;  3O8Z A;  5AW4 B;  2NR4 A;  2ACX A;  3GMA A;  4H9O C;  4D6T J;  5HXE A;  3MGN A;  1HNX T;  1Q9F A;  1NU1 K;  4QXB B;  2JMM A;  5DL5 A;  5HXR A;  3MHV A;  4UB6 O;  1OED A;  4QXC B;  2VK9 A;  3NSG A;  1SQP D;  1BCC G;  4DID B;  3UU2 A;  3WMM 0;  3D6Z A;  2G0U A;  2BG9 A;  1X22 A;  2W6J H;  4MLK A;  4KR4 A;  2FYU G;  2HN2 A;  4I43 B;  1M57 D;  1H0T B;  4ASK A;  1KB9 D;  1OZH A;  2GUV A;  1ZR2 A;  2KMF A;  5E79 H;  4BAY B;  4AUI A;  1RF1 A;  1QL2 A;  4AYN A;  4FSP A;  1YS5 A;  3AE6 A;  4XE5 B;  4KHZ F;  5IWA T;  3H1K J;  3IFM A;  3M9H A;  1T7S A;  3C5O A;  1UIX A;  1YQ3 A;  2KLQ A;  4O4I E;  4UV8 B;  2J4U P;  2JQQ A;  2XDJ A;  2FFD B;  2IYP A;  3CC4 P;  5HCJ A;  5AVR B;  3JC6 D;  1NTM E;  1GDT A;  5AW9 B;  1YKE B;  2Q9Q C;  2PFX A;  2ZXE B;  1L0L K;  2L8K A;  4ILB A;  5CA0 E;  2V26 A;  2CWY A;  1XNR T;  3WUV A;  2ZM6 T;  1HJ0 A;  4B6X A;  1HXX A;  2D0U A;  4QHO A;  5KKZ B;  3ONL C;  1HG5 A;  1X9B A;  4QXH B;  5HEJ A;  2NTX A;  1NYH A;  2QJK B;  5AW6 B;  4ZXL A;  3H3M A;  4WZX A;  1QGK B;  4CXX A;  4DV5 T;  2OYI C;  2JR8 A;  1VQ6 P;  3H1J J;  4JF7 A;  3FZM B;  4JYB A;  1YBK A;  4ZI7 E;  4A98 A;  1KIL C;  2MAW A;  1EZV D;  2FYN B;  3SWK A;  5FMN A;  2NW9 A;  4PR7 A;  3CX6 B;  4CXW A;  3VKG A;  1NJI Q;  3SY9 A;  3H32 B;  2BBH A;  2ZT9 B;  2KDY A;  1XTC C;  4AXP A;  3AAE A;  1ZRT E;  3BK9 A;  2NOX A;  3Q5P A;  3V5U A;  2ODU A;  2Q6Q A;  2E5V A;  4COF A;  4AKR B;  1SQV G;  4UB6 H;  1RF1 C;  4HB1 A;  2E75 B;  1KQL A;  2OLT A;  5CGM A;  2LHN A;  3HKB E;  1MM5 A;  2K5B B;  2KK7 A;  4X65 T;  4OH8 B;  3AAA A;  1SS1 A;  3CX5 D;  5L4E A;  5ADX L;  4ZNC A;  1BR4 A;  2V7L A;  4PK5 A;  3AEG A;  3FXE B;  1K05 A;  2QE7 H;  5AW5 B;  2YO2 A;  3GN5 A;  1UK5 A;  3TKL B;  3MUD A;  4NPP A;  2D2C D;  2KOG A;  1USD A;  2BS3 A;  5KXJ A;  3VMZ A;  5TIS E;  3VMX A;  1YKH B;  5L8R J;  2R4O A;  4UIG A;  1MIV A;  4DV6 T;  1SA0 E;  5ETW A;  3HTK A;  4G75 A;  2C5J A;  2HH7 A;  4U33 A;  4BA9 A;  2J5U A;  1IO4 A;  2WU2 A;  4EYY R;  5AW3 B;  1VQM P;  3I9Y A;  1T98 A;  4CN6 A;  2A45 I;  4Z1M H;  3H1L E;  3G71 P;  3FB2 A;  3JAD A;  3P32 A;  1GK6 A;  3ZN0 B;  2DHR A;  1NTZ D;  4TV8 E;  4FES A;  3UU4 A;  4IFM A;  3B5N D;  3PUW F;  3UUB A;  5LBQ B;  1LTA C;  1KNP A;  4IHJ E;  1JNR A;  2VWA A;  1NTZ E;  4GYR A;  5GV0 A;  3LID A;  4PJ0 H;  2DL1 A;  2YNK A;  2KZ7 B;  3J7Y q;  1MUU A;  4N59 A;  2E76 C;  1M62 A;  1YD8 G;  1QX8 A;  2X67 A;  5HYA A;  3QNU A;  4GCS A;  3R84 B;  1S72 P;  5DJT B;  1KMI Z;  2YIU B;  5EE2 A;  4HEA A;  4FRT A;  4DBR A;  1KNZ A;  5LGU B;  3HUS B;  2JMH A;  2EHO D;  2MBG A;  2WDQ A;  1YJW P;  3L72 G;  4E7Z A;  3RI5 A;  2JPF A;  5IYZ E;  1DEE G;  4DMW A;  2SPC A;  3IR9 A;  5AQL B;  1MNE A;  1J2J B;  4YSY A;  3L3P A;  3RYH E;  5F3J A;  4UB8 H;  4I6M C;  2LSY A;  2ZT9 D;  3OJA A;  1JY2 P;  2O1K A;  4IL6 O;  5KAF O;  3HA4 A;  2IUB A;  1VQO P;  3UQ4 A;  2Y0D A;  2JRK A;  2MYS A;  1ZN5 A;  4QQ1 A;  4E1S A;  1FEW A;  2WPR A;  3Q5D A;  1JM0 A;  1L0L G;  5JDN A;  2FXP A;  2E75 D;  4H44 D;  3TSI A;  5AQV B;  2CXF A;  3PP5 A;  1N7S C;  2KUB A;  3H37 A;  3AED C;  3PJS K;  4FI5 A;  1D1A A;  4CTD A;  2V1D B;  4JUY A;  1GL2 B;  5M4Y A;  4AKR A;  5AVV B;  3O9X A;  4AKL A;  2AXC A;  4IDN A;  2LT3 A;  3C4Z A;  2JO1 A;  1L0N E;  1GL2 A;  3NZQ A;  5GTH E;  5FXX A;  2Y0L A;  2YMK A;  2Z4E A;  1KIL E;  2YDQ A;  3P8C E;  3AE3 C;  1FZC C;  3S4R A;  3L70 E;  1SQP J;  2W4X A;  2CWO A;  1ZLL A;  5KTB A;  2HPJ A;  3S4U A;  2E5L T;  5LMN T;  3BS0 A;  4HFB A;  4CN1 A;  5G39 A;  5LYJ E;  1AV1 A;  1BCC J;  3OYZ A;  2M6I A;  4H44 B;  4HH2 A;  5KKZ C;  3LK3 A;  3RC3 A;  2XAG B;  2G3A A;  5DL6 A;  3B5N B;  1GW4 A;  5AVS B;  4WY4 B;  1U5P A;  3ANW B;  3LK3 B;  1YQ4 C;  1LTJ B;  4CI3 B;  4H9R C;  1PP9 J;  5AVW B;  2YPV A;  3HE4 B;  1G2C A;  2WQY A;  4GOU A;  2Y48 B;  1Q86 Q;  4WY4 A;  5CBO A;  4O4U A;  2C0W A;  3RH3 A;  2UXB T;  1BXW A;  1BSH A;  2QYW A;  2M8R A;  3LK2 B;  2VRS A;  2KNC B;  5C39 A;  4HWC A;  5KLV K;  1H89 A;  1N8R Q;  1E1H B;  3FZK B;  3IAO A;  4HWH A;  3AA0 B;  1YTZ T;  3SSU A;  2UUC T;  1IAP A;  5GTI O;  1VQP P;  3UIA A;  3F5H A;  1FZC B;  3OVU A;  3KVB A;  2WCA A;  1D0X A;  4TWD A;  3BQL A;  3KFW X;  4AQF C;  3TLW A;  2M06 A;  2UXC T;  4I2L C;  3POU A;  1NTM K;  4DV1 