1IZNB

Crystal structure of actin filament capping protein capz
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CapZ alpha-1 subunit
publication title Crystal structure of CapZ: structural basis for actin filament barbed end capping
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 88
structure length 270
sequence length 270
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 1iznB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1iznB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 1iznB02
5ADXL 3AA6A 3AA6B 3AA1A 2KZ7A 5AFUL 5ADXK 3AA1B 2KZ7B 1IZNA 5AFUK 1IZNB 2KXPA 3AAAA 2KXPB 3AA0A 3AAAB 3AA0B 3LK42 4AKRA 3AA7A 3LK2A 3LK3A 3LK2B 4AKRB 3AA7B 3LK3B 3AAEA 3AAEB 3LK41
chains in the Genus database with same CATH superfamily
1SQXG 1HF8A 4IDZA 1LTGC 2FXMA 4DO0A 3AA6B 5L3CB 3O1HA 3CVRA 4UIGA 4GF4A 5HEOA 2M6IA 4ZKUA 4D5UA 2KSJA 4ASVA 2XSBA 3NJTA 4H9SE 4I50E 3H1IG 1M1KQ 5JRCA 1S94A 4IL6O 3GF7A 2C9LY 4DV0T 4DR5T 3LW5J 1I94T 2BKNA 4IE7A 4PW8A 2HR3A 2LRKA 2BCCE 1OEDA 1AJYA 3L71E 1PRNA 4QQ1A 4X62T 1LT1A 4FSPA 2D0TA 4JF7A 1SQPJ 4JBWF 3FX0A 5HEJA 5FVNA 1NTMJ 3OYXA 5AQNB 2Y8DA 3L72J 1YI2P 4ZI2C 3DA4A 2ITAA 4KI0F 4JI4T 3CX5E 4I1LA 2YXQB 2WDVA 5AQUB 3N9NA 4N6JA 2Y0DA 4LGDE 2J1NA 1VDFA 2LSYA 3PP5A 4JYCA 2Y0HA 3RGUA 5JDNA 3NBXX 5AW6B 2JQKA 5LBQB 1VQ4P 3ZC1A 4XNKA 1FZCC 4DV4T 3VZUX 2FYUJ 5KKZB 2YDQA 3T20A 1KF6A 4DOJA 2CXDA 4I2LC 2JMMA 2W61A 1VQOP 1W09A 3HD7B 3JSVC 3JC22 2VK9A 3RK2C 2VWAA 1U57A 5KMGP 1VQPP 3LBXB 4DR3T 1EXIA 2F1TA 3KVBA 4H9QC 2JWDA 3BRZA 1MNEA 5AW9B 4C7NA 1NU1K 1NU1E 5LHIB 2J47A 2RH0A 1MZ9A 2X9WA 1JTHA 4UB6O 1ZEEA 2IUBA 1SFCD 2HODA 2A72A 1YQ3A 2LE8A 1BGYD 5L4HA 4O49A 3L75G 3BQKA 4H9RC 4ZMDA 3RHWA 1HJBA 3KXDA 1NWMX 1WRDA 3H32A 1WT6A 4C4VA 3TNUA 3CIRA 4O4JE 1YJNP 2O4VA 1SQXE 1SQXK 3K3NA 2A3DA 3ZT6A 3SZDA 2QJPB 3MACA 2A9UA 4ILAA 4QX8B 1L0LJ 2PFXA 2M8RA 2NZ2A 3GHGA 4OGQC 1SQQK 3H1IE 1WLXA 2M07A 1FEWA 3ETVA 2Y0KA 3DZMA 1LWUB 5KLVG 3LIDA 4I6MC 4CPGA 4DV5T 1ORMA 4JI3T 5AVUB 1PZQA 2FFDB 3AE3A 2PG8A 1GZLA 3AEGC 1HG2A 3JCFA 1S35A 3U78A 4D6TG 1URQD 2EHOC 6PRNA 4GCQA 4L74A 2R3CA 4HWCA 3QH9A 1J5WA 3GA8A 1YYCA 2J4GA 1ZR4A 2CLYC 5L3BB 2QTKA 1CUNA 3AEFA 1RF1B 3DA3A 2AEFA 1EZVG 1RE3C 4EOTA 4AYDC 2BZBA 3GMIA 4HKZH 5M4YA 3PU8A 2B88A 1O3XA 1GU4A 4C91A 3D71A 3M0DA 2IZ0A 3KVAA 3IBPA 3ZT5A 4XA4A 1P84H 3VHLA 1HGZA 3CCUP 3I9YA 4K0UA 4WB4A 5APXA 2QVAA 4N58A 1VQKP 1SQBG 5HCJA 3UULA 1PGOA 1FZAA 3M06A 4EDFA 5CCGC 1ZOYC 4NPPA 3VMAA 3AE7A 1SQVD 5L47A 1G1IA 3QRAA 4UV8B 5ABEA 3L73G 5AQFB 3HE5A 3UQ7A 5CCHC 4O8SA 2BG9A 4EAHA 3PF1A 3ZYKA 2X27X 3A0BO 3L75E 3M3ZB 2HHHT 1PIXA 2AXTO 1X22A 2O01H 4GIFA 4AKHA 3RK3D 4H9OC 1QL2A 2Y9YA 2K0LA 3CWBD 1NOHA 1R8EA 4NIQA 3V2QA 4UEMA 4UVAB 5FVLA 5AW7B 3W15B 2WP9A 1Q81Q 4O4XA 3TLVA 4RLBA 4GOEA 2UU9T 3BCCJ 3UTKA 1RQUA 2ZT9C 5TJHA 4CN1A 1JM0A 2LSKA 2WBLA 3AE1C 2W4XA 5E79E 1GDTA 3RYHE 2O1JA 2HN2A 4PV1C 4U7IA 5EFWB 1JMBA 2W6AA 3CCSP 5KJ7A 2RN0A 4H13C 3V4WA 4EOZB 4RLCA 3LK42 1BR2A 5KLVE 3EQ2A 5KLVK 2QYWA 2N1TC 3AA7B 3GP6A 2ZMAA 4TUYE 3ONJA 5LHHB 3HD7D 4HGAA 1GW3A 3ZSSA 1JY2P 4CN4A 2D2CC 4C69X 1L0NG 3HA4A 3ONLC 3VZWX 5CB4E 4D6TE 1QVFO 2OTLP 1FOSE 4PJ0O 1BSHA 5DABA 1J1JA 2FBWC 4OFZA 3CXHE 3P32A 3SWHA 3PUXF 1MMNA 3TF5A 4DCKA 4OGQB 2J5UA 3CCEP 2YMYA 2DNXA 2YO2A 4HWIB 2Y0EA 5G38A 3NRYA 3GWHA 2OYOA 3HTKB 1XNRT 1EZVE 4J2CA 1IFMA 3QRCA 3PUYF 5F3JA 2OYIB 1M8OB 1MM5A 3UAQA 1H89A 3OKQA 1EC5A 2EHOB 1RE4C 2ZFCA 1LWUA 1VCSA 2X67A 3PDYA 4YXDA 4DV3T 2X9KA 3VTPC 1K73Q 4KHPT 4QWNB 3N9QA 2K9JB 1SQBE 1YTZT 2FFDA 1PL5A 3E08A 1X9BA 2CLYB 4V1Av 1JO5A 3EUHA 4CXXA 3AE8C 1QVGO 4YJ3E 2Z6EA 2YIUC 2CPSA 1YXRA 2XQ7A 3LDQB 1HWTC 4H0LC 4LC1A 1IBLT 4L76A 1CSBA 2MPKA 1N7SA 3ONXA 3CL3D 1RF1A 4JCHA 3QWOC 3RC8A 2VKOA 2XTLA 3VMXA 1IAPA 1Y64B 5AVSB 1NTZD 2XQAA 2V7KA 5T5FA 3P4WA 5KX5E 2CWYA 3VY8X 3AAAA 5B66O 1RQVA 4I43B 4H44D 2P10A 4TNWA 3WU2O 2W80C 2JMKA 1W0BA 1J1DB 2X0HA 1HCIA 3CC4P 4N75A 5E79H 5CFBA 1FS0E 3RH3A 2N9DA 2GE4A 3PUVF 2IBZI 4DJGA 2L8KA 3RYCE 1E54A 3A5TA 1KV4A 4ADZA 1T3UA 2V7QH 3PRJA 4ZI3D 2BS4A 5FVKA 2E9XC 1ZRTD 1OX3A 2ZFGA 4PJNA 3O6QB 1JY2O 2OYHA 3UU2A 5JREA 5AW4B 3CKDA 5HXSA 1H88A 3K5BA 4W7ZA 4EIWA 2WAUA 2Q7CA 2WJRA 3SFEA 4TX5A 4ZI2D 4YTNA 2KIKA 2MNHA 1L0NE 1L0NK 2K24A 5LGTB 5TISO 1M90Q 4GCSA 1AJ3A 5FXXA 4AYID 2Y0CA 3SS1A 3IN6A 4BXLA 3SFDA 2LHRA 3KHUA 3UIAA 1JB0J 1N33T 2Q1KA 3JAEA 1KYOE 3N9LA 4UELA 4DR4T 2R6GF 4R4LA 4WVZA 3A8YC 4PNIA 4BAYB 1SS1A 2YKOA 1BGYJ 3H1HD 1VQLP 3PJSK 1OEDC 4ZHQE 4DV2T 2N1TB 4DR2T 2OTJP 3RX6A 2RKLA 3RLFF 1MPFA 3AEEA 5H2FO 1U7MA 2D2CB 1KQLA 3RK2D 1W2BO 3CD6P 3FZKB 4B3MT 4WBNE 2G0UA 3Q3DA 4HFEA 1NTKG 2XAFB 5GTIO 4QH5A 2I8DA 1T72A 1FAVA 2BBHA 2KSEA 3ZCJA 4KX6A 1G8XA 5CJ0A 2KYVA 4IFMA 5L3DB 2F4VT 1US7B 3VMYA 3TLSA 1NAYA 3UUXB 1L4AD 3FZLB 4KT0J 3UT5E 4KJMA 2J59M 2XE2A 2LSJA 4PK5A 3H25A 4KUMB 3Q2MA 4E7SA 4JV5T 4HWDA 1RH5B 5HXRA 1Z8UA 2LJLA 5EE2A 2BCCD 1PFIA 2KDYA 3L71D 3ZJ1A 4RJWA 5KDMC 5JTGA 2BVLA 2YU2A 2AEMA 3C5OA 1ZV8A 3L39A 2OYIA 3PORA 3EHZA 1MIYA 2WJQA 2H89A 2HG5D 3IEEA 3L70G 3UPGA 5ABHA 2J58A 3TGUG 1FDMA 3PJAA 3C4ZA 5AFUK 2MJZA 2E43A 3CX5D 2PAJA 3RC3A 3SSUA 4I0UA 3P4PA 1E5WA 4P09A 1KB9I 4B3ST 1YQ3C 5AQKB 1OW7A 4L73A 2LXBA 1IO4A 2WM9A 1SP4A 4IE0A 3RQWA 4IL4A 1X79B 3Q5SA 5LG3A 1Q9GA 4AFKA 3LK3B 5IYUA 4AYCA 5EK2A 4LSIA 3HUSA 2XAHB 3RIUA 2DL1A 2C9NY 2V6XA 2LSIA 2CE7A 1KYOH 4ZEYA 2YKQA 3GHGC 3GN5B 1SQVJ 3VY9X 2NOXA 1BE3J 4EB6E 2E9XB 1NU1D 4F8HA 3FXDB 2H3RA 2N2NA 2XY8B 2CCQA 2LSGA 1AVOA 1IK7A 4PJJA 3AE3C 4KP3C 1HVVA 1ZXGA 2YXRB 2XV5A 2FKWB 3CWBJ 2JWAA 3HKCE 3RBHA 3O6QA 4LF9T 1T98A 5CCGD 5H6RB 1GQEA 1OXZA 1NTKE 1NTKK 2MAWA 1SQXD 4FOZA 2W62A 3I9WA 2XQYA 1HX8A 1Y8AA 1R5SA 5JRCB 1HNXT 1GL2A 4C7RA 3AEFC 1SE7A 5AW8B 5CCHD 3J7Yq 1N32T 1OEDB 5C39A 1ZN5A 4PD4D 1G2CA 3H1ID 1UGOA 3BS0A 3M0DC 4N78E 5AQVB 4ILBA 2N1GA 3RYIE 1HUCA 4IDOA 1T2KD 4IDNA 5DJQC 1GMJA 1DH3A 3R84B 3HOLA 2YKPA 3ZDMA 2AEJA 3SY7A 4OVNF 2IIUA 5BVZA 1JMMA 2ZT9D 3A7OA 5J1GA 5CMZA 2HFED 2JIWA 3L70E 4CTDA 3OPCA 3TGUE 1DIPA 1BXWA 4PV1D 1IBMT 4D65A 3AE7C 4LSEA 4HJGH 2KLVA 4H13D 2YDRA 1DD3A 4EXTA 4A5XA 2CEAA 4NUUA 5C2TA 1LNQA 1USEA 2R88A 2IFNA 2ODVA 2BG9C 2UXXB 3QB5K 3K1SA 4HFHA 3JC6D 4WW0A 5AFUL 5JDMA 3MGNA 1OSMA 1LP1A 2XUEA 3N4XA 5DQVA 5LOVE 3GMAA 4DV1T 2N2LA 4AYNA 5IYZE 2UXBT 3L72G 5KKZC 1T8BA 4HKAA 1WR6A 2WSCJ 2KP8A 3E7KA 5LBMA 2B9BA 3H1KG 1YW0A 3ZKRA 2GK9A 1G73A 3CMAP 3PU3A 3H1LJ 2N9YB 2FJDA 4C7NB 1D0XA 2BKPA 4QHOA 3J9X1 2E76D 4YSZA 2KK7A 1JTHB 3OYZA 2X9YA 1EZ3A 2A06D 3T24A 3PTRB 5CJ4A 3Q2YA 3N2GE 5KJ7C 3P8MC 1YJWP 3L74G 2M67A 3DP7A 3WI5A 1PP9G 3H32B 3B4SA 3SWYA 2ZM0A 2ERVA 4C4VB 2H88A 3TNUB 3CCQP 1NTZJ 4X65T 2VQET 4LFAT 3L75D 1JCDA 4HE8A 