T;  3LBX A;  5LGT B;  3GF7 A;  3CD6 P;  3BQI A;  4AYI D;  1SQQ K;  5AVZ B;  4TWH A;  4IL6 H;  5J1G A;  1PRN A;  2M5A B;  3DA3 A;  4KP3 C;  2YMY A;  1RF1 B;  1SQQ J;  2KT9 A;  1M90 Q;  2PJQ A;  4QKN A;  5ABF A;  2BG9 B;  4D65 A;  2QJP B;  3AEF C;  4O9B A;  2K3W A;  4H63 H;  4JI7 T;  2FKW B;  5GTI H;  1MZ9 A;  1VQ4 P;  5BVZ A;  5G38 A;  3CX5 I;  1FDO A;  3A7O A;  3D6Y A;  2C5I T;  4K3A A;  2JMK A;  4XNK A;  3AAI A;  5L3E B;  1ZP0 A;  1EZV E;  2IFM A;  3AEB C;  3OYX A;  4LSE A;  3H1L D;  4UV9 B;  4YTM A;  2H88 C;  3H1J D;  3BCC D;  1RE3 A;  2B89 A;  3L71 J;  1L0N K;  1EC5 A;  1PZQ A;  3OA7 A;  3QB5 K;  2IDB A;  2PFV A;  4C00 A;  3LBX B;  3BRZ A;  2FY8 A;  2P67 A;  3JCU H;  4P0A A;  2IW5 B;  2A9U A;  5JRC B;  5KDM C;  2ODJ A;  3NVO A;  3Q2M A;  4LLH A;  2LXB A;  1N32 T;  2QJY B;  2QJP C;  3CXH E;  5LB7 B;  4O2B E;  5FNV E;  2Q9Q B;  1NU1 D;  1HTJ F;  2E5T A;  1YJN P;  3ESL A;  2BG9 C;  5DJQ C;  5JR9 B;  5APU A;  4UF0 B;  4L76 A;  3CWB J;  1SQP K;  2X9Y A;  5DJU B;  3F2E A;  3O4X E;  4H9N C;  3RL0 B;  4JQ0 D;  1N36 T;  2CPS A;  3BAT A;  3MZK B;  5JR9 A;  2I59 A;  2H43 A;  2NPS C;  4ZI3 C;  3V2R A;  3S9O A;  2C0S A;  3G06 A;  2DI4 A;  1G8X A;  3AE5 C;  2C0X A;  2M0B A;  1OED E;  3AA1 A;  5LBM A;  4N58 A;  3VRA A;  3GLM A;  3OKQ A;  1J1E C;  4KR8 A;  3A0H H;  1W0B A;  1S9K E;  3SOL A;  1NH4 A;  5CB4 E;  5KJ7 D;  4LF9 T;  1EDL A;  5LXT E;  2WBL A;  2DCF A;  2RPA A;  1IFM A;  5AVY B;  3CWB G;  1G73 A;  2XMX A;  3PRJ A;  5APQ A;  2Q9Q A;  1NKN A;  2FFD A;  2KLU A;  1FZF A;  3EFG A;  4DV2 T;  2I6H A;  3ZT6 A;  4RJT A;  2NTY A;  3AEB A;  3RBH A;  4TLF A;  5BU5 A;  4PD4 D;  1H88 A;  1NTK J;  3EI0 A;  5J2U E;  4KRA A;  3KV6 A;  4PAG A;  5LOV E;  2PTF A;  5BMV E;  4QWN B;  5JDH A;  3H1H E;  4HKA A;  4HTE A;  4JYC A;  2XZR A;  3NFQ A;  1ORM A;  4FZL A;  2QVA A;  5TJH A;  5APS A;  1KYO D;  3FWN A;  1BT9 A;  2WU5 A;  2YIN A;  1SQX G;  3KDP B;  1UUS A;  1LTG C;  1BE3 G;  2I8D A;  1GFP A;  2V6Y B;  5CCG D;  1IFP A;  5AQR B;  4JI2 T;  5ADX K;  4LMJ A;  4RES B;  4W7Z A;  5AQT B;  2EHO A;  3WAJ A;  1JMB A;  5J0Z A;  3CC7 P;  1Q7Y Q;  1VQN P;  3IA3 A;  2XAS B;  2K9Y A;  2F1T A;  2W61 A;  2J1D G;  3ZST A;  3CI9 A;  3T97 B;  1MMA A;  5HXH A;  2CMR A;  3T1H T;  3UT5 E;  2X9X A;  2JDI H;  1LT9 C;  4JBW F;  2GK9 A;  3I1A A;  3L75 G;  2LSJ A;  3U59 A;  4IE4 A;  2JQK A;  5JR9 C;  2XQ4 A;  2A45 H;  1L0L E;  1D7M A;  3F57 A;  4AKM A;  1N7S B;  4G76 A;  2CLY B;  1KQS O;  4B61 A;  1HGZ A;  1SQB K;  2R44 A;  1SQV K;  2Z6E A;  1GFN A;  2N2M A;  1M1J B;  4H13 C;  3CQG B;  2YKO A;  3ZC1 A;  1QJ9 A;  3Q2Y A;  1Q82 Q;  4R4M A;  2KYV A;  4C7R A;  4EI2 A;  4HFE A;  5HEG A;  4ADZ A;  5TIS O;  4AYD C;  4GYS A;  2N2L A;  3RYC E;  2YKP A;  2N1T D;  3L72 E;  1PPJ E;  5APV A;  3FX0 A;  2LLY A;  2HPC B;  2LRL A;  3ABV A;  3H1K E;  4UB8 O;  2FFD C;  4PW8 A;  1RQU A;  2XY8 B;  4LF5 T;  2VVN A;  5FXW A;  4F8H A;  3WU2 O;  2R4P A;  4YT0 A;  1MKM A;  1HBW A;  4ZMD A;  1ZP0 C;  4PK4 A;  5C2T A;  4HFD A;  4U31 A;  2ZM0 A;  2K1A A;  4ZKP A;  3B5N A;  3EWK A;  3HOL A;  2C5K T;  4GHB A;  1NTZ G;  3L09 A;  4U7Y A;  4EGW A;  1X79 B;  3MZW B;  1ZHC A;  1SFC D;  2BCC J;  1PHO A;  3QUJ A;  1MFZ A;  4DVD A;  5AQO B;  5AQM B;  4LF6 T;  3L75 D;  4WW0 A;  1LVK A;  3Q9D A;  4YHH T;  3U78 A;  1AVY A;  4YXD A;  1EDJ A;  1S94 A;  1VOM A;  2ZFG A;  2Q5U A;  5PRN A;  2L9Q A;  2XM2 A;  3LDQ B;  4WY4 C;  3JCU O;  4PJL A;  2X9H A;  5L3F B;  2AXD S;  4X1I E;  3C51 A;  5D5D A;  1L4A D;  1JMM A;  2KSJ A;  3SZD A;  3W67 A;  3RRW A;  5L3C B;  5DL7 A;  1NU1 E;  3CKD A;  1K04 A;  2LR2 A;  3K5B A;  3MIW A;  5FVL A;  5HEH A;  1W09 A;  1L0L J;  2RH0 A;  2V7K A;  2WMN A;  2YOE A;  4MBQ A;  1FBM A;  4D5U A;  5BU8 B;  3KPE A;  1MMG A;  4CPG A;  2FGQ X;  1CW5 A;  1SQV E;  2E74 D;  2D0T A;  3BCC E;  4PJM A;  4G2A A;  3JTY A;  3PGR A;  4GOD A;  1URQ C;  3FBZ A;  1PGQ A;  3RL0 C;  4HN9 A;  3N7N A;  1OXZ A;  1L2P A;  3L37 A;  5L3G B;  2YNY A;  4GCP A;  2NZ2 A;  4N74 A;  5AQN B;  2OAR A;  2FXO A;  5CA1 E;  1WYB A;  2WVP A;  4ISS A;  1DD3 A;  2W90 A;  2K0L A;  2M5A A;  1LGH B;  1ZV4 X;  1EZV I;  1I94 T;  4FOZ A;  4B3M T;  1FZC A;  3AE3 A;  2V8S V;  1US7 B;  4IFD K;  4K3B A;  2E42 A;  2CRB A;  5APW A;  1AFO A;  4DR3 T;  5FL0 A;  2A2F X;  4YJ2 E;  4OWF A;  4WVZ A;  3C64 A;  3M9B A;  1YXR A;  1FMV A;  3ZSS A;  1HS7 A;  2BCC D;  1T6A A;  2POH A;  3HR0 A;  3VR8 A;  3JSV C;  3LK4 2;  2Y9Y A;  2LSG A;  1VF5 C;  2IZ0 A;  4ZZB A;  1R8I A;  2QSI A;  5APY A;  3E08 A;  5AQS B;  2KSR A;  2BCC E;  3CCM P;  1VL2 A;  2K24 A;  2VUR A;  3UFG A;  4EEB A;  2HOD B;  4GIF A;  3ZYK A;  3HE5 B;  2KB7 P;  5IHY A;  1E54 A;  1D0Z A;  4PD4 I;  5CHX A;  1KQG B;  3KIN B;  1OSM A;  2ZM2 A;  1FU1 A;  2HOD A;  3G7G A;  2JEE A;  5FYM A;  2CPB A;  4HWI B;  3ZMU B;  4EB6 E;  4DUZ T;  3M9Q A;  3KBU A;  3JAF A;  3ITK A;  5JRE A;  2YXR B;  3TZG A;  1UII A;  3SY7 A;  3GP6 A;  2YKS A;  4IGU A;  1X8Y A;  1IBM T;  4EOT A;  3VKH A;  2Q3I A;  4FMS A;  4H0L B;  4BJN A;  3SWY A;  1J1D C;  2LOS A;  2B87 A;  1KN7 A;  1Q90 D;  1M7K A;  3CL3 D;  5G3A A;  3HRN A;  4PV1 B;  4G63 A;  1VQ9 P;  1WCR A;  1CI6 B;  5FP3 A;  3A2S X;  3QRA A;  4JEU B;  3MP7 B;  3BCC J;  3BQK A;  4AI6 A;  5CMZ A;  4DO0 A;  4P09 A;  2Z5H A;  3AE1 C;  3VOP A;  1N73 B;  1J5E T;  3AXJ A;  3VYI A;  3P4R A;  1CI6 A;  4YFS A;  5JDQ A;  1KYO E;  4LF4 T;  3ETU A;  3CWZ B;  3H1K D;  1OW8 A;  1E79 H;  3H1K G;  2KWI B;  5FL1 A;  2OTL P;  1S2E A;  5ABG A;  2XTR A;  2V7Q H;  1PPJ G;  5B5E H;  4CI2 B;  3FBL A;  4D64 A;  2P9B A;  3AA1 B;  3SZV A;  3OW2 O;  4CQI A;  4PJJ A;  1VCT A;  4Q25 A;  4DR7 T;  1T72 A;  1SVF A;  1P84 H;  4JEH B;  4JI1 T;  4X62 T;  1K8A Q;  2H89 A;  3NRX A;  1L0V A;  3HWB A;  1DIP A;  2X9K A;  3RIU A;  3Q3D A;  3JCF A;  4KBM B;  1L0N D;  4FUV A;  3G3Z A;  1NO4 A;  2VL8 A;  3AAA B;  3L75 E;  3RHW A;  2W83 C;  1NTK D;  2FJE A;  5EK2 A;  3VTP C;  2V6Y A;  3A5X A;  3UAQ A;  3AE9 C;  4NUV A;  4PFP A;  3RLF F;  1M1J A;  3AEG C;  2LOP A;  1HXT A;  4F4B A;  2OYH B;  4Z90 A;  3N5L A;  3P4S A;  2E76 B;  3B4S A;  1FZG A;  2XE3 A;  2WPQ A;  2CM0 A;  3ZMZ B;  3L70 D;  2P7J A;  2XND H;  3NWI A;  2A3D A;  3VP9 A;  5AQH B;  1FDM A;  4W7Y A;  2LKH A;  4UVC B;  1VCS A;  3JC2 2;  5AW1 B;  5HWX A;  2LE8 A;  4DV3 T;  3MKD A;  4IE5 A;  3PUY F;  5FKY A;  3T20 A;  4N78 E;  3AEC C;  2CHO A;  1MFT A;  5F5W A;  4AQY T;  3HD7 B;  5KAF H;  2KC0 A;  2J4G A;  2ZYA A;  2V7Q J;  5FVN A;  3N9M A;  1K73 Q;  1CSB A;  4I1L A;  2BDE A;  2FBW A;  3PUA A;  5LGN B;  1WRG A;  2OTK E;  3EHZ A;  1SE7 A;  5LA6 E;  2VKJ A;  1JEK A;  3P4P A;  1J1D B;  3E1I A;  2QIW A;  2VQF T;  2VQE T;  3RQW A;  4RJW A;  4ERR A;  5KAI H;  3S1K A;  1AJ3 A;  3CMA P;  4P0B A;  1UX4 A;  2IAK A;  2DW3 A;  2FUP A;  4TZ4 C;  4N75 A;  3C50 A;  4ILU A;  2KWH A;  1E5W A;  3HD7 D;  5CBN A;  1YHQ P;  4ASW A;  2A06 G;  1H8A A;  3H1L J;  2J47 A;  4H13 D;  2M6B A;  3WI5 A;  1RF0 A;  3HD7 A;  1TU3 F;  4JYA T;  3AE9 A;  5LCY A;  2XE5 A;  3I0Q A;  3ZMS B;  3RK2 D;  1LT9 A;  1B7T A;  2GA1 A;  3UU5 A;  4OGQ D;  4LSI A;  1ZRT D;  3HTK B;  1URQ D;  3TGU E;  1ZXG A;  2CA5 A;  1FZA A;  2AXT H;  4KJM A;  2H3R A;  4OK0 A;  4AYC A;  3ZYL A;  3FWL A;  1K9M Q;  2ZLY A;  3GHG B;  1S9K D;  3OBV E;  1JTH B;  5CCH D;  1SQQ G;  2OYI B;  3PU3 A;  3MUD C;  1SQQ D;  2KXP A;  1HJB A;  3CQX C;  1YQ3 C;  3GHG C;  4EYY Q;  3C4X A;  3CX8 B;  5C3J A;  4IE6 A;  2LEH A;  4HWD A;  5C8Y E;  5CCH A;  2E8I A;  1A02 J;  5KLI C;  1WR0 A;  3QC9 A;  3ZJ2 A;  2NW8 A;  2MOZ A;  1JOC A;  4MAL A;  1VQ8 P;  4YLH A;  1L4A C;  3DP7 A;  3CCL P;  3ABV C;  3PUS A;  2OQQ A;  2IC9 A;  2XHE B;  3B5M A;  3M65 A;  3TLS A;  1T2K D;  2AXT O;  1JY2 O;  3K3Q C;  5H6Q B;  4YY3 T;  2ZAE B;  1DX7 A;  2CHN A;  1UX5 A;  1DEB A;  2YU1 A;  3FZL B;  2D2C C;  3ZPO A;  5E79 E;  4TV9 E;  1M7L A;  1KV4 A;  5IYU A;  1T3U A;  1X0T A;  4WBO A;  3PUZ F;  4UR9 A;  2AEF A;  2KS1 B;  1PP9 G;  5ABF B;  2XAQ B;  3ANW A;  3MA9 A;  2H8P D;  3PTR B;  2QA4 P;  1JNZ A;  2J59 M;  3GF3 A;  2R4N A;  8PRN A;  4HYT B;  1NGM B;  4Z3T A;  2H7V C;  4UEL A;  3RK2 C;  3CCS P;  1SP4 A;  4NXN T;  2RKL A;  2ZFC A;  3KHU A;  3TNU A;  4ZZC A;  4IT4 A;  2XTL A;  4WNK A;  3POX A;  4YTP A;  4TX5 A;  1MV8 A;  4C7N A;  4BUM X;  3HD7 C;  2N1T B;  1L0N J;  1KEY A;  4O49 A;  1AA0 A;  3AEA C;  2FYU K;  4LF7 T;  3EUH A;  1OMI A;  3CXH H;  3I56 P;  1EXJ A;  4DV0 T;  2WT7 A;  4EZH A;  2IWV A;  1D0Y A;  2F1V A;  3M0D C;  1EDK A;  3BAS A;  2V5C A;  1NKZ B;  3Q5W A;  3IBP A;  2O4V A;  1IJD B;  4UF0 A;  3EDV