4AQGA 3H1JG 4HYTB 1DEEG 5FL1A 2FGRA 4O9BA 4IDPA 3RGLA 1X79A 2AE9A 5CA0E 3O4XE 4PUXA 4HN9A 3GHGB 1YKHB 1K8AQ 3M65A 4JI6T 4H0LD 4DV7T 2QJPC 2F1VA 3Q5PA 2F1CX 3HWBA 2I1KA 2QIWA 3KQGA 5C3JA 2JO1A 3OBVE 5KTBA 1QGKB 1SLQA 1HTJF 3I0OA 3B5NA 1HTLC 2JQHA 3T97B 2MTQA 2WZHA 3E1IA 2XAGB 1UIXA 3CPWO 5LYJE 2CK3H 5KLVD 3A2SX 4XBFB 2D0UA 1J2JB 4YXDC 4YSYA 5LMNT 2VL8A 5KLIC 2UUBT 2JQQA 4TWFA 2XQ8A 4KRAA 1MFTA 1TU3F 2R4LA 1P4TA 2KZIA 1MV8A 1NO4A 4D6TD 2E5TA 1L0LG 4PFPA 1YJ9P 1W2EA 2M0BA 3CXHD 5APVA 1QLBA 4AKLA 2W27A 5EZYE 2UXDT 1QL1A 4JYBA 1FE6A 5LP6E 2BS3A 3I1AA 5KAIO 1SQQG 2VURA 1N7SC 4HFVA 1RF1C 3UU4A 3G3ZA 2VASA 1EZVD 1G90A 1NVOA 2Y2XA 1NTMK 2I59A 3USSA 5AQOB 3L72E 4LSFA 2R5BA 3B8EB 2H7VC 4EZHA 1H0TB 3H1KE 4GT1A 3RF1A 2FYNC 2LM2A 1SQBD 3V2NA 3F5HA 1YIJP 4M3LA 2QG4A 4HTEA 2M06A 3HE5B 2OQQA 3G4SP 2BG9B 3C4XA 4HFBA 1WYCA 2SPCA 2FYUK 4JI2T 2W90A 3L74E 2BCCJ 2OYHC 2NW8A 1T6AA 3L73D 2QA4P 1PP9E 4XNLA 2NPSB 2IDBA 2K3RA 4I7ZC 3SFEC 3G06A 4DBRA 1BCCJ 4GOFA 3ZMSB 3VN0A 4A56A 5LMUT 2Z5IA 3H1JE 2LFUA 1EQ7A 3QNUA 4AUWA 2XM2A 2PP6A 2KOGA 2YPVA 3SFDC 3TK1A 1P84E 1N86A 1VL2A 2P7JA 1S5LH 3CC2P 3UFEA 4TLFA 2QSIA 3BQLA 1Q7YQ 2NRGA 2W67A 2LOSA 2QRXA 3N2KE 4AZLA 4U7JA 1FDIA 3P8CE 4GKGA 2KSRA 3PUQA 5FY7A 3PTZA 4B3TT 2CWOA 2LKGA 1Z0PA 1OMIA 3AEEC 4WY4D 2E5VA 4YT0A 1KFYA 4D64A 1HNWT 2JJLA 3BCCG 2KB7P 2H7HA 1QSDA 4I55E 3RYFE 1FIOA 4U3FJ 5AW0B 3KZIE 2IMLA 1L0ND 2KT9A 3WAJA 2W66A 2A2FX 1FZBA 2MBGA 3NFQA 1L0LK 1L0LE 5DJTB 2I0MA 4ZOLE 2LRLA 2QJYC 3LW5H 1ZV4X 2W2UA 3L3PA 3RPUA 1A02J 1KYOD 2ZYAA 3ANWB 1VQ7P 1E1HB 1SQQE 3G7GA 2WMOA 3Q5RA 3MJXA 4JEHB 2M5AB 1NEKA 1M56D 2D9DA 4OYJA 5KAFH 4O3XB 2X0LB 4IL6X 2NWBA 3Q5XA 5KLIB 3AVRA 2OYIC 5AVWB 2CPBA 2H89C 3PUGA 3T97A 4K0KT 3AXJA 5GTHO 1SQXJ 1KILD 5APSA 3MZWB 1URQA 4NPDA 4PAGA 2KWIB 2BVMA 2WSEJ 3H1IJ 2KZJA 4YPCA 1N7SB 4BJNA 1LTSC 3QK6A 2Y0LA 1Y47A 1JNZA 3PV0F 5FNVE 3ZMZB 3M9HA 4MBQA 5KXJA 1BDCA 4EGWA 4AKIA 4B6XA 1HXUA 2Q3IA 3AAAB 5BU5A 1W0AA 2XNDH 3HUSC 1UUSA 4RESB 2WU2A 3V5SA 2O01N 1HF9A 1D0ZA 3TLTA 4LF8T 2VKDA 3RIUC 1ZHZA 2FYNB 1XZYA 3WUTA 3OA7A 1X9VA 3PQUA 2WVRA 2A45H 3JCUE 2LLYA 1OZHA 1PGQA 3CX7B 4YHJA 3EDVA 2B1EA 1MFZA 3VP9A 1J1DC 1H0TA 2XAJB 2UWJE 2KLQA 2E74B 2OYHB 4NUVA 2JRKA 2XJ7A 2QGSA 3LIEA 2KINB 1GFQA 4BWNA 4I7ZB 1D0YA 4UB8O 4HFIA 2K37A 2LKHA 2CRBA 2C5JA 3KZIH 3AEDA 4EV6A 4K35A 3CCRP 3AVSA 3BCCE 3Q1MA 2NPSA 1AFOA 3H3AA 4BRYA 1T16A 3T8OA 3CX5I 3KV9A 1GL2C 1FJKA 4LF4T 4CQIA 3U3IA 1A02F 2P58A 4AUIA 4UVBB 2CXLA 3C9IA 2XPKA 3C1LA 1VQMP 2QM7A 2KXPA 3CPZA 2XTRA 3PLNA 2A45I 2IYOA 3ZN1B 2N2MA 1HH0A 4JI7T 4HWHA 3H37A 4FUVA 1EDIA 3L75J 2OGUA 1LRZA 2CPTA 1T8ZA 4EI2A 2ZXEB 2V5DA 2XE1A 2NR4A 3PQSA 2NP9A 2WPVB 3ZYLA 3MKDA 4JQ0D 4PR7A 4X64T 2PRRA 3B71A 4TV9E 1MM4A 4IL6E 2WB5A 2QJYB 3ZT7A 3TDKA 3O1IA 4WBAA 2ZM6T 4JEUB 5KJ7D 5CJ5A 1HFAA 3EVYA 1HR0T 3K3OA 3EI0A 2PORA 2ODUA 2OV9A 1BGYG 2YDSA 4QXCB 4JLEA 4XAXB 2CMRA 2XQ4A 8PRNA 5AW5B 1OW8A 1IJ5A 1UIIA 2JP3A 5KLVJ 2WWWA 2KMFA 3ANWA 3AAEB 3IA3A 3IHRA 4Z90A 4N78D 1NH4A 3HW9A 1MMDA 1DD4A 2M5AA 2VRSA 4IL9A 3SYBA 4D6TJ 3JCUH 5ETWA 3QB5A 2VKJA 3DWNA 4BUMX 3A7MA 2IPPA 4WWIA 1YHQP 4RO0A 4EYYR 3TGUD 1KB9E 1OEDE 2V7JA 3RRWA 4PD4I 1IC2A 2DI4A 3AE2A 4U74A 1ZHXA 5BU8B 4JUYA 7PRNA 2H88C 3NKZA 1S4XA 1YBKA 2KZ7A 1VF5B 1HNZT 3HUSB 4LFBT 5PRNA 4DNDA 5BR8T 2UXNB 4AYMC 2W8ZA 5G39A 3FZHB 3TLWA 3K19A 3S4RA 3ABVA 5LB7B 2IX7C 3GF3A 4DR1T 2R8AA 5LJNA 4WBOA 5AQSB 1SQBJ 4JI0T 4UB6E 4U3CA 3AEBA 5DL7A 3SRZA 4EZ4A 4B61A 2ZM8A 2B87A 2FYZA 4EYYQ 3N9OA 3F89A 1EDJA 3ZLIA 5L2LA 2HPLA 5HEHA 1L0VA 4ZZCA 1PHOA 2E75B 4KBMB 3B5NC 4UF0B 4NXMT 1NHLA 1L2PA 3L73J 2X0YA 2W00A 1IFDA 4I4TE 2N9BA 4GCPA 1S3JA 2PJQA 2XE5A 1XTGB 4RKUJ 4P1NA 2YO3A 4IL6H 1T3JA 3LG7A 2E5YA 4U72A 1IFJA 1OVUA 2YNKA 1GL2B 4FZMA 3P4SA 2P2UA 4FSOA 5JVDE 3FB2A 4CXWA 2V1DB 1BE3G 5AVYB 4M1PA 1G2CB 1XMOT 5APQA 1DX7A 1UURA 1BGYE 3P7IA 4ISTA 2X9HA 1MUUA 3Q5WA 1NGMB 3MIWA 2JMHA 2K3WA 2XNXA 2XM1A 3CWBG 4LMLA 3A0HE 2ZAEB 3PGRA 4Y99B 3ZPOA 2XTQA 1PV3A 4EYUA 1BDDA 2PFVA 1SVFA 1L0NJ 1K04A 2BDEA 3WAKA 2WWVA 4CZZB 2WZ7A 2R44A 4FRTA 2WWUA 1KB9H 2PTFA 2VL0A 2BBJA 4AISA 2UUCT 1NJIQ 1Y9BA 1RY3A 3ZSTA 1Q2NA 4NXNT 4QH4A 2J1DG 1AQ5A 3I55P 1LGHB 4G2AA 3KV5A 1LP1B 3U1CA 1QJPA 1L4AA 2FXOA 2ES0A 5LCYA 1FZEA 1CZQA 3HL6A 2W6BA 4G76A 3RL0B 4JYAT 3HI2A 2KNDA 2JQYA 2Q9IA 3KFWX 1Q86Q 3D70A 3HRNA 4JPZB 4H9NC 1G1JA 2IHR1 5AQJB 4LLHA 1UX4A 3AAEA 3TKLB 4UB6H 3L72D 2H43A 1D7MA 1MKMA 3VU7H 2C5IT 3RIAA 3CXHI 3H3MA 2BEZF 3H1KD 1IZNA 4OGQD 3NRXA 3V5UA 2V6YA 3A0BE 1UK5A 4KHZF 1YTZI 2K9AA 2Q3EA 1NAFA 1LTAC 1JEKA 5E0OA 2LHFA 1EZVI 1VOMA 1KZUB 3V6IA 3CQXC 3L74D 5HCMA 1N73B 3POUA 2FUPA 2IAKA 1PP9D 3RL0g 2EHOD 4LMKA 5LXTE 1BR1A 4LF5T 2YINA 3H1LG 3KDPB 3GW6A 3H1JD 2LOPA 4L5GA 1NENA 5J2TE 2POHA 5G3AA 1OVRA 3EWKA 1P84D 1SQVK 3RIFA 3Q5EA 2KWHA 3POXA 2VQFT 3TYYA 3CX8B 1BE3E 1JY3N 2BG9E 1WCRA 3B5NB 4DZOA 1AQTA 2C5KT 2WCAA 2XU6A 4N3YB 3OVUA 4GYRA 2W6JH 2C0SA 3A0HH 4N74A 4NPEA 3RK3E 3LK2B 3UU5A 2WDQA 3AE9A 3MZKB 3CWBE 1FDOA 1YITP 4UF0A 5HEUA 5JH7E 2PRNA 4OYKA 1EDKA 4KHXA 3FGAD 5J0ZA 2ZVOB 1S5LX 3NWIA 1URQC 4E1SA 3V5BA 2FY8A 2OARA 3OTOT 1XWMA 5FXWA 4AQYT 3DWOX 1XTCC 3ZCIA 2YNYA 1Y01A 4YJ2E 3FZFB 1VCTA 4C46A 3N7NA 3WI4A 3I5CA 2XAQB 3CMLA 1GK4A 1QJ9A 2ACXA 3CCMP 4O4LE 5H6QB 1OW6A 1SQQD 1CW5A 5APUA 3AEAA 4YTPA 2XG6A 1THQA 2QJKB 4O4IE 3FHNA 4X1KE 2O1KA 2WY2A 2ZYDA 4CI2B 4GDOA 1WRGA 5FL0A 1S9KE 4LSHA 1Q82Q 3O8ZA 3WI3A 4YLHA 3VRAA 4F6RC 5HAXA 3MD0A 3CX6B 1FMWA 1H8AA 5HXHA 3A0BH 5F5WA 4MLKA 5AVQB 2L5GB 5AVXB 2R89A 3KZIO 2AXTH 1LTBC 1GTWA 5L4EA 3KVDD 1NWQA 5HXCA 3S4UA 4TV8E 2R4OA 2K1AA 2NW9A 2N1TD 1LTJA 1QUUA 2WSFH 2XDJA 4TT3H 4YXWH 2IDOB 4TWHA 3UFGA 2MHLA 2V5CA 2D2CD 1KFNA 2CBIA 1SQPG 3C98B 3AEDC 2G3AA 1NTMG 2L91A 2KS1A 1IK9A 1OWAA 3RK3C 2NPSC 3NSGA 1BR0A 2MOZA 3H1LE 2I1JA 3N9MA 4IREA 2R3SA 1HX1B 2X66A 3TGUJ 3PUSA 5LGUB 4L0RA 5D5DA 2B76A 2IW5B 4O3ZA 5GV0A 1Q90D 1OIPA 3KINB 2V7LA 3BRYA 4QKNA 3UU8A 5JDQA 1SFCB 4PJ0H 3QOFA 1FC2C 4O4HE 5TAOA 2FYUG 2HH7A 4IFDK 1NTZK 1BCCG 4Y28J 4RJXA 1M62A 3AA0A 3KV6A 3EMNX 3L37A 1RHZB 2X51A 4LFCT 2LHNA 1FBMA 1CI6B 3HE4A 2XHEB 1E79H 1N73A 4BA9A 3BCCD 1D1CA 2IC9A 3AA1A 4FMSA 2NW7A 1PGPA 3PUZF 1LVFA 2A45G 2Q9QA 1S5LE 3CK6A 1QJ8A 4RL9A 1M1JB 2XQ5A 5DL8A 4JI1T 4FESA 5AVTB 2ZJSE 1N2DC 1EDLA 4ISSA 3BK9A 4EIJA 2H7OA 2BEQD 5GTIE 2RPAA 3IF8B 3AXJB 3FXEA 4ZS2A 4YSXA 4U3FG 2J62A 2WPRA 1VRBA 2KNCA 3LK2A 1KNZA 4OK0A 1URQB 1KORA 2WQYA 1IFPA 4GYSA 2K5BB 5A1LA 3E0ZA 2BASA 2ODJA 4QXBB 5B5EE 1RF0A 2CHOA 1LKXA 3B5ND 2WT7A 2FJBA 2W63A 2SPZA 5AQLB 1X8YA 3AE2C 4PK6A 4AXPA 4AQFA 2E9XD 2YKSA 1OPFA 3H1HJ 3UUNA 1SA0E 2YEVC 4DMVA 5E79O 1NKZB 3VOPA 4X66T 4IIJE 2WSCH 1DU2A 5AW3B 5JR9B 3C8VA 3ABVC 1SQPE 1SQPK 1GFOA 1NTME 1HXXA 5KAFE 4HFDA 5IUXA 4LMJA 2IYPA 2BS2A 3DJBA 4X5TA 3VE2A 4P0AA 3AEBC 2Q6QA 3AB3B 1LT9B 4H44C 1PPJG 2QA7A 5JDPA 3NZPA 4YY3T 5HXEA 2K88A 2C0WA 2W83C 1KB9D 5TISH 3HKDE 3VE1A 3CCJP 4ASWA 2AXCA 1GW4A 4ZI3C 5G26A 2JR8A 2GM4A 4KMCA 2E74C 4GODA 2FYUE 2MYSA 2OLTA 3B13A 1X0TA 1BCCE 3EFFK 2RMZA 3L71J 2E2AA 5AQRB 3RK3B 1QEXA 4O2BE 3UQ4A 3POQA 3AE4A 1CHUA 4BRYB 3HR0A 1KK7A 1KN7A 3SZVA 4U33A 3H1KJ 2LM9A 3L35A 4IHJE 1N36T 1UX5A 2KXPB 3GG2A 5H2FH 2IBZG 3QC9A 1J1EB 5FY0A 3G71P 4IGUA 4FJOA 1VPCA 2XZEA 5IWAT 1FMVA 5GTIH 1YQ4A 4JI5T 3PURA 2GUVA 3L74J 3BVHA 1PP9J 1U5PA 4PFOA 1GK6A 5FMNA 4GHBA 1SFCA 2DLRA 3PJAJ 4WNKA 4WY4A 2JEEA 2R4NA 1JY3P 1LTTC 1U4QA 3L09A 1JNMA 4U3FE 1KD1Q 2FJEA 3SOLA 3H1JJ 1KQGB 4OWFA 2R4PA 1AVYA 2A06G 3JTYA 2O3JA 5B5EH 3A2AA 3AE5A 3M91A 4ZNCA 3CLQA 3ZEFB 1CI6A 3EFGA 3S9OA 3I56P 5HYAA 4AKRA 2QE7H 3C64A 3D0TA 4ILUA 3T1YT 3SY9A 3LK41 3T1HT 1NU1J 1L4AC 1V9DA 3GLMA 1M1JA 3PGSA 4FZNA 2YN6A 3UUBA 1IBKT 3B5MA 2W0GA 1FZFA 2I6HA 3HOEA 4PJMA 3ITKA 5AQMB 3R6NA 3OAKA 4CI1B 2O01J 3R4YA 2OA5A 4RJTA 2VVNA 2AXDS 3LFMA 4HEAA 1KILA 1PPJE 3CI9A 4CXYA 4PD4E 3U59A 3BASA 1GD2E 1ZP0A 3MXZA 4GOUA 5LG4A 2M3EA 2X68A 3ZYMA 5CA1E 1SQQJ 2KZ7B 3L4FA 2WVPA 1MMAA 3KBTA 4AI6A 1MNDA 5JDGA 3MUDA 4W80A 5LGNB 1VQ6P 3TLUA 4IE4A 2ZVNB 4K3BA 2ZLDA 2CBJA 1VF5C 2P67A 3CX5H 4G75A 4H63V 3A0HO 1MIWA 2CHNA 3NVOA 3L8RA 2CM0A 1KMIZ 4H44B 5DQWA 1D1BA 5FKYA 5JR9A 2B87B 1NYHA 3IF4A 4PJLA 2WS3A 1FU1A 3AA6A 3KBUA 5AQTB 2E8IA 2FGQX 2IBZE 1M7LA 3PH0A 2CXFA 2WZIA 4K3AA 4Z91A 4XFJA 2VKHA 1GU5A 2WTYA 4DUYT 1LT9A 1Z56A 2YU1A 5CBNA 4DR7T 2DWGA 3RKOA 4TNVA 2WITA 3EAMA 3AE9C 3R2PA 4WZXA 3O9XA 4MHCA 2E75C 1JY3O 1BSNA 3RBXA 2HPCB 3FZMB 4JI8T 1XMQT 5L3FB 4A7PA 2K48A 2V26A 5F8PA 4LF7T 4HWFA 2A06E 1LTIC 1WR0A 5ADXK 3L36A 2J4UP 2W81C 3AECA 2XQ3A 3ETUA 2OTKE 3NTNA 1BE3D 5EK3A 1FZCB 3N5LA 3WMM0 1VQ5P 1YKEB 4ZI7E 3AEAC 4YTPC 4HH2A 3PGUA 3QUJA 1PGJA 4UR9A 2D2SA 2NPSD 1IJ6A 1H7CA 3RK2B 3CQGB 1T2KC 1K05A 1M7KA 4ZZBA 4CN6A 1HG5A 4Y99C 2HLOA 2UXCT 4HFCA 2HN1A 1P84I 3HD7A 5KAIE 2WU5A 3FBZA 4PD4H 4DMWA 2WSEH 2XASB 2XQ6A 1NTKD 3FWNA 4G63A 4IT4A 3MA9A 3LBXA 2WPQA 4OHFA 1L4AB 4E1TA 3RKGA 3JADA 2XE3A 5FP3A 5LHGB 4ANJA 2IWWA 2FXPA 1AV1A 1BH3A 2WMMA 1LTJC 3M9QA 3PHLA 2P9BA 1KFMA 1AA0A 3ZMTB 2V7QJ 3JC6C 3AE6A 2YK0A 2JDIH 1ZHCA 2WSSH 1SHZC 4O3WA 3Q5DA 3SWFA 3RL0C 4OX9T 1T7SA 1S9KD 4CI3B 2IFMA 1E7PA 1IZNB 1KNPA 3K3QC 5L8RJ 2V6YB 1VQ9P 1N7LA 4DV6T 4NPFX 3CCVP 3F57A 4E7ZA 4COFA 3FYXA 3L70D 2E76C 2E42A 4YTMA 2P1JA 3PUWF 3C50A 2Y6XA 5ABFB 1WYBA 5AQPB 1E2AA 5HWYA 3SWKA 2Y9ZA 3ZJ2A 2YMKA 2FJAA 3VR8A 4DBQA 1GFNA 1W5CE 3V4QA 4AQRD 5L3GB 3OJAB 1ZHTA 3VMZA 3S1KA 1N73C 1SQBK 4B3RT 1IJDB 2GUSA 4U2ZA 3H1LD 1HXTA 4ILCA 2Q9QC 4ASKA 2HPJA 3KDSE 3EABA 2V7IA 4FQEA 3KYQA 2QEXP 1N7SD 3L73E 5ADXL 3IAOA 5CGMA 2G8YA 5C8YE 5L3EB 4XZCA 3ZMVB 4L9IA 3CQCB 3WUUA 1GFPA 3VYIA 1USDA 2WQYC 5KAIH 4HB1A 2Y48B 5AW2B 1B7TA 2KC0A 3E22E 4DVDA 1K9MQ 2HPCA 1ZR2A 1RF0C 4DR6T 1SQVG 3RBZA 1NKNA 4AQFC 2E5LT 4X20E 4B86A 3UU6A 3VP8A 5JDHA 2E74D 2XZRA 5LNKA 1WMKA 1WFDA 3VRBA 4ZS3A 2RA1A 5AQIB 2BKOA 5GTHE 2IWVA 4AKMA 3G9RA 1FZCA 1OVVA 4YHHT 3DTOA 4QXHB 3SYSA 3ZN0B 3B57A 2QJKC 4GK5E 3CXHH 3MHVA 2KLUA 1S72P 5AQGB 2ZT9B 3VKHA 1YD8G 4QX7B 3UUMA 1FOSF 4W7YA 5AVVB 4MN4C 4PV1B 3LJCA 5LJMA 2Z5HA 2JQ9A 1M57D 1BR4A 2LEHA 4H13B 4AKGA 1HGVA 2ZXXA 2LXCB 3O1JA 3MTUE 5BMVE 1LTJB 4TWDA 4TN7B 5LA6E 1S5LO 3WUVA 5JDLA 4O4UA 2NTXA 1LJ2A 1ZHWA 1HS7A 1J5ET 2KS1B 3HKEE 2QM8A 1SUMB 1XDPA 1KILE 3A5XA 3T0SA 1ZKEA 4DIDB 3AE4C 3AA7A 3CC7P 3LSVA 3ZC0A 1SQPD 4IFFA 4UVCB 1KQSO 1KTMA 1NTMD 2RP4A 2LR2A 1QX8A 2E76B 5FY1A 2IZ1A 5FXZA 4UB8E 2JKVA 1YQ4C 5JQGE 5B5EO 1N34T 4FT6A 2AXTE 1MIVA 4EEBA 4C00A 5APTA 4GIWA 5GONE 3AA0B 1JCCA 4U7YA 2V8SV 3M9BA 3HTKA 1SFCC 1JOCA 4XE5B 3PUAA 4WY4C 2FYUD 3HKBE 4UV9B 5ABFA 4Z8XA 1KNRA 3HE4B 1BCCD 2WMNA 3D6YA 2L3LA 2UUAT 3AEGA 1MMGA 2DW3A 3C4WA 3BATA 4GKKT 3P4QA 2EHOA 3AE5C 3AA1B 2VB6A 3IR9A 3VKGA 2Q9QB 2YIUB 2B89A 2XKMA 3OJAA 2XMXA 5KAFO 5IHYA 4O3YA 3I0QA 3W68A 3PRNA 2K9JA 1SQVE 4H0LB 1EXJA 2DHRA 3EDUA 1IFIA 4C90A 3RI5A 4FRXA 5J2UE 1S2EA 3F2EA 1JUNA 5GTHH 1XDOA 1M1JC 1RE3A 3K8PC 3FXEB 3P8CD 4F4BA 1VF5D 1NTZG 2KNCB 3BRVB 4ERRA 4PJ0E 2WSFJ 4FZLA 2HYNA 1ZW0A 3AAIA 3FBLA 2X9XA 3RRCA 1U7JA 4U3FD 3JAFA 4ZKPA 3CWZB 2XSAA 4DUZT 1KILC 2WT7B 1W9RA 5DL5A 3ESLA 3UU3A 1ZP0C 3P7KA 5CCGA 3P4RA 1ZOYA 4A98A 1L0LD 1H6S1 5DJUB 2E75D 2JPFA 2D5UA 5ABGA 3C51A 4KR4A 1LVKA 3KV4A 3N9PA 2OMFA 3MUDC 5CCHA 5CHXA 3F31A 2WDRA 2H8PD 4U2YA 2R5DA 3VR9A 2KUBA 4BJMA 1XNQT 4AIUA 3MP7B 2L9QA 4U31A 1OFCX 2XQ9A 1HJ0A 3RQUA 4Q25A 5JR9C 1DEBA 1FZGA 2PBIA 2ACZA 4X1IE 1T1LA 1GL2D 1JNRA 1NTKJ 3NMDA 1BT9A 2NTYA 4A97A 4OH8B 4UB8H 1R8IA 4O2AE 1ZLLA 2GA1A 1VQ8P 1PPJD 2VVSA 1LT9C 5AVZB 3AE1A 4MFRA 3H1HG 1KYOI 2WSSV 4H63H 3X1DA 5M1BA 4LF6T 4U9CA 3V8UA 3O0EA 2ZYGA 3TZGA 4ZXLA 2V4HA 1KC8Q 4DT0A 3G6EP 4YFSA 1ZHYA 5B66E 2N1TA 3N2OA 4PK4A 4WYVA 4N59A 3WU2E 2PGDA 5DL6A 2V7MA 5K5GB 1KQFB 3Q9DA 2K4TA 1VQNP 4K3CA 3BQIA 1R5LA 4JFBA 1QLED 4Z3TA 2FBWA 3NXSA 4JBZA 3L70J 1D1AA 3AECC 2IC6A 2K9YA 2R32A 3P50A 3H6PA 2IBZD 5FYMA 4FI5A 1J1EC 4P0BA 2BCCG 1S1CX 3L71G 3BRTB 3RL0D 4WY4B 3A3YB 3OW2O 2DWKA 5TISE 4GKJT 1NTZE 3E1RA 1FJPA 3NZQA 1Q9FA 4QMAA 2Q5UA 3V2PA 5AW1B 2YOEA 3U1AA 1RE4A 2LKMA 2CA5A 3HD7C 4IDQA 4AKRB 5FXVA 3PE0A 4Z1MH 2HODB 3D6ZA 2Z4EA 1ZMEC 3M0AA 4IOIH 4GK0E 3MK7C 3CMEP 3VZTX 3AE8A 4H9PC 3TSIA 1ZRTE 2DCFA 3JCUO 5H2FE 2WPSA 1KEYA 1HBWA 4L75A 2M6BA 3AE6C 3W67A 5APYA 1IFNA 3IFMA 2C0XA 3V2RA 3FWLA 4EEDA 5HWXA 5AQHB 1GFMA 1UCUA 2ZLYA 3LK3A 4IE5A 1KILB 2Q9QD 4AYEC 4QH1A 5CBOA 4R4MA 2JJ9A 4X1YE 1JY2N 1NU1G 5APWA 3CCLP 1FJGT 3H1HE 4MALA 4UXNB 3II6A 4TZ4C 3GN5A 4KR8A 1YS5A 5HEGA 2M3BA 5B66H 1N8RQ 2ZM2A 2E9XA 3KPEA 1I6ZA 3ZMUB 3FXDA 1LWUC 3WU2H 2LT3A 4IE6A 5JDFA 2MKVA 5AQQB 5EK4A 2KI7B 2Y7SA 5AVRB 2FFDC
chains in the Genus database with same CATH topology