A;  4U3F J;  5JDL A;  2I0M A;  2PG8 A;  2E9X A;  2ZXX A;  3ZYM A;  2L5G B;  3NKZ A;  2X68 A;  1URQ A;  3PH0 A;  1EQ7 A;  3RKO A;  3H32 A;  2DWG A;  2JQ9 A;  4C46 A;  5DQW A;  2XJ7 A;  2X0L B;  4BWN A;  2RN0 A;  1GL2 C;  1VPC A;  1L0N G;  3EFF K;  1H0T A;  1DD4 A;  3ZMV B;  2E9X D;  3PU8 A;  1KYO I;  2KZJ A;  4I7Z C;  1X9V A;  4UB6 E;  2Q7C A;  2LSI A;  1PGJ A;  3B71 A;  4JLE A;  3JAE A;  4C69 X;  5KLV J;  4U72 A;  4JI5 T;  2QJY C;  2JWD A;  2HR3 A;  3AEE C;  1P4T A;  1GU4 A;  3PJA A;  1U7M A;  3IEE A;  4O3X B;  1JUN A;  1KD1 Q;  1WT6 A;  3LFM A;  3K1S A;  3L71 D;  3B8E B;  1FZB A;  1NTM D;  1FJG T;  1QJP A;  3FZF B;  1VQ7 P;  2ERV A;  2WSE J;  1YQ4 A;  3PF1 A;  5APX A;  3QB5 A;  2N9B A;  2CEA A;  5G26 A;  1EXI A;  4N6J A;  1HGV A;  4NXM T;  5KAI O;  1KZU B;  2WSC H;  3UPG A;  3A5T A;  3USS A;  4AIU A;  2R32 A;  5AW0 B;  3A8Y C;  1ZR4 A;  5TAO A;  2NRG A;  3WUU A;  1FJP A;  5B5E O;  4JPZ B;  1KFM A;  3FGA D;  3CCJ P;  4A97 A;  3H1I J;  3Q5E A;  3RIF A;  4O2A E;  1QLE D;  1J1E B;  1ZOY C;  3A0B E;  1Z0P A;  3MXZ A;  2YK0 A;  1JNM A;  3V4W A;  5F8P A;  5KLV G;  2E5Y A;  5LHG B;  3E7K A;  4QMA A;  3TGU D;  3N9Q A;  3EMN X;  4O3Z A;  1HFA A;  2E9X C;  1DH3 A;  3AE4 C;  1H6S 1;  4D6T E;  3ZT7 A;  4B3T T;  2WWW A;  1ZHT A;  3SYS A;  4IL9 A;  5CCH C;  2MKV A;  3AE8 C;  5AQG B;  4U3F E;  4K0U A;  2FXM A;  2E2A A;  3P50 A;  4DR6 T;  4K0K T;  1SFC C;  5LG4 A;  3VE2 A;  3V5B A;  3HUS A;  3CX5 E;  2A06 D;  5EK3 A;  4RL9 A;  1IJ6 A;  3RQU A;  2XV5 A;  2FJB A;  4AKG A;  2FBW C;  1JY2 N;  4GDO A;  4DBQ A;  2CLY C;  4U3F G;  5TIS H;  4V1A v;  5B66 E;  5AQJ B;  1IC2 A;  5CCG A;  5KLV E;  1OED C;  3C4W A;  4H63 V;  3KXD A;  5JDG A;  4GF4 A;  1BCC D;  3E0Z A;  3UFE A;  2Y0H A;  2XZE A;  3CX7 B;  2R4L A;  1P84 E;  1U57 A;  4IOI H;  5FXZ A;  2ZJS E;  3RX6 A;  3SFD C;  2FYU J;  2W2U A;  2W6A A;  2OYH C;  7PRN A;  2HLO A;  1LNQ A;  1S1C X;  4GCQ A;  4BJM A;  2VAS A;  5AVQ B;  3OAK A;  1RE4 C;  4U7J A;  1YIT P;  1ZKE A;  4FQE A;  3QK6 A;  3ZLI A;  2PRN A;  3AE6 C;  1NHL A;  3CXH D;  4C91 A;  4L5G A;  1S4X A;  2J58 A;  3MAC A;  3AE2 C;  5CFB A;  2YEV C;  2OMF A;  3M0D A;  3L73 J;  1RQV A;  1FAV A;  4NUU A;  3VE1 A;  1NAF A;  2G8Y A;  2Y0E A;  5LHH B;  1FS0 E;  3WU2 H;  1OED B;  2OV9 A;  4ZHQ E;  2KI7 B;  4QH1 A;  2ZVO B;  1LP1 A;  2R8A A;  3Q5R A;  4TNV A;  4EAH A;  3O1J A;  2E74 B;  1KFN A;  3KVD D;  3GN5 B;  1T2K C;  1HCI A;  2HG5 D;  2ITA A;  2BEZ F;  3UU8 A;  3MJX A;  1E2A A;  2N1G A;  2BS2 A;  4YSZ A;  4DZO A;  3HKE E;  3O0E A;  3AEC A;  3L73 D;  5LP6 E;  4C4V B;  3AEF A;  1G2C B;  2RMZ A;  3TF5 A;  2YU2 A;  3Q5S A;  2B76 A;  1FOS F;  1KF6 A;  3GMI A;  1NTM G;  3B5N C;  4IDQ A;  5EZY E;  4EED A;  3IN6 A;  1VQK P;  4EV6 A;  2MJZ A;  3EDU A;  2LSK A;  3D0T A;  4IIJ E;  3PHL A;  4NPF X;  2H88 A;  5AVT B;  2FYZ A;  3I9W A;  3TNU B;  2ZLD A;  2KXP B;  1GQE A;  4LSH A;  2FJA A;  2XNX A;  3N9N A;  2W0G A;  3KBT A;  1FZE A;  2LKG A;  4OFZ A;  3D71 A;  1AQT A;  3GW6 A;  2WTY A;  2V6X A;  1R5S A;  2OYH A;  3VZU X;  2HPC A;  2WPV B;  5GTH H;  2JQH A;  2GM4 A;  3ZT5 A;  2RA1 A;  5AW2 B;  3RRC A;  3P7K A;  4IL4 A;  5LJM A;  2OGU A;  3RBX A;  1OFC X;  3AEA A;  3NJT A;  4C4V A;  3BCC G;  3B57 A;  3L70 J;  1YYC A;  5AVX B;  2IHR 1;  1MPF A;  1KB9 H;  1M8O B;  3L8R A;  3T97 A;  2QEX P;  1S3J A;  3QH9 A;  1NTK G;  2BG9 E;  2K9J A;  4QX8 B;  3AA6 A;  4DR5 T;  1ZEE A;  3AE5 A;  1IFJ A;  2E75 C;  3BRV B;  1YTZ I;  4GKK T;  4AQF A;  1NU1 G;  2HYN A;  3ZEF B;  2VL0 A;  2QM7 A;  2H7O A;  4ZS2 A;  2XG6 A;  1NVO A;  2YKQ A;  1PP9 E;  3GHG A;  3CCQ P;  1IFI A;  2WDV A;  1QVF O;  1VDF A;  3OPC A;  2IBZ G;  5T5F A;  2WMM A;  1QJ8 A;  2R3C A;  1IK9 A;  2XQY A;  3HUS C;  2BZB A;  3H1I D;  4GOE A;  3VR9 A;  1Q9G A;  2NWB A;  4L9I A;  4WBN E;  2IIU A;  2CBI A;  3CML A;  2CK3 H;  2CPT A;  2X51 A;  2P1J A;  3PUV F;  4O3Y A;  1KOR A;  2QM8 A;  1BGY E;  2JWA A;  5L47 A;  4H0L C;  5EFW B;  4GKJ T;  3KV5 A;  3FXD A;  3CWB D;  3V8U A;  1VF5 D;  4LML A;  2PRR A;  3ZN1 B;  1KIL A;  2W66 A;  5B5E E;  3I5C A;  3RYF E;  2WAU A;  5HCM A;  1NEK A;  3FXD B;  3N4X A;  5H2F E;  2OA5 A;  4FT6 A;  1CHU A;  1KIL B;  4IE0 A;  5LJN A;  2W80 C;  2A45 G;  3TGU G;  3KV4 A;  4K3C A;  2XQ3 A;  2WIT A;  3RGL A;  2WJR A;  5GTI E;  4AKI A;  4YTP C;  1LTJ A;  1RE4 A;  4OYJ A;  3P4Q A;  1WLX A;  1SQX D;  3HE4 A;  4EOZ B;  3H6P A;  2Q3E A;  1IFN A;  2X0Y A;  3K19 A;  4U2Z A;  3L36 A;  3PUX F;  1KB9 I;  5AQI B;  3PGS A;  4LSF A;  3L71 E;  3WUT A;  2SPZ A;  3RL0 D;  4AUW A;  3PTZ A;  4Z8X A;  2UUB T;  3W68 A;  3LSV A;  3GA8 A;  3C9I A;  4GT1 A;  4Y99 C;  2CXD A;  1SQP E;  1JO5 A;  4U3F D;  2W62 A;  3TLV A;  4O4L E;  5HAX A;  3SRZ A;  5KMG P;  1M56 D;  2XQ6 A;  4X66 T;  3M91 A;  3AE4 A;  3F89 A;  2M3E A;  5AW7 B;  4FRX A;  5JDP A;  4ANJ A;  1N34 T;  3AXJ B;  1XDP A;  1MND A;  2LHF A;  4HWF A;  2QTK A;  3KV9 A;  1OW7 A;  4ZI2 D;  1HG2 A;  1V9D A;  2XTQ A;  2V5D A;  4QH5 A;  1SHZ C;  4O8S A;  2FYU D;  1IZN B;  1SQV D;  2FJD A;  1AVO A;  2UUA T;  4LC1 A;  5KLI B;  1A02 F;  3N9P A;  5KX5 E;  1P84 D;  4UVB B;  4AZL A;  3L74 G;  1VQ5 P;  1Q81 Q;  1G90 A;  5DL8 A;  2KNC A;  2K9J B;  2LM9 A;  1GFQ A;  1BE3 E;  3N2G E;  1SQX E;  3WAK A;  4WWI A;  3N9L A;  4OGQ B;  1E7P A;  2XQ5 A;  4ZS3 A;  4JCH A;  1H7C A;  1WR6 A;  1GL2 D;  1QEX A;  3AVS A;  1HX1 B;  4AYM C;  1S5L X;  4W80 A;  1BGY J;  3PRN A;  1HNZ T;  3RF1 A;  4ILA A;  1LRZ A;  3L74 E;  1XNQ T;  1AJY A;  3RGU A;  1N7S D;  3KZI E;  4OVN F;  1FDI A;  3BVH A;  1P84 I;  1SLQ A;  2X9W A;  4PD4 H;  4EIW A;  4E1T A;  5LNK A;  3HOE A;  5FY7 A;  4DT0 A;  2C9N Y;  4IL6 E;  1THQ A;  3U1C A;  2WB5 A;  1T8B A;  2WZ7 A;  1N33 T;  2WS3 A;  4CN4 A;  3AA7 B;  1Y47 A;  1CZQ A;  3IHR A;  1FE6 A;  4KX6 A;  3V2P A;  4ASV A;  2Q1K A;  5GTH O;  2I1K A;  4IDP A;  4HJG H;  2ZT9 C;  1KFY A;  4XAX B;  5AFU K;  1W5C E;  2E9X B;  3LIE A;  1OPF A;  3TLU A;  3FHN A;  1SQP G;  5HEU A;  4RLC A;  5L4H A;  3POQ A;  1LVF A;  1XZY A;  4XNL A;  1S5L E;  3A0B O;  1LTT C;  2WZH A;  1EZ3 A;  1LWU B;  4DR4 T;  1SQB J;  4RO0 A;  1NAY A;  3H1J E;  2N2N A;  1T3J A;  3HL6 A;  2YIU C;  1GK4 A;  2C9L Y;  4UXN B;  1HVV A;  4X5T A;  2QJK C;  2W27 A;  5ABE A;  2IFN A;  4BRY B;  2OTJ P;  2K9A A;  4M3L A;  1Y64 B;  3JCU E;  3LK2 A;  3L75 J;  5AQU B;  2VKO A;  1FOS E;  2CCQ A;  3UUX B;  1FC2 C;  4GOF A;  3AE1 A;  5LHI B;  2MNH A;  2E74 C;  3AA7 A;  1ZME C;  2LJL A;  4I55 E;  1IBL T;  3N2O A;  2ES0 A;  4IRE A;  5HXS A;  3M0A A;  4U7I A;  2NP9 A;  1PGP A;  4NPE A;  5ABH A;  4TNW A;  2XAH B;  2O3J A;  2IDO B;  4DV4 T;  2BKP A;  3K3N A;  4H13 B;  4JV5 T;  3P7I A;  3NZP A;  4LF8 T;  4JI0 T;  3EAM A;  1BGY G;  3ZDM A;  5E79 O;  1DU2 A;  3U3I A;  3F31 A;  1W2E A;  3DA4 A;  1LWU A;  1SQX J;  3C8V A;  5CCG C;  4HGA A;  1YJ9 P;  1QSD A;  3X1D A;  4X1Y E;  2Y7S A;  3RBZ A;  2M3B A;  4IST A;  4EDF A;  3A2A A;  1PGO A;  1NTK K;  2WSE H;  2KIN B;  3A3Y B;  1IZN A;  3RIU C;  2LHR A;  4XBF B;  5CJ0 A;  2WQY C;  2J1N A;  2O1J A;  2BS4 A;  2IBZ E;  3T0S A;  2NPS B;  3W15 B;  3C98 B;  2XPK A;  4HE8 A;  4YPC A;  2FYN C;  1R8E A;  1HWT C;  2BBJ A;  1R5L A;  1ZHW A;  4KHX A;  2WWU A;  4O4H E;  3ZCJ A;  2IZ1 A;  1KK7 A;  4KT0 J;  1GFM A;  4ZEY A;  1RH5 B;  4HKZ H;  1T16 A;  2BCC G;  1EDI A;  3RK3 B;  2KP8 A;  3P4W A;  3A0H O;  3DJB A;  1RHZ B;  3PLN A;  2R89 A;  5CJ4 A;  1NTK E;  2N1T A;  4EZ4 A;  1NTZ J;  2X66 A;  3ZC0 A;  1X79 A;  3J9X 1;  4D6T D;  3HKC E;  3WU2 E;  3TLT A;  5BR8 T;  2BAS A;  3TK1 A;  3FXE A;  1HTL C;  3H1I E;  1SQB E;  3RK3 E;  2Y2X A;  1OWA A;  2EHO B;  2NPS D;  4ZI3 D;  2YDR A;  2O01 J;  1SUM B;  1KIL D;  1Z8U A;  2NW7 A;  2W67 A;  2XAF B;  4N3Y B;  5M1B A;  3L72 D;  1G1J A;  1BGY D;  2DLR A;  3LK4 1;  4AYE C;  2WSS H;  1WFD A;  2KZI A;  3TGU J;  1LKX A;  2BVM A;  3RK2 B;  2JJ9 A;  4Z91 A;  2A72 A;  2KIK A;  2AE9 A;  2WWV A;  4AQR D;  1LWU C;  3CPZ A;  4EIJ A;  3AAE B;  4JI4 T;  4O3W A;  1KC8 Q;  1W2B O;  4JFB A;  2KSE A;  1M1K Q;  1SQV J;  3L70 G;  3POR A;  1PV3 A;  1D1C A;  4PK6 A;  2IYO A;  3T1Y T;  2HFE D;  1XWM A;  5HEO A;  5LG3 A;  1Y9B A;  5AQF B;  3VP8 A;  3SWF A;  2HPL A;  1JTH A;  3O6Q A;  1U4Q A;  1ZHZ A;  5AFU L;  1ZW0 A;  1RF0 C;  2OYO A;  4QH4 A;  3B13 A;  1PPJ D;  3LJC A;  4YHJ A;  1LP1 B;  1OVU A;  4LGD E;  3V6I A;  1D1B A;  3KVA A;  2W00 A;  3O6Q B;  2IPP A;  3G6E P;  3ZKR A;  1ZV8 A;  1JB0 J;  3UUL A;  3KDS E;  5APT A;  3RPU A;  5AQP B;  3IF8 B;  1VF5 B;  2E76 D;  3UU6 A;  4ZI2 C;  1KB9 E;  1HX8 A;  3SWH A;  3CCR P;  1YIJ P;  1JY3 