1HF8A 4IDZA 1PHOA 3KBUA 3AA6A 4DO0A 4KBMB 2E8IA 4KP3C 4PJJA 3AA6B 4UF0B 5L3CB 2FGQX 2CXFA 3O1HA 2W00A 2VKHA 4I4TE 3CVRA 3HKCE 3RBHA 4GCPA 2YU1A 4UIGA 2PJQA 2XE5A 4GF4A 1T98A 2DWGA 5H6RB 3RKOA 1OXZA 4D5UA 4H9SE 4I50E 4FOZA 2W62A 3O9XA 5JRCA 1S94A 4MHCA 3I9WA 2XQYA 1HX8A 5JRCB 3LG7A 4IE7A 4PW8A 4U72A 2YNKA 3J7Yq 4FZMA 4FSOA 4FMSA 5JVDE 1PRNA 3FB2A 4QQ1A 4CXWA 2V1DB 5L3FB 4FSPA 2K48A 2V26A 5F8PA 2D0TA 4M1PA 3P7IA 4ISTA 5FVNA 3OYXA 5ADXK 2N1GA 2X9HA 2Y8DA 3Q5WA 3RYIE 2J4UP 5DJQC 2W81C 2JMHA 4ZI2C 3DA4A 3ETUA 3R84B 3HOLA 3SY7A 5EK3A 3N5LA 4ZI7E 1YKEB 5J1GA 3ZPOA 2XTQA 3N9NA 4EYUA 2PFVA 3QUJA 2J1NA 2LSYA 1BXWA 2Y0HA 4D65A 2BDEA 2D2SA 3WAKA 1IJ6A 5JDNA 1H7CA 3UAQA 3NBXX 4CZZB 4LSEA 3CQGB 5LBQB 4FRTA 4EXTA 3ZC1A 4XNKA 2WWUA 3VZUX 2CEAA 1HG5A 4NUUA 3T20A 2ODVA 5AFUL 2UXXB 5JDMA 4WW0A 2CXDA 3JC6D 2JMMA 3FBZA 4DMWA 1OSMA 2W61A 2J1DG 2XASB 2XUEA 5DQVA 5LOVE 4G2AA 3KV5A 4G63A 2VK9A 2N2LA 4AYNA 2VWAA 5IYZE 1QJPA 2ES0A 3MA9A 3LBXA 5LCYA 5KMGP 3HL6A 4OHFA 4G76A 4E1TA 3LBXB 3HI2A 2F1TA 2KNDA 3KVBA 4H9QC 2XE3A 4HKAA 5FP3A 1WR6A 5LHGB 3KFWX 4ANJA 5LBMA 1MNEA 1YW0A 2GK9A 5L2LA 1BH3A 1G73A 2P9BA 4H9NC 3PU3A 3ZMTB 5LHIB 4QHOA 2X9WA 1D0XA 3JC6C 1UX4A 3J9X1 2YK0A 1ZEEA 3TKLB 1ZHCA 3AAEA 1SHZC 4O3WA 3OYZA 2A72A 1EZ3A 2X9YA 3VU7H 2LE8A 2C5IT 3PTRB 3T24A 4O49A 4H9RC 3BQKA 3N2GE 1IZNA 4CI3B 1IZNB 1NWMX 3NRXA 3V5UA 2M67A 1WRDA 3DP7A 2K9AA 3K3QC 3WI5A 2ERVA 2ZM0A 1NAFA 4O4JE 3F57A 2O4VA 3K3NA 4E7ZA 2A3DA 5E0OA 2LHFA 3FYXA 1VOMA 3SZDA 4HE8A 4AQGA 3CQXC 3MACA 2FGRA 3C50A 2Y6XA 1X79A 1WYBA 4QX8B 5CA0E 3POUA 3O4XE 2IAKA 5HWYA 4PUXA 2EHOD 4HN9A 5LXTE 1YKHB 1WLXA 3M65A 1BR1A 2M07A 2YINA 1FEWA 3ETVA 3ZJ2A 2Y0KA 4DBQA 2LOPA 1GFNA 4L5GA 5J2TE 2F1VA 3G7GA 3HWBA 5L3GB 1ZHTA 1ORMA 2KWHA 3POXA 3OBVE 3CX8B 1HTJF 3I0OA 2PG8A 1HG2A 1HXTA 1S35A 2C5KT 3U78A 2MTQA 2EHOC 6PRNA 4GCQA 2XAGB 2Q9QC 4GYRA 4ASKA 5LYJE 3A2SX 4XBFB 2D0UA 2C0SA 2HPJA 3KDSE 2V7IA 3LK2B 2VL8A 3GA8A 2JQQA 3MZKB 5ADXL 4KRAA 2CLYC 4UF0A 5JH7E 1P4TA 2PRNA 4OYKA 5L3BB 2QTKA 1CUNA 5C8YE 4PFPA 5L3EB 3DA3A 4XZCA 4AKLA 4AYDC 2BZBA 3GMIA 3ZMVB 4L9IA 5EZYE 5M4YA 4E1SA 3CQCB 3PU8A 1GFPA 1O3XA 5LP6E 4C91A 3I1AA 5FXWA 3KVAA 3ZCIA 2Y48B 3IBPA 1B7TA 2KC0A 3E22E 4YJ2E 3VHLA 4HFVA 4DVDA 2VASA 3WI4A 3I9YA 4K0UA 2XAQB 3CMLA 1G90A 1QJ9A 4N58A 2ACXA 2Y2XA 4O4LE 2I59A 5H6QB 4AQFC 4X20E 3UULA 2XG6A 1THQA 4O4IE 5JDHA 3FHNA 4LSFA 4X1KE 5LNKA 2H7VC 4CI2B 4EZHA 4LSHA 4ZS3A 2RA1A 3WI3A 4YLHA 4AKMA 3QRAA 4UV8B 4F6RC 5HAXA 4HTEA 2M06A 3DTOA 4O8SA 4QXHB 3ZN0B 3CX6B 3SYSA 3B57A 1FMWA 4GK5E 4EAHA 5HXHA 3ZYKA 2X27X 3C4XA 4MLKA 1WYCA 3VKHA 1YD8G 2SPCA 4QX7B 4AKHA 3UUMA 4H9OC 2NW8A 3KVDD 2K0LA 3LJCA 5HXCA 3S4UA 5LJMA 4UEMA 4UVAB 4TV8E 3W15B 4XNLA 4O4XA 4RLBA 1BR4A 2LEHA 2NW9A 4DBRA 3ZMSB 3UTKA 4A56A 4AKGA 1QUUA 2MHLA 2LFUA 3O1JA 2LSKA 2WBLA 5BMVE 4TN7B 5LA6E 2YPVA 3C98B 3RYHE 3UFEA 5JDLA 4O4UA 2NTXA 1OWAA 1ZHWA 1HS7A 3BQLA 3NSGA 1BR0A 2MOZA 2LOSA 3HKEE 3A5XA 3T0SA 3N9MA 4EOZB 4RLCA 1ZKEA 3LK42 3N2KE 2X66A 4AZLA 1BR2A 3PUSA 3AA7A 3PUQA 5LGUB 3ZC0A 4L0RA 4UVCB 5FY7A 3AA7B 5D5DA 2CWOA 2IW5B 3GP6A 2ZMAA 4TUYE 4O3ZA 1Z0PA 2RP4A 4HGAA 5LHHB 5GV0A 3KINB 4C69X 2V7LA 3HA4A 3VZWX 4QKNA 5CB4E 5JDQA 5FY1A 4D64A 5DABA 5FXZA 4O4HE 4OFZA 5TAOA 2HH7A 3SWHA 1MMNA 1QSDA 4RJXA 5JQGE 4I55E 3RYFE 1FIOA 4FT6A 1MIVA 2KT9A 3AA0A 2DNXA 3WAJA 4GIWA 3KV6A 5GONE 3AA0B 3EMNX 2A2FX 2MBGA 3NRYA 2X51A 3GWHA 2LHNA 4ZOLE 1ZV4X 3PUAA 2XHEB 3HKBE 3L3PA 4UV9B 4J2CA 4Z8XA 3RPUA 4BA9A 3QRCA 2WMNA 5F3JA 2L3LA 3ANWB 1MMGA 1MM5A 1E1HB 1D1CA 2IC9A 2WMOA 3C4WA 2NW7A 2EHOA 3AA1A 1LVFA 3MJXA 4JEHB 2Q9QA 3AA1B 2VB6A 3OKQA 3VKGA 2EHOB 1QJ8A 4RL9A 5DL8A 2X67A 2Q9QB 3PDYA 4FESA 4OYJA 3OJAA 2XMXA 4O3XB 5IHYA 2X0LB 3I0QA 4O3YA 4QWNB 3PRNA 4ISSA 2NWBA 3N9QA 3Q5XA 2DHRA 3BK9A 3EDUA 3AVRA 4C90A 2H7OA 3E08A 3PUGA 2CLYB 4FRXA 4V1Av 5J2UE 3F2EA 3EUHA 3IF8B 4CXXA 4ZS2A 4YJ3E 2Z6EA 3K8PC 3FXEB 3P8CD 1VRBA 3LK2A 4F4BA 1KNZA 4OK0A 4PAGA 4ERRA 2KWIB 4GYSA 2BVMA 4FZLA 2K5BB 3AAIA 3ONXA 5A1LA 3E0ZA 3FBLA 4JCHA 2ODJA 2X9XA 2VKOA 2XTLA 4QXBB 3RRCA 4BJNA 3QK6A 3RC8A 1IAPA 2Y0LA 3CWZB 1LKXA 5FNVE 1Y64B 2W63A 3ZMZB 2V7KA 4MBQA 4PK6A 4AXPA 4AQFA 5DL5A 5KX5E 5T5FA 3ESLA 2E9XD 1OPFA 2CWYA 3VY8X 3AAAA 4I43B 3UUNA 4AKIA 4B6XA 1SA0E 3AAAB 1HXUA 3V5SA 2W80C 2YEVC 4DMVA 2JMKA 1H6S1 1HCIA 1D0ZA 4IIJE 3RH3A 2VKDA 1ZHZA 2N9DA 2GE4A 2JPFA 2D5UA 3C51A 4KR4A 5JR9B 3PQUA 1LVKA 1GFOA 2L8KA 3KV4A 3N9PA 3RYCE 1E54A 2OMFA 3F31A 4ADZA 1HXXA 4YHJA 3CX7B 4BJMA 4ZI3D 3EDVA 2B1EA 3DJBA 3VE2A 4P0AA 2E9XC 2L9QA 2XAJB 2KLQA 3AB3B 2ZFGA 4PJNA 2QA7A 3UU2A 5JREA 5JDPA 3CKDA 3NZPA 5HXSA 4NUVA 5HXEA 2JRKA 4EIWA 5JR9C 2WAUA 2PBIA 4X1IE 2QGSA 2KINB 1GFQA 4TX5A 4ZI2D 1D0YA 1BT9A 2NTYA 2K24A 2MNHA 5LGTB 3HKDE 4GCSA 4O2AE 3VE1A 1AJ3A 5FXXA 4AYID 4MFRA 3SS1A 5G26A 4ZI3C 4KMCA 2C5JA 4H63H 2LHRA 2MYSA 2WSSV 3B13A 3AVSA 4U9CA 3V8UA 3O0EA 3TZGA 3N9LA 4UELA 3H3AA 4O2BE 3T8OA 3KV9A 3POQA 4CQIA 4YFSA 4PNIA 3HR0A 3U3IA 1KK7A 4BAYB 3N2OA 4PK4A 1ZHYA 4RJWA 4ZHQE 4AUIA 3SZVA 4UVBB 2CXLA 4N59A 2LM9A 4IHJE 3RX6A 1UX5A 2KXPA 2V7MA 3CPZA 5DL6A 2XTRA 1MPFA 2KXPB 3Q9DA 2K4TA 3ZN1B 3QC9A 2N2MA 5FY0A 4IGUA 3BQIA 3H37A 4FJOA 4WBNE 4JFBA 2G0UA 4Z3TA 4FUVA 2XAFB 1D1AA 1FMVA 1LRZA 2IC6A 3ZCJA 3PURA 1G8XA 2XE1A 5L3DB 5FYMA 3PQSA 2NP9A 1U5PA 3ZYLA 1US7B 3MKDA 4FI5A 4PFOA 5FMNA 4GHBA 4P0BA 2DLRA 4TV9E 1MM4A 4WNKA 3UUXB 1U4QA 3L09A 3SOLA 3UT5E 3O1IA 2DWKA 4JEUB 2XE2A 1HFAA 3EVYA 2LSJA 4PK5A 3K3OA 3NZQA 3Q2MA 4KUMB 4E7SA 5HXRA 1Q9FA 3JTYA 2PORA 2ODUA 4QXCB 2LJLA 5EE2A 2Y7SA 4JLEA 2KDYA 2CA5A 2CMRA 4XAXB 3ZJ1A 3ZEFB 8PRNA 4AKRA 5HYAA 5KDMC 3C64A 2BVLA 2YU2A 4AKRB 5FXVA 3D0TA 1IJ5A 4ILUA 3SY9A 2KMFA 3ANWA 3PE0A 3C5OA 3AAEB 3IHRA 3LK41 3PORA 1MIYA 4N78D 1V9DA 3HW9A 1MMDA 4GK0E 3IEEA 3MK7C 3UPGA 3VZTX 4H9PC 4FZNA 3SYBA 3C4ZA 5AFUK 2DCFA 5ETWA 2W0GA 3RC3A 2VKJA 4BUMX 4P09A 3HOEA 4PJMA 3R6NA 4EYYR 4CI1B 5HWXA 2OA5A 2V7JA 1GFMA 3RRWA 2WM9A 1UCUA 2ZLYA 4IE0A 3LFMA 3LK3A 2DI4A 4HEAA 4U74A 4AFKA 4IE5A 1Q9GA 4CXYA 3LK3B 1ZHXA 4AYEC 2Q9QD 5IYUA 4JUYA 7PRNA 3MXZA 5EK2A 4GOUA 4LSIA 5LG4A 2JJ9A 2KZ7A 2X68A 4X1YE 3ZYMA 5CA1E 2KZ7B 2XAHB 5PRNA 4DNDA 2UXNB 2LSIA 4AYMC 2CE7A 1MMAA 3K19A 3KBTA 4MALA 4UXNB 4AI6A 4TZ4C 1MNDA 3GN5A 5JDGA 5LGNB 1YS5A 4KR8A 3GN5B 3VY9X 5LJNA 4WBOA 4IE4A 2ZM2A 2NOXA 2ZLDA 2E9XA 5DL7A 4EB6E 4G75A 3ZMUB 4H63V 2E9XB 3SRZA 4EZ4A 2LT3A 1MIWA 4IE6A 2ZM8A 5JDFA 4B61A 3FXDB 2CM0A 2H3RA 2N2NA 1D1BA 5DQWA 5EK4A 5JR9A 3N9OA 2CCQA 3ZLIA 2LSGA 4PJLA 2HPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADX L;  3AA6 A;  3AA6 B;  3AA1 A;  2KZ7 A;  5AFU L;  5ADX K;  3AA1 B;  2KZ7 B;  1IZN A;  5AFU K;  1IZN B;  2KXP A;  3AAA A;  2KXP B;  3AA0 A;  3AAA B;  3AA0 B;  3LK4 2;  4AKR A;  3AA7 A;  3LK2 A;  3LK3 A;  3LK2 B;  4AKR B;  3AA7 B;  3LK3 B;  3AAE A;  3AAE B;  3LK4 1; 
#chains in the Genus database with same CATH topology