O;  3RK3 C;  2UU9 T;  3QRC A;  4HFH A;  1NTM J;  2JIW A;  3M3Z B;  3EQ2 A;  1BR1 A;  3NXS A;  2VB6 A;  4A5X A;  4JI6 T;  3IF4 A;  2O01 H;  3L4F A;  3UQ7 A;  1YW0 A;  1WRD A;  1S35 A;  2M67 A;  3DTO A;  4KHP T;  1KNR A;  3L73 E;  3AED A;  1BH3 A;  2ZMA A;  3HKD E;  1N2D C;  4DOJ A;  3VZW X;  4IL6 X;  1W0A A;  4GK0 E;  4FZM A;  2XKM A;  3LW5 H;  2ZYG A;  2MHL A;  2VKH A;  2Y0K A;  4A7P A;  4DMV A;  2XU6 A;  2XUE A;  5FVK A;  1GFO A;  3CC2 P;  1GZL A;  3AEE A;  3L73 G;  2YDS A;  2LKM A;  1HH0 A;  3CQC B;  1FJK A;  1XMO T;  3CVR A;  4GKG A;  1JY3 P;  4MHC A;  1LTS C;  3H3A A;  4Y99 B;  1HXU A;  4ILC A;  4QX7 B;  2XSA A;  2D5U A;  2JP3 A;  3RYI E;  2IWW A;  3CIR A;  1IK7 A;  2UWJ E;  1T1L A;  4WBA A;  4WYV A;  4OGQ C;  2KS1 A;  4L73 A;  4NIQ A;  4YXD C;  5H2F O;  3CCE P;  4O4X A;  5H2F H;  1OX3 A;  3T8O A;  4TN7 B;  3T24 A;  5KJ7 A;  1GD2 E;  4IDZ A;  4PFO A;  4AQG A;  2ODV A;  3HI2 A;  4LMK A;  2Q9I A;  3CXH I;  1ZHY A;  5FY1 A;  4I50 E;  4UB8 E;  1N73 A;  1WMK A;  2W63 A;  3K8P C;  3MK7 C;  1FMW A;  4D6T G;  1GTW A;  2XAJ B;  1LTJ C;  5KAF E;  1SFC B;  2WVR A;  3OTO T;  4LFB T;  2HN1 A;  4DR1 T;  2AEJ A;  4GK5 E;  3TDK A;  4XZC A;  2K48 A;  5JRC A;  2N1T C;  3Q5X A;  3WI4 A;  3VHL A;  1BR2 A;  1OW6 A;  1PP9 D;  3L39 A;  1AQ5 A;  5JTG A;  5JDM A;  1OVR A;  1L0L D;  2WT7 B;  2XQ9 A;  1USE A;  3VZT X;  1WYC A;  2X0H A;  2GUS A;  3H1H D;  3UTK A;  3PUG A;  4IFF A;  3V2N A;  3AE8 A;  3H1H G;  1HUC A;  2JJL A;  2UXX B;  2UXN B;  3P8M C;  1FIO A;  2BKO A;  1PFI A;  1HF9 A;  1NWM X;  2Q9Q D;  4P1N A;  3JC6 C;  2ZM8 A;  4TWF A;  1I6Z A;  4PV1 D;  3HE5 A;  1L4A A;  3Q1M A;  1YI2 P;  4U74 A;  4M1P A;  2IX7 C;  2PBI A;  4L0R A;  1PL5 A;  3VN0 A;  3M06 A;  2IBZ D;  2IC6 A;  3CWB E;  1N86 A;  1BDD A;  1U7J A;  3EAB A;  2O01 N;  1OIP A;  3VMA A;  4L74 A;  3SFE A;  5JVD E;  1SQB G;  3H1I G;  5J2T E;  2XQA A;  3R6N A;  2B88 A;  3VU7 H;  2H7H A;  3RL0 g;  3U1A A;  2AEM A;  1QLB A;  4CI1 B;  4B86 A;  3PGU A;  3KYQ A;  2CXL A;  2KLV A;  2DNX A;  4H9Q C;  2QGS A;  2B87 B;  1KTM A;  2KND A;  3QOF A;  4MN4 C;  4BRY A;  1Z56 A;  2XQ8 A;  2P58 A;  3AE7 C;  4I7Z B;  1N73 C;  2IBZ I;  4KUM B;  3ZCI A;  3CK6 A;  4DR2 T;  5IUX A;  2ZVN B;  3VY8 X;  2BKN A;  3O1I A;  1RY3 A;  5JDF A;  2MTQ A;  5FXV A;  3NTN A;  4R4L A;  3PQU A;  5L3B B;  3RK3 D;  3E1R A;  4YXW H;  3H25 A;  3LG7 A;  3PDY A;  2WPS A;  1J5W A;  5B66 O;  4ZOL E;  3TYY A;  3AB3 B;  4TT3 H;  3ONJ A;  4H0L D;  4TUY E;  3BRT B;  2NPS A;  3RC8 A;  1S5L O;  1XTG B;  2CE7 A;  4F6R C;  1S5L H;  2GE4 A;  2W8Z A;  3C1L A;  3VMY A;  5DAB A;  4WY4 D;  3I0O A;  3UUM A;  1QL1 A;  2UXD T;  1MIW A;  4FZN A;  2N9Y B;  3CME P;  2BVL A;  3MD0 A;  3E22 E;  2XSB A;  2FYU E;  1EZV G;  4K35 A;  1W9R A;  2WSC J;  2V7I A;  2K3R A;  1SFC A;  1BCC E;  3I55 P;  1HR0 T;  2PAJ A;  2YXQ B;  4ZKU A;  4N78 D;  1NTZ K;  1UGO A;  1IFD A;  4C90 A;  2F4V T;  2KZ7 A;  3KQG A;  4EXT A;  2XE2 A;  2WM9 A;  3HW9 A;  3PJA J;  4PJ0 E;  3CPW O;  2WP9 A;  3VRB A;  4JI3 T;  2OYI A;  3L74 D;  1Y01 A;  3P8C D;  2XE1 A;  1UCU A;  1VQL P;  3G4S P;  5CJ5 A;  2IML A;  4DJG A;  3FZH B;  2K37 A; 
#chains in the Genus database with same CATH homology
 5KMG P;  3LBX A;  5LGT B;  4ERR A;  4RJW A;  3BQI A;  3K3O A;  5EK4 A;  4AYI D;  1AJ3 A;  3NRY A;  4P0B A;  4FRX A;  5J1G A;  5JDP A;  1PRN A;  1UX4 A;  4ANJ A;  4KP3 C;  2IAK A;  3DA3 A;  4RJX A;  1MND A;  2Y6X A;  2LHF A;  2KT9 A;  4TZ4 C;  2QTK A;  3KV9 A;  3C50 A;  4ILU A;  2EHO C;  2KWH A;  4ZI2 D;  1HG2 A;  1V9D A;  5L2L A;  3WI3 A;  2XTQ A;  2PJQ A;  4QKN A;  3WI5 A;  3O1H A;  1SHZ C;  4UEM A;  2QA7 A;  4O8S A;  4D65 A;  1IZN B;  5A1L A;  4H63 H;  5KX5 E;  3N9P A;  5LCY A;  2XE5 A;  3I0Q A;  4UVB B;  4AZL A;  1G90 A;  3ZMS B;  5DL8 A;  1B7T A;  2C5I T;  2JMK A;  2LM9 A;  4LSI A;  4XNK A;  3AAI A;  4X20 E;  5L3E B;  1GFQ A;  3N2G E;  3OYX A;  3WAK A;  2CA5 A;  4OK0 A;  2H3R A;  4UV9 B;  4O4J E;  1VRB A;  3ZYL A;  5JQG E;  4LSE A;  3N9L A;  5GON E;  2ZLY A;  4ZS3 A;  3OBV E;  4JCH A;  1H7C A;  1WR6 A;  3EVY A;  3AVS A;  3PU3 A;  4OYK A;  2Y8D A;  4AYM C;  2D2S A;  2KXP A;  3PRN A;  2PFV A;  3CQX C;  3LBX B;  1LRZ A;  4YJ3 E;  3C4X A;  4H9S E;  3CX8 B;  4P0A A;  4IE6 A;  2IW5 B;  2LEH A;  3PUQ A;  3AA0 