 1SQX G;  1HF8 A;  4IDZ A;  1LTG C;  2FXM A;  4DO0 A;  3AA6 B;  5L3C B;  3O1H A;  3CVR A;  4UIG A;  4GF4 A;  5HEO A;  2M6I A;  4ZKU A;  4D5U A;  2KSJ A;  4ASV A;  2XSB A;  3NJT A;  4H9S E;  4I50 E;  3H1I G;  1M1K Q;  5JRC A;  1S94 A;  4IL6 O;  3GF7 A;  2C9L Y;  4DV0 T;  4DR5 T;  3LW5 J;  1I94 T;  2BKN A;  4IE7 A;  4PW8 A;  2HR3 A;  2LRK A;  2BCC E;  1OED A;  1AJY A;  3L71 E;  1PRN A;  4QQ1 A;  4X62 T;  1LT1 A;  4FSP A;  2D0T A;  4JF7 A;  1SQP J;  4JBW F;  3FX0 A;  5HEJ A;  5FVN A;  1NTM J;  3OYX A;  5AQN B;  2Y8D A;  3L72 J;  1YI2 P;  4ZI2 C;  3DA4 A;  2ITA A;  4KI0 F;  4JI4 T;  3CX5 E;  4I1L A;  2YXQ B;  2WDV A;  5AQU B;  3N9N A;  4N6J A;  2Y0D A;  4LGD E;  2J1N A;  1VDF A;  2LSY A;  3PP5 A;  4JYC A;  2Y0H A;  3RGU A;  5JDN A;  3NBX X;  5AW6 B;  2JQK A;  5LBQ B;  1VQ4 P;  3ZC1 A;  4XNK A;  1FZC C;  4DV4 T;  3VZU X;  2FYU J;  5KKZ B;  2YDQ A;  3T20 A;  1KF6 A;  4DOJ A;  2CXD A;  4I2L C;  2JMM A;  2W61 A;  1VQO P;  1W09 A;  3HD7 B;  3JSV C;  3JC2 2;  2VK9 A;  3RK2 C;  2VWA A;  1U57 A;  5KMG P;  1VQP P;  3LBX B;  4DR3 T;  1EXI A;  2F1T A;  3KVB A;  4H9Q C;  2JWD A;  3BRZ A;  1MNE A;  5AW9 B;  4C7N A;  1NU1 K;  1NU1 E;  5LHI B;  2J47 A;  2RH0 A;  1MZ9 A;  2X9W A;  1JTH A;  4UB6 O;  1ZEE A;  2IUB A;  1SFC D;  2HOD A;  2A72 A;  1YQ3 A;  2LE8 A;  1BGY D;  5L4H A;  4O49 A;  3L75 G;  3BQK A;  4H9R C;  4ZMD A;  3RHW A;  1HJB A;  3KXD A;  1NWM X;  1WRD A;  3H32 A;  1WT6 A;  4C4V A;  3TNU A;  3CIR A;  4O4J E;  1YJN P;  2O4V A;  1SQX E;  1SQX K;  3K3N A;  2A3D A;  3ZT6 A;  3SZD A;  2QJP B;  3MAC A;  2A9U A;  4ILA A;  4QX8 B;  1L0L J;  2PFX A;  2M8R A;  2NZ2 A;  3GHG A;  4OGQ C;  1SQQ K;  3H1I E;  1WLX A;  2M07 A;  1FEW A;  3ETV A;  2Y0K A;  3DZM A;  1LWU B;  5KLV G;  3LID A;  4I6M C;  4CPG A;  4DV5 T;  1ORM A;  4JI3 T;  5AVU B;  1PZQ A;  2FFD B;  3AE3 A;  2PG8 A;  1GZL A;  3AEG C;  1HG2 A;  3JCF A;  1S35 A;  3U78 A;  4D6T G;  1URQ D;  2EHO C;  6PRN A;  4GCQ A;  4L74 A;  2R3C A;  4HWC A;  3QH9 A;  1J5W A;  3GA8 A;  1YYC A;  2J4G A;  1ZR4 A;  2CLY C;  5L3B B;  2QTK A;  1CUN A;  3AEF A;  1RF1 B;  3DA3 A;  2AEF A;  1EZV G;  1RE3 C;  4EOT A;  4AYD C;  2BZB A;  3GMI A;  4HKZ H;  5M4Y A;  3PU8 A;  2B88 A;  1O3X A;  1GU4 A;  4C91 A;  3D71 A;  3M0D A;  2IZ0 A;  3KVA A;  3IBP A;  3ZT5 A;  4XA4 A;  1P84 H;  3VHL A;  1HGZ A;  3CCU P;  3I9Y A;  4K0U A;  4WB4 A;  5APX A;  2QVA A;  4N58 A;  1VQK P;  1SQB G;  5HCJ A;  3UUL A;  1PGO A;  1FZA A;  3M06 A;  4EDF A;  5CCG C;  1ZOY C;  4NPP A;  3VMA A;  3AE7 A;  1SQV D;  5L47 A;  1G1I A;  3QRA A;  4UV8 B;  5ABE A;  3L73 G;  5AQF B;  3HE5 A;  3UQ7 A;  5CCH C;  4O8S A;  2BG9 A;  4EAH A;  3PF1 A;  3ZYK A;  2X27 X;  3A0B O;  3L75 E;  3M3Z B;  2HHH T;  1PIX A;  2AXT O;  1X22 A;  2O01 H;  4GIF A;  4AKH A;  3RK3 D;  4H9O C;  1QL2 A;  2Y9Y A;  2K0L A;  3CWB D;  1NOH A;  1R8E A;  4NIQ A;  3V2Q A;  4UEM A;  4UVA B;  5FVL A;  5AW7 B;  3W15 B;  2WP9 A;  1Q81 Q;  4O4X A;  3TLV A;  4RLB A;  4GOE A;  2UU9 T;  3BCC J;  3UTK A;  1RQU A;  2ZT9 C;  5TJH A;  4CN1 A;  1JM0 A;  2LSK A;  2WBL A;  3AE1 C;  2W4X A;  5E79 E;  1GDT A;  3RYH E;  2O1J A;  2HN2 A;  4PV1 C;  4U7I A;  5EFW B;  1JMB A;  2W6A A;  3CCS P;  5KJ7 A;  2RN0 A;  4H13 C;  3V4W A;  4EOZ B;  4RLC A;  3LK4 2;  1BR2 A;  5KLV E;  3EQ2 A;  5KLV K;  2QYW A;  2N1T C;  3AA7 B;  3GP6 A;  2ZMA A;  4TUY E;  3ONJ A;  5LHH B;  3HD7 D;  4HGA A;  1GW3 A;  3ZSS A;  1JY2 P;  4CN4 A;  2D2C C;  4C69 X;  1L0N G;  3HA4 A;  3ONL C;  3VZW X;  5CB4 E;  4D6T E;  1QVF O;  2OTL P;  1FOS E;  4PJ0 O;  1BSH A;  5DAB A;  1J1J A;  2FBW C;  4OFZ A;  3CXH E;  3P32 A;  3SWH A;  3PUX F;  1MMN A;  3TF5 A;  4DCK A;  4OGQ B;  2J5U A;  3CCE P;  2YMY A;  2DNX A;  2YO2 A;  4HWI B;  2Y0E A;  5G38 A;  3NRY A;  3GWH A;  2OYO A;  3HTK B;  1XNR T;  1EZV E;  4J2C A;  1IFM A;  3QRC A;  3PUY F;  5F3J A;  2OYI B;  1M8O B;  1MM5 A;  3UAQ A;  1H89 A;  3OKQ A;  1EC5 A;  2EHO B;  1RE4 C;  2ZFC A;  1LWU A;  1VCS A;  2X67 A;  3PDY A;  4YXD A;  4DV3 T;  2X9K A;  3VTP C;  1K73 Q;  4KHP T;  4QWN B;  3N9Q A;  2K9J B;  1SQB E;  1YTZ T;  2FFD A;  1PL5 A;  3E08 A;  1X9B A;  2CLY B;  4V1A v;  1JO5 A;  3EUH A;  4CXX A;  3AE8 C;  1QVG O;  4YJ3 E;  2Z6E A;  2YIU C;  2CPS A;  1YXR A;  2XQ7 A;  3LDQ B;  1HWT C;  4H0L C;  4LC1 A;  1IBL T;  4L76 A;  1CSB A;  2MPK A;  1N7S A;  3ONX A;  3CL3 D;  1RF1 A;  4JCH A;  3QWO C;  3RC8 A;  2VKO A;  2XTL A;  3VMX A;  1IAP A;  1Y64 B;  5AVS B;  1NTZ D;  2XQA A;  2V7K A;  5T5F A;  3P4W A;  5KX5 E;  2CWY A;  3VY8 X;  3AAA A;  5B66 O;  1RQV A;  4I43 B;  4H44 D;  2P10 A;  4TNW A;  3WU2 O;  2W80 C;  2JMK A;  1W0B A;  1J1D B;  2X0H A;  1HCI A;  3CC4 P;  4N75 A;  5E79 H;  5CFB A;  1FS0 E;  3RH3 A;  2N9D A;  2GE4 A;  3PUV F;  2IBZ I;  4DJG A;  2L8K A;  3RYC E;  1E54 A;  3A5T A;  1KV4 A;  4ADZ A;  1T3U A;  2V7Q H;  3PRJ A;  4ZI3 D;  2BS4 A;  5FVK A;  2E9X C;  1ZRT D;  1OX3 A;  2ZFG A;  4PJN A;  3O6Q B;  1JY2 O;  2OYH A;  3UU2 A;  5JRE A;  5AW4 B;  3CKD A;  5HXS A;  1H88 A;  3K5B A;  4W7Z A;  4EIW A;  2WAU A;  2Q7C A;  2WJR A;  3SFE A;  4TX5 A;  4ZI2 D;  4YTN A;  2KIK A;  2MNH A;  1L0N E;  1L0N K;  2K24 A;  5LGT B;  5TIS O;  1M90 Q;  4GCS A;  1AJ3 A;  5FXX A;  4AYI D;  2Y0C A;  3SS1 A;  3IN6 A;  4BXL A;  3SFD A;  2LHR A;  3KHU A;  3UIA A;  1JB0 J;  1N33 T;  2Q1K A;  3JAE A;  1KYO E;  3N9L A;  4UEL A;  4DR4 T;  2R6G F;  4R4L A;  4WVZ A;  3A8Y C;  4PNI A;  4BAY B;  1SS1 A;  2YKO A;  1BGY J;  3H1H D;  1VQL P;  3PJS K;  1OED C;  4ZHQ E;  4DV2 T;  2N1T B;  4DR2 T;  2OTJ P;  3RX6 A;  2RKL A;  3RLF F;  1MPF A;  3AEE A;  5H2F O;  1U7M A;  2D2C B;  1KQL A;  3RK2 D;  1W2B O;  3CD6 P;  3FZK B;  4B3M T;  4WBN E;  2G0U A;  3Q3D A;  4HFE A;  1NTK G;  2XAF B;  5GTI O;  4QH5 A;  2I8D A;  1T72 A;  1FAV A;  2BBH A;  2KSE A;  3ZCJ A;  4KX6 A;  1G8X A;  5CJ0 A;  2KYV A;  4IFM A;  5L3D B;  2F4V T;  1US7 B;  3VMY A;  3TLS A;  1NAY A;  3UUX B;  1L4A D;  3FZL B;  4KT0 J;  3UT5 E;  4KJM A;  2J59 M;  2XE2 A;  2LSJ A;  4PK5 A;  3H25 A;  4KUM B;  3Q2M A;  4E7S A;  4JV5 T;  4HWD A;  1RH5 B;  5HXR A;  1Z8U A;  2LJL A;  5EE2 A;  2BCC D;  1PFI A;  2KDY A;  3L71 D;  3ZJ1 A;  4RJW A;  5KDM C;  5JTG A;  2BVL A;  2YU2 A;  2AEM A;  3C5O A;  1ZV8 A;  3L39 A;  2OYI A;  3POR A;  3EHZ A;  1MIY A;  2WJQ A;  2H89 A;  2HG5 D;  3IEE A;  3L70 G;  3UPG A;  5ABH A;  2J58 A;  3TGU G;  1FDM A;  3PJA A;  3C4Z A;  5AFU K;  2MJZ A;  2E43 A;  3CX5 D;  2PAJ A;  3RC3 A;  3SSU A;  4I0U A;  3P4P A;  1E5W A;  4P09 A;  1KB9 I;  4B3S T;  1YQ3 C;  5AQK B;  1OW7 A;  4L73 A;  2LXB A;  1IO4 A;  2WM9 A;  1SP4 A;  4IE0 A;  3RQW A;  4IL4 A;  1X79 B;  3Q5S A;  5LG3 A;  1Q9G A;  4AFK A;  3LK3 B;  5IYU A;  4AYC A;  5EK2 A;  4LSI A;  3HUS A;  2XAH B;  3RIU A;  2DL1 A;  2C9N Y;  2V6X A;  2LSI A;  2CE7 A;  1KYO H;  4ZEY A;  2YKQ A;  3GHG C;  3GN5 B;  1SQV J;  3VY9 X;  2NOX A;  1BE3 J;  4EB6 E;  2E9X B;  1NU1 D;  4F8H A;  3FXD B;  2H3R A;  2N2N A;  2XY8 B;  2CCQ A;  2LSG A;  1AVO A;  1IK7 A;  4PJJ A;  3AE3 C;  4KP3 C;  1HVV A;  1ZXG A;  2YXR B;  2XV5 A;  2FKW B;  3CWB J;  2JWA A;  3HKC E;  3RBH A;  3O6Q A;  4LF9 T;  1T98 A;  5CCG D;  5H6R B;  1GQE A;  1OXZ A;  1NTK E;  1NTK K;  2MAW A;  1SQX