A;  2LFU A;  5JRC B;  5KDM C;  5C8Y E;  2ODJ A;  2E8I A;  2X9W A;  3Q2M A;  3QC9 A;  4EIW A;  4E1T A;  5H6R B;  3ZJ2 A;  5LNK A;  2NW8 A;  1MMN A;  3HOE A;  2MOZ A;  3V5S A;  5FY7 A;  4PUX A;  4MAL A;  4YLH A;  1THQ A;  3DP7 A;  4O2B E;  3ZJ1 A;  4I4T E;  5FNV E;  2Q9Q B;  3PUS A;  1HTJ F;  2IC9 A;  2XHE B;  3AA7 B;  3AVR A;  3ESL A;  3M65 A;  5DJQ C;  3IHR A;  5JR9 B;  4UF0 B;  5HXC A;  3K3Q C;  2WMO A;  5H6Q B;  5JH7 E;  2DWK A;  2X9Y A;  4J2C A;  3F2E A;  3O4X E;  4H9N C;  4E7S A;  2YU1 A;  1UX5 A;  4DND A;  1O3X A;  4XAX B;  3ZPO A;  2VKD A;  5AFU K;  2E9X B;  1OPF A;  4TV9 E;  3MZK B;  5JR9 A;  3FHN A;  2I59 A;  4RLC A;  5FY0 A;  4FSO A;  5IYU A;  4WBO A;  4ZI3 C;  1LVF A;  3POQ A;  5HWY A;  3ZMT B;  2C0S A;  1BR0 A;  4XNL A;  2DI4 A;  1G8X A;  2XAQ B;  3ANW A;  3MA9 A;  3PTR B;  4PJN A;  3N2K E;  1EZ3 A;  3AA1 A;  5LBM A;  4N58 A;  4OHF A;  3OKQ A;  8PRN A;  4KR8 A;  3UUN A;  2N2N A;  3HL6 A;  4Z3T A;  2H7V C;  4UEL A;  4UVA B;  3SOL A;  5CB4 E;  2V7M A;  4UXN B;  5LXT E;  4HFV A;  4CXY A;  2WBL A;  3ONX A;  2K9A A;  2XTL A;  5DQV A;  1Y64 B;  2DCF A;  4WNK A;  4U9C A;  1HF8 A;  1MIY A;  2W81 C;  3POX A;  6PRN A;  4TX5 A;  3GWH A;  4H9P C;  1G73 A;  2XMX A;  3LK2 A;  4BUM X;  2VKO A;  3NBX X;  1ZHX A;  3FYX A;  2CCQ A;  3UUX B;  4O49 A;  4AKH A;  2Q9Q A;  4X1K E;  5LHI B;  3SYB A;  2MNH A;  4MFR A;  3AA7 A;  2LJL A;  4I55 E;  5E0O A;  3EUH A;  2ES0 A;  3N2O A;  5HXS A;  2NTY A;  2V7J A;  2NP9 A;  3RBH A;  5L3D B;  2POR A;  4KRA A;  4AFK A;  5J2U E;  2XAH B;  3KV6 A;  4PAG A;  5LOV E;  4EZH A;  5BMV E;  3PQS A;  4QWN B;  3K3N A;  5JDH A;  1D0Y A;  2FGR A;  1QUU A;  4HKA A;  4PNI A;  4FJO A;  3N9O A;  4HTE A;  1ORM A;  2F1V A;  3P7I A;  2X27 X;  4FZL A;  4RLB A;  3NZP A;  3Q5W A;  3IBP A;  2RP4 A;  3U3I A;  3F31 A;  1BT9 A;  2O4V A;  3DA4 A;  2YIN A;  1MMD A;  1GFP A;  3SS1 A;  4UF0 A;  4HGA A;  3EDV A;  4EYU A;  1QSD A;  4X1Y E;  5JDL A;  5ADX K;  2Y7S A;  4IST A;  2L3L A;  2PG8 A;  3AA6 B;  2E9X A;  2KIN B;  2EHO A;  1IZN A;  1IJ5 A;  3ZYM A;  3WAJ A;  2LHR A;  4XBF B;  2X68 A;  2J1N A;  2N9D A;  2WSS V;  3RKO A;  3PE0 A;  2XAS B;  3PUR A;  4GIW A;  3T0S A;  4CZZ B;  2DWG A;  2F1T A;  3W15 B;  2W61 A;  5DQW A;  3C98 B;  4HE8 A;  2J1D G;  2X0L B;  1MMA A;  5HXH A;  4A56 A;  2CMR A;  3UT5 E;  2X9X A;  1ZHW A;  3VY9 X;  2WWU A;  4O4H E;  2E9X D;  3ZMV B;  2GK9 A;  3PU8 A;  3I1A A;  3ZCJ A;  2LSJ A;  3ETV A;  1KK7 A;  4IE4 A;  5JR9 C;  1GFM A;  2LSI A;  4JLE A;  4C69 X;  3DJB A;  3F57 A;  4AKM A;  4KMC A;  1MM4 A;  4U72 A;  4G76 A;  2CLY B;  1CUN A;  4EZ4 A;  4B61 A;  1P4T A;  2K4T A;  2X66 A;  3ZC0 A;  2B1E A;  2Z6E A;  1X79 A;  4IE7 A;  2M07 A;  3IEE A;  3J9X 1;  1GFN A;  2N2M A;  4O3X B;  2ACX A;  3HKC E;  3CQG B;  4H9O C;  3ZC1 A;  5HXE A;  1QJ9 A;  1Q9F A;  4QXB B;  2JMM A;  5DL5 A;  3LFM A;  5HXR A;  4AYD C;  1QJP A;  4ADZ A;  2ERV A;  4QXC B;  2VK9 A;  4GYS A;  2N2L A;  3RYC E;  3NSG A;  2Y2X A;  1OWA A;  2EHO B;  4ZI3 D;  2CEA A;  5G26 A;  3UU2 A;  2NW7 A;  2XAF B;  4PW8 A;  2G0U A;  3UPG A;  5FXW A;  4MLK A;  2DLR A;  3LK4 1;  4KR4 A;  4AYE C;  5TAO A;  4I43 B;  4ASK A;  2KMF A;  4BAY B;  4AUI A;  1LKX A;  2BVM A;  4PK4 A;  4AYN A;  2JJ9 A;  4FSP A;  1YS5 A;  2ZM0 A;  2A72 A;  4O2A E;  1Z0P A;  3MXZ A;  3CPZ A;  2C5K T;  3AAE B;  3HOL A;  2YK0 A;  4GHB A;  3L09 A;  4O3W A;  1ZHC A;  4JFB A;  5F8P A;  3C5O A;  3POR A;  5LHG B;  3N9Q A;  3EMN X;  4O3Z A;  1HFA A;  2E9X C;  2KLQ A;  4O4I E;  1D1C A;  3QUJ A;  4UV8 B;  4DVD A;  2JQQ A;  1PHO A;  1H6S 1;  2J4U P;  4PK6 A;  4WW0 A;  3SYS A;  1ZHT A;  1LVK A;  3Q9D A;  3U78 A;  4K0U A;  1S94 A;  1VOM A;  2ZFG A;  5PRN A;  3JC6 D;  2HPL A;  1U4Q A;  1YKE B;  2L9Q A;  2Q9Q C;  5AFU L;  5LG4 A;  1ZHZ A;  3VE2 A;  2L8K A;  4PJL A;  2X9H A;  5CA0 E;  2V26 A;  3B13 A;  2CWY A;  5L3F B;  4X1I E;  3LJC A;  3C51 A;  4YHJ A;  5D5D A;  4B6X A;  3KVA A;  1HXX A;  1D1B A;  2W00 A;  5EK3 A;  2D0U A;  4QHO A;  4RL9 A;  3SZD A;  1IJ6 A;  3UUL A;  3RRW A;  3KDS E;  5L3C B;  1HG5 A;  4AKG A;  3RPU A;  5DL7 A;  4DBQ A;  2CLY C;  3IF8 B;  4QXH B;  2NTX A;  3CKD A;  4ZI2 C;  1HX8 A;  3SWH A;  3QRC A;  4CXX A;  4V1A v;  1BR1 A;  2V7K A;  2VB6 A;  2WMN A;  4MBQ A;  4D5U A;  4ZI7 E;  3C4W A;  4H63 