D;  4FOZ A;  2W62 A;  3I9W A;  2XQY A;  1HX8 A;  1Y8A A;  1R5S A;  5JRC B;  1HNX T;  1GL2 A;  4C7R A;  3AEF C;  1SE7 A;  5AW8 B;  5CCH D;  3J7Y q;  1N32 T;  1OED B;  5C39 A;  1ZN5 A;  4PD4 D;  1G2C A;  3H1I D;  1UGO A;  3BS0 A;  3M0D C;  4N78 E;  5AQV B;  4ILB A;  2N1G A;  3RYI E;  1HUC A;  4IDO A;  1T2K D;  4IDN A;  5DJQ C;  1GMJ A;  1DH3 A;  3R84 B;  3HOL A;  2YKP A;  3ZDM A;  2AEJ A;  3SY7 A;  4OVN F;  2IIU A;  5BVZ A;  1JMM A;  2ZT9 D;  3A7O A;  5J1G A;  5CMZ A;  2HFE D;  2JIW A;  3L70 E;  4CTD A;  3OPC A;  3TGU E;  1DIP A;  1BXW A;  4PV1 D;  1IBM T;  4D65 A;  3AE7 C;  4LSE A;  4HJG H;  2KLV A;  4H13 D;  2YDR A;  1DD3 A;  4EXT A;  4A5X A;  2CEA A;  4NUU A;  5C2T A;  1LNQ A;  1USE A;  2R88 A;  2IFN A;  2ODV A;  2BG9 C;  2UXX B;  3QB5 K;  3K1S A;  4HFH A;  3JC6 D;  4WW0 A;  5AFU L;  5JDM A;  3MGN A;  1OSM A;  1LP1 A;  2XUE A;  3N4X A;  5DQV A;  5LOV E;  3GMA A;  4DV1 T;  2N2L A;  4AYN A;  5IYZ E;  2UXB T;  3L72 G;  5KKZ C;  1T8B A;  4HKA A;  1WR6 A;  2WSC J;  2KP8 A;  3E7K A;  5LBM A;  2B9B A;  3H1K G;  1YW0 A;  3ZKR A;  2GK9 A;  1G73 A;  3CMA P;  3PU3 A;  3H1L J;  2N9Y B;  2FJD A;  4C7N B;  1D0X A;  2BKP A;  4QHO A;  3J9X 1;  2E76 D;  4YSZ A;  2KK7 A;  1JTH B;  3OYZ A;  2X9Y A;  1EZ3 A;  2A06 D;  3T24 A;  3PTR B;  5CJ4 A;  3Q2Y A;  3N2G E;  5KJ7 C;  3P8M C;  1YJW P;  3L74 G;  2M67 A;  3DP7 A;  3WI5 A;  1PP9 G;  3H32 B;  3B4S A;  3SWY A;  2ZM0 A;  2ERV A;  4C4V B;  2H88 A;  3TNU B;  3CCQ P;  1NTZ J;  4X65 T;  2VQE T;  4LFA T;  3L75 D;  1JCD A;  4HE8 A;  4AQG A;  3H1J G;  4HYT B;  1DEE G;  5FL1 A;  2FGR A;  4O9B A;  4IDP A;  3RGL A;  1X79 A;  2AE9 A;  5CA0 E;  3O4X E;  4PUX A;  4HN9 A;  3GHG B;  1YKH B;  1K8A Q;  3M65 A;  4JI6 T;  4H0L D;  4DV7 T;  2QJP C;  2F1V A;  3Q5P A;  2F1C X;  3HWB A;  2I1K A;  2QIW A;  3KQG A;  5C3J A;  2JO1 A;  3OBV E;  5KTB A;  1QGK B;  1SLQ A;  1HTJ F;  3I0O A;  3B5N A;  1HTL C;  2JQH A;  3T97 B;  2MTQ A;  2WZH A;  3E1I A;  2XAG B;  1UIX A;  3CPW O;  5LYJ E;  2CK3 H;  5KLV D;  3A2S X;  4XBF B;  2D0U A;  1J2J B;  4YXD C;  4YSY A;  5LMN T;  2VL8 A;  5KLI C;  2UUB T;  2JQQ A;  4TWF A;  2XQ8 A;  4KRA A;  1MFT A;  1TU3 F;  2R4L A;  1P4T A;  2KZI A;  1MV8 A;  1NO4 A;  4D6T D;  2E5T A;  1L0L G;  4PFP A;  1YJ9 P;  1W2E A;  2M0B A;  3CXH D;  5APV A;  1QLB A;  4AKL A;  2W27 A;  5EZY E;  2UXD T;  1QL1 A;  4JYB A;  1FE6 A;  5LP6 E;  2BS3 A;  3I1A A;  5KAI O;  1SQQ G;  2VUR A;  1N7S C;  4HFV A;  1RF1 C;  3UU4 A;  3G3Z A;  2VAS A;  1EZV D;  1G90 A;  1NVO A;  2Y2X A;  1NTM K;  2I59 A;  3USS A;  5AQO B;  3L72 E;  4LSF A;  2R5B A;  3B8E B;  2H7V C;  4EZH A;  1H0T B;  3H1K E;  4GT1 A;  3RF1 A;  2FYN C;  2LM2 A;  1SQB D;  3V2N A;  3F5H A;  1YIJ P;  4M3L A;  2QG4 A;  4HTE A;  2M06 A;  3HE5 B;  2OQQ A;  3G4S P;  2BG9 B;  3C4X A;  4HFB A;  1WYC A;  2SPC A;  2FYU K;  4JI2 T;  2W90 A;  3L74 E;  2BCC J;  2OYH C;  2NW8 A;  1T6A A;  3L73 D;  2QA4 P;  1PP9 E;  4XNL A;  2NPS B;  2IDB A;  2K3R A;  4I7Z C;  3SFE C;  3G06 A;  4DBR A;  1BCC J;  4GOF A;  3ZMS B;  3VN0 A;  4A56 A;  5LMU T;  2Z5I A;  3H1J E;  2LFU A;  1EQ7 A;  3QNU A;  4AUW A;  2XM2 A;  2PP6 A;  2KOG A;  2YPV A;  3SFD C;  3TK1 A;  1P84 E;  1N86 A;  1VL2 A;  2P7J A;  1S5L H;  3CC2 P;  3UFE A;  4TLF A;  2QSI A;  3BQL A;  1Q7Y Q;  2NRG A;  2W67 A;  2LOS A;  2QRX A;  3N2K E;  4AZL A;  4U7J A;  1FDI A;  3P8C E;  4GKG A;  2KSR A;  3PUQ A;  5FY7 A;  3PTZ A;  4B3T T;  2CWO A;  2LKG A;  1Z0P A;  1OMI A;  3AEE C;  4WY4 D;  2E5V A;  4YT0 A;  1KFY A;  4D64 A;  1HNW T;  2JJL A;  3BCC G;  2KB7 P;  2H7H A;  1QSD A;  4I55 E;  3RYF E;  1FIO A;  4U3F J;  5AW0 B;  3KZI E;  2IML A;  1L0N D;  2KT9 A;  3WAJ A;  2W66 A;  2A2F X;  1FZB A;  2MBG A;  3NFQ A;  1L0L K;  1L0L E;  5DJT B;  2I0M A;  4ZOL E;  2LRL A;  2QJY C;  3LW5 H;  1ZV4 X;  2W2U A;  3L3P A;  3RPU A;  1A02 J;  1KYO D;  2ZYA A;  3ANW B;  1VQ7 P;  1E1H B;  1SQQ E;  3G7G A;  2WMO A;  3Q5R A;  3MJX A;  4JEH B;  2M5A B;  1NEK A;  1M56 D;  2D9D A;  4OYJ A;  5KAF H;  4O3X B;  2X0L B;  4IL6 X;  2NWB A;  3Q5X A;  5KLI B;  3AVR A;  2OYI C;  5AVW B;  2CPB A;  2H89 C;  3PUG A;  3T97 A;  4K0K T;  3AXJ A;  5GTH O;  1SQX J;  1KIL D;  5APS A;  3MZW B;  1URQ A;  4NPD A;  4PAG A;  2KWI B;  2BVM A;  2WSE J;  3H1I J;  2KZJ A;  4YPC A;  1N7S B;  4BJN A;  1LTS C;  3QK6 A;  2Y0L A;  1Y47 A;  1JNZ A;  3PV0 F;  5FNV E;  3ZMZ B;  3M9H A;  4MBQ A;  5KXJ A;  1BDC A;  4EGW A;  4AKI A;  4B6X A;  1HXU A;  2Q3I A;  3AAA B;  5BU5 A;  1W0A A;  2XND H;  3HUS C;  1UUS A;  4RES B;  2WU2 A;  3V5S A;  2O01 N;  1HF9 A;  1D0Z A;  3TLT A;  4LF8 T;  2VKD A;  3RIU C;  1ZHZ A;  2FYN B;  1XZY A;  3WUT A;  3OA7 A;  1X9V A;  3PQU A;  2WVR A;  2A45 H;  3JCU E;  2LLY A;  1OZH A;  1PGQ A;  3CX7 B;  4YHJ A;  3EDV A;  2B1E A;  1MFZ A;  3VP9 A;  1J1D C;  1H0T A;  2XAJ B;  2UWJ E;  2KLQ A;  2E74 B;  2OYH B;  4NUV A;  2JRK A;  2XJ7 A;  2QGS A;  3LIE A;  2KIN B;  1GFQ A;  4BWN A;  4I7Z B;  1D0Y A;  4UB8 O;  4HFI A;  2K37 A;  2LKH A;  2CRB A;  2C5J A;  3KZI H;  3AED A;  4EV6 A;  4K35 A;  3CCR P;  3AVS A;  3BCC E;  3Q1M A;  2NPS A;  1AFO A;  3H3A A;  4BRY A;  1T16 A;  3T8O A;  3CX5 I;  3KV9 A;  1GL2 C;  1FJK A;  4LF4 T;  4CQI A;  3U3I A;  1A02 F;  2P58 A;  4AUI A;  4UVB B;  2CXL A;  3C9I A;  2XPK A;  3C1L A;  1VQM P;  2QM7 A;  2KXP A;  3CPZ A;  2XTR A;  3PLN A;  2A45 I;  2IYO A;  3ZN1 B;  2N2M A;  1HH0 A;  4JI7 T;  4HWH A;  3H37 A;  4FUV A;  1EDI A;  3L75 J;  2OGU A;  1LRZ A;  2CPT A;  1T8Z A;  4EI2 A;  2ZXE B;  2V5D A;  2XE1 A;  2NR4 A;  3PQS A;  2NP9 A;  2WPV B;  3ZYL A;  3MKD A;  4JQ0 D;  4PR7 A;  4X64 T;  2PRR A;  3B71 A;  4TV9 E;  1MM4 A;  4IL6 E;  2WB5 A;  2QJY B;  3ZT7 A;  3TDK A;  3O1I A;  4WBA A;  2ZM6 T;  4JEU B;  5KJ7 D;  5CJ5 A;  1HFA A;  3EVY A;  1HR0 T;  3K3O A;  3EI0 A;  2POR A;  2ODU A;  2OV9 A;  1BGY G;  2YDS A;  4QXC B;  4JLE A;  4XAX B;  2CMR A;  2XQ4 A;  8PRN A;  5AW5 B;  1OW8 A;  1IJ5 A;  1UII A;  2JP3 A;  5KLV J;  2WWW A;  2KMF A;  3ANW A;  3AAE B;  3IA3 A;  3IHR A;  4Z90 A;  4N78 D;  1NH4 A;  3HW9 A;  1MMD A;  1DD4 A;  2M5A A;  2VRS A;  4IL9 A;  3SYB A;  4D6T J;  3JCU H;  5ETW A;  3QB5 A;  2VKJ A;  3DWN A;  4BUM X;  3A7M A;  2IPP A;  4WWI A;  1YHQ P;  4RO0 A;  4EYY R;  3TGU D;  1KB9 E;  1OED E;  2V7J A;  3RRW A;  4PD4 I;  1IC2 A;  2DI4 A;  3AE2 A;  4U74 A;  1ZHX A;  5BU8 B;  4JUY A;  7PRN A;  2H88 C;  3NKZ A;  1S4X A;  1YBK A;  2KZ7 A;  1VF5 B;  1HNZ T;  3HUS B;  4LFB T;  5PRN A;  4DND A;  5BR8 T;  2UXN B;  4AYM C;  2W8Z A;  5G39 A;  3FZH B;  3TLW A;  3K19 A;  3S4R A;  3ABV A;  5LB7 B;  2IX7 C;  3GF3 A;  4DR1 T;  2R8A A;  5LJN A;  4WBO A;  5AQS B;  1SQB J;  4JI0 T;  4UB6 E;  4U3C A;  3AEB A;  5DL7 A;  3SRZ A;  4EZ4 A;  4B61 A;  2ZM8 A;  2B87 A;  2FYZ A;  4EYY Q;  3N9O A;  3F89 A;  1EDJ A;  3ZLI A;  5L2L A;  2HPL A;  5HEH A;  1L0V A;  4ZZC A;  1PHO A;  2E75 B;  4KBM B;  3B5N C;  4UF0 B;  4NXM T;  1NHL A;  1L2P A;  3L73 J;  2X0Y A;  2W00 A;  1IFD A;  4I4T E;  2N9B A;  4GCP A;  1S3J A;  2PJQ A;  2XE5 A;  1XTG B;  4RKU J;  4P1N A;  2YO3 A;  4IL6 H;  1T3J A;  3LG7 A;  2E5Y A;  4U72 A;  1IFJ A;  1OVU A;  2YNK A;  1GL2 B;  4FZM A;  3P4S A;  2P2U A;  4FSO A;  5JVD E;  3FB2 A;  4CXW A;  2V1D B;  1BE3 G;  5AVY B;  4M1P A;  1G2C B;  1XMO T;  5APQ A;  1DX7 A;  1UUR A;  1BGY E;  3P7I A;  4IST A;  2X9H A;  1MUU A;  3Q5W A;  1NGM B;  3MIW A;  2JMH A;  2K3W A;  2XNX A;  2XM1 A;  3CWB G;  4LML A;  3A0H E;  2ZAE B;  3PGR A;  4Y99 B;  3ZPO A;  2XTQ A;  1PV3 A;  4EYU A;  1BDD A;  2PFV A;  1SVF A;  1L0N J;  1K04 A;  2BDE A;  3WAK A;  2WWV A;  4CZZ B;  2WZ7 A;  2R44 A;  4FRT A;  2WWU A;  1KB9 H;  2PTF A;  2VL0 A;  2BBJ A;  4AIS A;  2UUC T;  1NJI Q;  1Y9B A;  1RY3 A;  3ZST A;  1Q2N A;  4NXN T;  4QH4 A;  2J1D G;  1AQ5 A;  3I55 P;  1LGH B;  4G2A A;  3KV5 A;  1LP1 B;  3U1C A;  1QJP A;  1L4A A;  2FXO A;  2ES0 A;  5LCY A;  1FZE A;  1CZQ A;  3HL6 A;  2W6B A;  4G76 A;  3RL0 B;  4JYA T;  3HI2 A;  2KND A;  2JQY A;  2Q9I A;  3KFW X;  1Q86 Q;  3D70 A;  3HRN A;  4JPZ B;  4H9N C;  1G1J A;  2IHR 1;  5AQJ B;  4LLH A;  1UX4 A;  3AAE A;  3TKL B;  4UB6 H;  3L72 D;  2H43 A;  1D7M A;  1MKM A;  3VU7 H;  2C5I T;  3RIA A;  3CXH I;  3H3M A;  2BEZ F;  3H1K D;  1IZN A;  4OGQ D;  3NRX A;  3V5U A;  2V6Y A;  3A0B E;  1UK5 A;  4KHZ F;  1YTZ I;  2K9A A;  2Q3E A;  1NAF A;  1LTA C;  1JEK A;  5E0O A;  2LHF A;  1EZV I;  1VOM A;  1KZU B;  3V6I A;  3CQX C;  3L74 D;  5HCM A;  1N73 B;  3POU A;  2FUP A;  2IAK A;  1PP9 D;  3RL0 g;  2EHO D;  4LMK A;  5LXT E;  1BR1 A;  4LF5 T;  2YIN A;  3H1L G;  3KDP B;  3GW6 A;  3H1J D;  2LOP A;  4L5G A;  1NEN A;  5J2T E;  2POH A;  5G3A A;  1OVR A;  3EWK A;  1P84 D;  1SQV K;  3RIF A;  3Q5E A;  2KWH A;  3POX A;  2VQF T;  3TYY A;  3CX8 B;  1BE3 E;  1JY3 N;  2BG9 E;  1WCR A;  3B5N B;  4DZO A;  1AQT A;  2C5K T;  2WCA A;  2XU6 A;  4N3Y B;  3OVU A;  4GYR A;  2W6J H;  2C0S A;  3A0H H;  4N74 A;  4NPE A;  3RK3 E;  3LK2 B;  3UU5 A;  2WDQ A;  3AE9 A;  3MZK B;  3CWB E;  1FDO A;  1YIT P;  4UF0 A;  5HEU A;  5JH7 E;  2PRN A;  4OYK A;  1EDK A;  4KHX A;  3FGA D;  5J0Z A;  2ZVO B;  1S5L X;  3NWI A;  1URQ C;  4E1S A;  3V5B A;  2FY8 A;  2OAR A;  3OTO T;  1XWM A;  5FXW A;  4AQY T;  3DWO X;  1XTC C;  3ZCI A;  2YNY A;  1Y01 A;  4YJ2 E;  3FZF B;  1VCT A;  4C46 A;  3N7N A;  3WI4 A;  3I5C A;  2XAQ B;  3CML A;  1GK4 A;  1QJ9 A;  2ACX A;  3CCM P;  4O4L E;  5H6Q B;  1OW6 A;  1SQQ D;  1CW5 A;  5APU A;  3AEA A;  4YTP A;  2XG6 A;  1THQ A;  2QJK B;  4O4I E;  3FHN A;  4X1K E;  2O1K A;  2WY2 A;  2ZYD A;  4CI2 B;  4GDO A;  1WRG A;  5FL0 A;  1S9K E;  4LSH A;  1Q82 Q;  3O8Z A;  3WI3 A;  4YLH A;  3VRA A;  4F6R C;  5HAX A;  3MD0 A;  3CX6 B;  1FMW A;  1H8A A;  5HXH A;  3A0B H;  5F5W A;  4MLK A;  5AVQ B;  2L5G B;  5AVX B;  2R89 A;  3KZI O;  2AXT H;  1LTB C;  1GTW A;  5L4E A;  3KVD D;  1NWQ A;  5HXC A;  3S4U A;  4TV8 E;  2R4O A;  2K1A A;  2NW9 A;  2N1T D;  1LTJ A;  1QUU A;  2WSF H;  2XDJ A;  4TT3 H;  4YXW H;  2IDO B;  4TWH A;  3UFG A;  2MHL A;  2V5C A;  2D2C D;  1KFN A;  2CBI A;  1SQP G;  3C98 B;  3AED C;  2G3A A;  1NTM G;  2L91 A;  2KS1 A;  1IK9 A;  1OWA A;  3RK3 C;  2NPS C;  3NSG A;  1BR0 A;  2MOZ A;  3H1L E;  2I1J A;  3N9M A;  4IRE A;  2R3S A;  1HX1 B;  2X66 A;  3TGU J;  3PUS A;  5LGU B;  4L0R A;  5D5D A;  2B76 A;  2IW5 B;  4O3Z A;  5GV0 A;  1Q90 D;  1OIP A;  3KIN B;  2V7L A;  3BRY A;  4QKN A;  3UU8 A;  5JDQ A;  1SFC B;  4PJ0 H;  3QOF A;  1FC2 C;  4O4H E;  5TAO A;  2FYU G;  2HH7 A;  4IFD K;  1NTZ K;  1BCC G;  4Y28 J;  4RJX A;  1M62 A;  3AA0 A;  3KV6 A;  3EMN X;  3L37 A;  1RHZ B;  2X51 A;  4LFC T;  2LHN A;  1FBM A;  1CI6 B;  3HE4 A;  2XHE B;  1E79 H;  1N73 A;  4BA9 A;  3BCC D;  1D1C A;  2IC9 A;  3AA1 A;  4FMS A;  2NW7 A;  1PGP A;  3PUZ F;  1LVF A;  2A45 G;  2Q9Q A;  1S5L E;  3CK6 A;  1QJ8 A;  4RL9 A;  1M1J B;  2XQ5 A;  5DL8 A;  4JI1 T;  4FES A;  5AVT B;  2ZJS E;  1N2D C;  1EDL A;  4ISS A;  3BK9 A;  4EIJ A;  2H7O A;  2BEQ D;  5GTI E;  2RPA A;  3IF8 B;  3AXJ B;  3FXE A;  4ZS2 A;  4YSX A;  4U3F G;  2J62 A;  2WPR A;  1VRB A;  2KNC A;  3LK2 A;  1KNZ A;  4OK0 A;  1URQ B;  1KOR A;  2WQY A;  1IFP A;  4GYS A;  2K5B B;  5A1L A;  3E0Z A;  2BAS A;  2ODJ A;  4QXB B;  5B5E E;  1RF0 A;  2CHO A;  1LKX A;  3B5N D;  2WT7 A;  2FJB A;  2W63 A;  2SPZ A;  5AQL B;  1X8Y A;  3AE2 C;  4PK6 A;  4AXP A;  4AQF A;  2E9X D;  2YKS A;  1OPF A;  3H1H J;  3UUN A;  1SA0 E;  2YEV C;  4DMV A;  5E79 O;  1NKZ B;  3VOP A;  4X66 T;  4IIJ E;  2WSC H;  1DU2 A;  5AW3 B;  5JR9 B;  3C8V A;  3ABV C;  1SQP E;  1SQP K;  1GFO A;  1NTM E;  1HXX A;  5KAF E;  4HFD A;  5IUX A;  4LMJ A;  2IYP A;  2BS2 A;  3DJB A;  4X5T A;  3VE2 A;  4P0A A;  3AEB C;  2Q6Q A;  3AB3 B;  1LT9 B;  4H44 C;  1PPJ G;  2QA7 A;  5JDP A;  3NZP A;  4YY3 T;  5HXE A;  2K88 A;  2C0W A;  2W83 C;  1KB9 D;  5TIS H;  3HKD E;  3VE1 A;  3CCJ P;  4ASW A;  2AXC A;  1GW4 A;  4ZI3 C;  5G26 A;  2JR8 A;  2GM4 A;  4KMC A;  2E74 C;  4GOD A;  2FYU E;  2MYS A;  2OLT A;  3B13 A;  1X0T A;  1BCC E;  3EFF K;  2RMZ A;  3L71 J;  2E2A A;  5AQR B;  3RK3 B;  1QEX A;  4O2B E;  3UQ4 A;  3POQ A;  3AE4 A;  1CHU A;  4BRY B;  3HR0 A;  1KK7 A;  1KN7 A;  3SZV A;  4U33 A;  3H1K J;  2LM9 A;  3L35 A;  4IHJ E;  1N36 T;  1UX5 A;  2KXP B;  3GG2 A;  5H2F H;  2IBZ G;  3QC9 A;  1J1E B;  5FY0 A;  3G71 P;  4IGU A;  4FJO A;  1VPC A;  2XZE A;  5IWA T;  1FMV A;  5GTI H;  1YQ4 A;  4JI5 T;  3PUR A;  2GUV A;  3L74 J;  3BVH A;  1PP9 J;  1U5P A;  4PFO A;  1GK6 A;  5FMN A;  4GHB A;  1SFC A;  2DLR A;  3PJA J;  4WNK A;  4WY4 A;  2JEE A;  2R4N A;  1JY3 P;  1LTT C;  1U4Q A;  3L09 A;  1JNM A;  4U3F E;  1KD1 Q;  2FJE A;  3SOL A;  3H1J J;  1KQG B;  4OWF A;  2R4P A;  1AVY A;  2A06 G;  3JTY A;  2O3J A;  5B5E H;  3A2A A;  3AE5 A;  3M91 A;  4ZNC A;  3CLQ A;  3ZEF B;  1CI6 A;  3EFG A;  3S9O A;  3I56 P;  5HYA A;  4AKR A;  2QE7 H;  3C64 A;  3D0T A;  4ILU A;  3T1Y T;  3SY9 A;  3LK4 1;  3T1H T;  1NU1 J;  1L4A C;  1V9D A;  3GLM A;  1M1J A;  3PGS A;  4FZN A;  2YN6 A;  3UUB A;  1IBK T;  3B5M A;  2W0G A;  1FZF A;  2I6H A;  3HOE A;  4PJM A;  3ITK A;  5AQM B;  3R6N A;  3OAK A;  4CI1 B;  2O01 J;  3R4Y A;  2OA5 A;  4RJT A;  2VVN A;  2AXD S;  3LFM A;  4HEA A;  1KIL A;  1PPJ E;  3CI9 A;  4CXY A;  4PD4 E;  3U59 A;  3BAS A;  1GD2 E;  1ZP0 A;  3MXZ A;  4GOU