V;  1MMG A;  2NW9 A;  5JDG A;  5FMN A;  2FGQ X;  3CX6 B;  4CXW A;  3VKG A;  4GF4 A;  3SY9 A;  1YW0 A;  3E0Z A;  1WRD A;  3UFE A;  1S35 A;  2D0T A;  2M67 A;  3CX7 B;  3DTO A;  4PJM A;  4G2A A;  2Y0H A;  3JTY A;  3FBZ A;  5FXZ A;  2KDY A;  4HN9 A;  1BH3 A;  3RX6 A;  2ZMA A;  3HKD E;  4AXP A;  1OXZ A;  3AAE A;  3BK9 A;  5L3G B;  2NOX A;  3VZW X;  7PRN A;  4GK0 E;  4GCP A;  3V5U A;  4FZM A;  4GCQ A;  4BJM A;  2ODU A;  2VAS A;  5CA1 E;  2MHL A;  1WYB A;  2VKH A;  4AKR B;  2Y0K A;  4ISS A;  1ZKE A;  4DMV A;  3QK6 A;  2LHN A;  3HKB E;  1MM5 A;  3ZLI A;  2K5B B;  2XUE A;  2K0L A;  2PRN A;  4C91 A;  4L5G A;  3MAC A;  1ZV4 X;  1GFO A;  3AAA A;  2YEV C;  5ADX L;  2V7L A;  1BR4 A;  2OMF A;  4PK5 A;  4FOZ A;  3CQC B;  3FXE B;  1US7 B;  4NUU A;  3VE1 A;  1NAF A;  3CVR A;  3GN5 A;  4MHC A;  5LHH B;  3H3A A;  3TKL B;  4ZHQ E;  1HXU A;  2A2F X;  4QX7 B;  4YJ2 E;  2D5U A;  3RYI E;  4EAH A;  3C64 A;  3O1J A;  1YKH B;  1FMV A;  3GN5 B;  3KVD D;  1HCI A;  1HS7 A;  4UIG A;  1MIV A;  3HR0 A;  3LK4 2;  2LSG A;  4O4X A;  1SA0 E;  3MJX A;  3T8O A;  5ETW A;  4TN7 B;  3T24 A;  4G75 A;  2C5J A;  2HH7 A;  2N1G A;  3E08 A;  4BA9 A;  4IDZ A;  4PFO A;  2K24 A;  4AQG A;  2ODV A;  3HI2 A;  4EYY R;  3HKE E;  1ZHY A;  5FY1 A;  3ZYK A;  3O0E A;  5IHY A;  4I50 E;  1E54 A;  3I9Y A;  1T98 A;  1D0Z A;  2W63 A;  3K8P C;  3MK7 C;  5LP6 E;  1FMW A;  3FB2 A;  3KIN B;  1OSM A;  2XAJ B;  2ZM2 A;  3ZN0 B;  2DHR A;  2YU2 A;  4TV8 E;  4FES A;  3G7G A;  4GK5 E;  5FYM A;  3ZMU B;  4EB6 E;  3GMI A;  4XZC A;  3KBU A;  5LBQ B;  5EZY E;  2K48 A;  4IHJ E;  5JRE A;  5JRC A;  2VWA A;  3TZG A;  3SY7 A;  3EDU A;  2LSK A;  4GYR A;  3D0T A;  3GP6 A;  4IGU A;  4IIJ E;  5GV0 A;  3Q5X A;  3WI4 A;  3VHL A;  2YNK A;  2KZ7 B;  3J7Y q;  1BR2 A;  3VKH A;  4N59 A;  4FMS A;  3I9W A;  2ZLD A;  2KXP B;  4BJN A;  4LSH A;  5JDM A;  1YD8 G;  2X67 A;  4GCS A;  5HYA A;  1WYC A;  3VZT X;  3R84 B;  2LOS A;  5EE2 A;  3N9N A;  2W0G A;  3KBT A;  4HEA A;  3UTK A;  3PUG A;  4FRT A;  4OFZ A;  4DBR A;  2UXN B;  2UXX B;  1FIO A;  4G63 A;  1KNZ A;  5LGU B;  3VZU X;  1NWM X;  2EHO D;  2JMH A;  2Q9Q D;  5FP3 A;  3A2S X;  2RA1 A;  3QRA A;  3JC6 C;  2ZM8 A;  4JEU B;  2MBG A;  3BQK A;  4AI6 A;  3RRC A;  4DO0 A;  4P09 A;  4E7Z A;  4U74 A;  2JPF A;  5IYZ E;  4M1P A;  4DMW A;  2PBI A;  5LJM A;  2SPC A;  4YFS A;  3B57 A;  1MNE A;  4L0R A;  5JDQ A;  3ETU A;  3L3P A;  3RYH E;  3CWZ B;  5F3J A;  1MPF A;  2LSY A;  3OJA A;  2IC6 A;  2KWI B;  3HA4 A;  2XTR A;  2JRK A;  2MYS A;  3FBL A;  5JVD E;  4CI2 B;  4QQ1 A;  4E1S A;  1FEW A;  5J2T E;  4D64 A;  2P9B A;  4QX8 B;  3R6N A;  3AA6 A;  3AA1 B;  3VU7 H;  1ZEE A;  3SZV A;  5JDN A;  4CQI A;  4PJJ A;  4AQF A;  4CI1 B;  3ZEF B;  2CXF A;  2H7O A;  2DNX A;  2CXL A;  4H9Q C;  4ZS2 A;  2XG6 A;  2QGS A;  2KND A;  4JEH B;  3NRX A;  3H37 A;  3HWB A;  4FI5 A;  1D1A A;  2V1D B;  4JUY A;  5M4Y A;  4AKR A;  4KBM B;  3O9X A;  4KUM B;  3ZCI A;  5T5F A;  1QJ8 A;  4FUV A;  4AKL A;  2VL8 A;  3VY8 X;  2LT3 A;  3AAA B;  2XQY A;  3C4Z A;  3O1I A;  5JDF A;  2MTQ A;  5FXV A;  3PQU A;  2BZB A;  5L3B B;  3NZQ A;  5EK2 A;  1Q9G A;  5FXX A;  2Y0L A;  3A5X A;  3UAQ A;  2NWB A;  3LG7 A;  4NUV A;  4L9I A;  4PFP A;  3PDY A;  4WBN E;  3CML A;  2X51 A;  4ZOL E;  2LOP A;  4F4B A;  1HXT A;  4O3Y A;  3AB3 B;  2CWO A;  3N5L A;  2HPJ A;  4TUY E;  3S4U A;  3KV5 A;  2XE3 A;  5LYJ E;  3V8U A;  2CM0 A;  3ZMZ B;  3OYZ A;  3RC8 A;  2CE7 A;  4F6R C;  3ZN1 B;  3LK3 A;  2A3D A;  2GE4 A;  3RC3 A;  5DAB A;  2XAG B;  3I0O A;  3UUM A;  3RYF E;  5DL6 A;  4UVC B;  2WAU A;  1MIW A;  3FXD B;  4FZN A;  2BVL A;  2OA5 A;  4FT6 A;  1U5P A;  3E22 E;  3ANW B;  3LK3 B;  4IE0 A;  5LJN A;  2W80 C;  5HWX A;  3KV4 A;  2LE8 A;  4CI3 B;  4H9R C;  3MKD A;  4IE5 A;  2YPV A;  3T20 A;  2V7I A;  4AKI A;  4GOU A;  2Y48 B;  4O4U A;  3RH3 A;  2KC0 A;  4N78 D;  4OYJ A;  1BXW A;  1WLX A;  4C90 A;  5FVN A;  3LK2 B;  4EOZ B;  3N9M A;  2KZ7 A;  1E1H B;  4EXT A;  3K19 A;  2XE2 A;  2BDE A;  2WM9 A;  3AA0 B;  3PUA A;  3HW9 A;  1IAP A;  4LSF A;  5LGN B;  4Z8X A;  3KVB A;  3GA8 A;  1D0X A;  5LA6 E;  3BQL A;  2CXD A;  3KFW X;  2VKJ A;  4AQF C;  3P8C D;  2XE1 A;  1UCU A;  2M06 A;  2W62 A;  3POU A;  4O4L E;  5HAX A;  3SRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...