A;  5LG4 A;  2M3E A;  2X68 A;  3ZYM A;  5CA1 E;  1SQQ J;  2KZ7 B;  3L4F A;  2WVP A;  1MMA A;  3KBT A;  4AI6 A;  1MND A;  5JDG A;  3MUD A;  4W80 A;  5LGN B;  1VQ6 P;  3TLU A;  4IE4 A;  2ZVN B;  4K3B A;  2ZLD A;  2CBJ A;  1VF5 C;  2P67 A;  3CX5 H;  4G75 A;  4H63 V;  3A0H O;  1MIW A;  2CHN A;  3NVO A;  3L8R A;  2CM0 A;  1KMI Z;  4H44 B;  5DQW A;  1D1B A;  5FKY A;  5JR9 A;  2B87 B;  1NYH A;  3IF4 A;  4PJL A;  2WS3 A;  1FU1 A;  3AA6 A;  3KBU A;  5AQT B;  2E8I A;  2FGQ X;  2IBZ E;  1M7L A;  3PH0 A;  2CXF A;  2WZI A;  4K3A A;  4Z91 A;  4XFJ A;  2VKH A;  1GU5 A;  2WTY A;  4DUY T;  1LT9 A;  1Z56 A;  2YU1 A;  5CBN A;  4DR7 T;  2DWG A;  3RKO A;  4TNV A;  2WIT A;  3EAM A;  3AE9 C;  3R2P A;  4WZX A;  3O9X A;  4MHC A;  2E75 C;  1JY3 O;  1BSN A;  3RBX A;  2HPC B;  3FZM B;  4JI8 T;  1XMQ T;  5L3F B;  4A7P A;  2K48 A;  2V26 A;  5F8P A;  4LF7 T;  4HWF A;  2A06 E;  1LTI C;  1WR0 A;  5ADX K;  3L36 A;  2J4U P;  2W81 C;  3AEC A;  2XQ3 A;  3ETU A;  2OTK E;  3NTN A;  1BE3 D;  5EK3 A;  1FZC B;  3N5L A;  3WMM 0;  1VQ5 P;  1YKE B;  4ZI7 E;  3AEA C;  4YTP C;  4HH2 A;  3PGU A;  3QUJ A;  1PGJ A;  4UR9 A;  2D2S A;  2NPS D;  1IJ6 A;  1H7C A;  3RK2 B;  3CQG B;  1T2K C;  1K05 A;  1M7K A;  4ZZB A;  4CN6 A;  1HG5 A;  4Y99 C;  2HLO A;  2UXC T;  4HFC A;  2HN1 A;  1P84 I;  3HD7 A;  5KAI E;  2WU5 A;  3FBZ A;  4PD4 H;  4DMW A;  2WSE H;  2XAS B;  2XQ6 A;  1NTK D;  3FWN A;  4G63 A;  4IT4 A;  3MA9 A;  3LBX A;  2WPQ A;  4OHF A;  1L4A B;  4E1T A;  3RKG A;  3JAD A;  2XE3 A;  5FP3 A;  5LHG B;  4ANJ A;  2IWW A;  2FXP A;  1AV1 A;  1BH3 A;  2WMM A;  1LTJ C;  3M9Q A;  3PHL A;  2P9B A;  1KFM A;  1AA0 A;  3ZMT B;  2V7Q J;  3JC6 C;  3AE6 A;  2YK0 A;  2JDI H;  1ZHC A;  2WSS H;  1SHZ C;  4O3W A;  3Q5D A;  3SWF A;  3RL0 C;  4OX9 T;  1T7S A;  1S9K D;  4CI3 B;  2IFM A;  1E7P A;  1IZN B;  1KNP A;  3K3Q C;  5L8R J;  2V6Y B;  1VQ9 P;  1N7L A;  4DV6 T;  4NPF X;  3CCV P;  3F57 A;  4E7Z A;  4COF A;  3FYX A;  3L70 D;  2E76 C;  2E42 A;  4YTM A;  2P1J A;  3PUW F;  3C50 A;  2Y6X A;  5ABF B;  1WYB A;  5AQP B;  1E2A A;  5HWY A;  3SWK A;  2Y9Z A;  3ZJ2 A;  2YMK A;  2FJA A;  3VR8 A;  4DBQ A;  1GFN A;  1W5C E;  3V4Q A;  4AQR D;  5L3G B;  3OJA B;  1ZHT A;  3VMZ A;  3S1K A;  1N73 C;  1SQB K;  4B3R T;  1IJD B;  2GUS A;  4U2Z A;  3H1L D;  1HXT A;  4ILC A;  2Q9Q C;  4ASK A;  2HPJ A;  3KDS E;  3EAB A;  2V7I A;  4FQE A;  3KYQ A;  2QEX P;  1N7S D;  3L73 E;  5ADX L;  3IAO A;  5CGM A;  2G8Y A;  5C8Y E;  5L3E B;  4XZC A;  3ZMV B;  4L9I A;  3CQC B;  3WUU A;  1GFP A;  3VYI A;  1USD A;  2WQY C;  5KAI H;  4HB1 A;  2Y48 B;  5AW2 B;  1B7T A;  2KC0 A;  3E22 E;  4DVD A;  1K9M Q;  2HPC A;  1ZR2 A;  1RF0 C;  4DR6 T;  1SQV G;  3RBZ A;  1NKN A;  4AQF C;  2E5L T;  4X20 E;  4B86 A;  3UU6 A;  3VP8 A;  5JDH A;  2E74 D;  2XZR A;  5LNK A;  1WMK A;  1WFD A;  3VRB A;  4ZS3 A;  2RA1 A;  5AQI B;  2BKO A;  5GTH E;  2IWV A;  4AKM A;  3G9R A;  1FZC A;  1OVV A;  4YHH T;  3DTO A;  4QXH B;  3SYS A;  3ZN0 B;  3B57 A;  2QJK C;  4GK5 E;  3CXH H;  3MHV A;  2KLU A;  1S72 P;  5AQG B;  2ZT9 B;  3VKH A;  1YD8 G;  4QX7 B;  3UUM A;  1FOS F;  4W7Y A;  5AVV B;  4MN4 C;  4PV1 B;  3LJC A;  5LJM A;  2Z5H A;  2JQ9 A;  1M57 D;  1BR4 A;  2LEH A;  4H13 B;  4AKG A;  1HGV A;  2ZXX A;  2LXC B;  3O1J A;  3MTU E;  5BMV E;  1LTJ B;  4TWD A;  4TN7 B;  5LA6 E;  1S5L O;  3WUV A;  5JDL A;  4O4U A;  2NTX A;  1LJ2 A;  1ZHW A;  1HS7 A;  1J5E T;  2KS1 B;  3HKE E;  2QM8 A;  1SUM B;  1XDP A;  1KIL E;  3A5X A;  3T0S A;  1ZKE A;  4DID B;  3AE4 C;  3AA7 A;  3CC7 P;  3LSV A;  3ZC0 A;  1SQP D;  4IFF A;  4UVC B;  1KQS O;  1KTM A;  1NTM D;  2RP4 A;  2LR2 A;  1QX8 A;  2E76 B;  5FY1 A;  2IZ1 A;  5FXZ A;  4UB8 E;  2JKV A;  1YQ4 C;  5JQG E;  5B5E O;  1N34 T;  4FT6 A;  2AXT E;  1MIV A;  4EEB A;  4C00 A;  5APT A;  4GIW A;  5GON E;  3AA0 B;  1JCC A;  4U7Y A;  2V8S V;  3M9B A;  3HTK A;  1SFC C;  1JOC A;  4XE5 B;  3PUA A;  4WY4 C;  2FYU D;  3HKB E;  4UV9 B;  5ABF A;  4Z8X A;  1KNR A;  3HE4 B;  1BCC D;  2WMN A;  3D6Y A;  2L3L A;  2UUA T;  3AEG A;  1MMG A;  2DW3 A;  3C4W A;  3BAT A;  4GKK T;  3P4Q A;  2EHO A;  3AE5 C;  3AA1 B;  2VB6 A;  3IR9 A;  3VKG A;  2Q9Q B;  2YIU B;  2B89 A;  2XKM A;  3OJA A;  2XMX A;  5KAF O;  5IHY A;  4O3Y A;  3I0Q A;  3W68 A;  3PRN A;  2K9J A;  1SQV E;  4H0L B;  1EXJ A;  2DHR A;  3EDU A;  1IFI A;  4C90 A;  3RI5 A;  4FRX A;  5J2U E;  1S2E A;  3F2E A;  1JUN A;  5GTH H;  1XDO A;  1M1J C;  1RE3 A;  3K8P C;  3FXE B;  3P8C D;  4F4B A;  1VF5 D;  1NTZ G;  2KNC B;  3BRV B;  4ERR A;  4PJ0 E;  2WSF J;  4FZL A;  2HYN A;  1ZW0 A;  3AAI A;  3FBL A;  2X9X A;  3RRC A;  1U7J A;  4U3F D;  3JAF A;  4ZKP A;  3CWZ B;  2XSA A;  4DUZ T;  1KIL C;  2WT7 B;  1W9R A;  5DL5 A;  3ESL A;  3UU3 A;  1ZP0 C;  3P7K A;  5CCG A;  3P4R A;  1ZOY A;  4A98 A;  1L0L D;  1H6S 1;  5DJU B;  2E75 D;  2JPF A;  2D5U A;  5ABG A;  3C51 A;  4KR4 A;  1LVK A;  3KV4 A;  3N9P A;  2OMF A;  3MUD C;  5CCH A;  5CHX A;  3F31 A;  2WDR A;  2H8P D;  4U2Y A;  2R5D A;  3VR9 A;  2KUB A;  4BJM A;  1XNQ T;  4AIU A;  3MP7 B;  2L9Q A;  4U31 A;  1OFC X;  2XQ9 A;  1HJ0 A;  3RQU A;  4Q25 A;  5JR9 C;  1DEB A;  1FZG A;  2PBI A;  2ACZ A;  4X1I E;  1T1L A;  1GL2 D;  1JNR A;  1NTK J;  3NMD A;  1BT9 A;  2NTY A;  4A97 A;  4OH8 B;  4UB8 H;  1R8I A;  4O2A E;  1ZLL A;  2GA1 A;  1VQ8 P;  1PPJ D;  2VVS A;  1LT9 C;  5AVZ B;  3AE1 A;  4MFR A;  3H1H G;  1KYO I;  2WSS V;  4H63 H;  3X1D A;  5M1B A;  4LF6 T;  4U9C A;  3V8U A;  3O0E A;  2ZYG A;  3TZG A;  4ZXL A;  2V4H A;  1KC8 Q;  4DT0 A;  3G6E P;  4YFS A;  1ZHY A;  5B66 E;  2N1T A;  3N2O A;  4PK4 A;  4WYV A;  4N59 A;  3WU2 E;  2PGD A;  5DL6 A;  2V7M A;  5K5G B;  1KQF B;  3Q9D A;  2K4T A;  1VQN P;  4K3C A;  3BQI A;  1R5L A;  4JFB A;  1QLE D;  4Z3T A;  2FBW A;  3NXS A;  4JBZ A;  3L70 J;  1D1A A;  3AEC C;  2IC6 A;  2K9Y A;  2R32 A;  3P50 A;  3H6P A;  2IBZ D;  5FYM A;  4FI5 A;  1J1E C;  4P0B A;  2BCC G;  1S1C X;  3L71 G;  3BRT B;  3RL0 D;  4WY4 B;  3A3Y B;  3OW2 O;  2DWK A;  5TIS E;  4GKJ T;  1NTZ E;  3E1R A;  1FJP A;  3NZQ A;  1Q9F A;  4QMA A;  2Q5U A;  3V2P A;  5AW1 B;  2YOE A;  3U1A A;  1RE4 A;  2LKM A;  2CA5 A;  3HD7 C;  4IDQ A;  4AKR B;  5FXV A;  3PE0 A;  4Z1M H;  2HOD B;  3D6Z A;  2Z4E A;  1ZME C;  3M0A A;  4IOI H;  4GK0 E;  3MK7 C;  3CME P;  3VZT X;  3AE8 A;  4H9P C;  3TSI A;  1ZRT E;  2DCF A;  3JCU O;  5H2F E;  2WPS A;  1KEY A;  1HBW A;  4L75 A;  2M6B A;  3AE6 C;  3W67 A;  5APY A;  1IFN A;  3IFM A;  2C0X A;  3V2R A;  3FWL A;  4EED A;  5HWX A;  5AQH B;  1GFM A;  1UCU A;  2ZLY A;  3LK3 A;  4IE5 A;  1KIL B;  2Q9Q D;  4AYE C;  4QH1 A;  5CBO A;  4R4M A;  2JJ9 A;  4X1Y E;  1JY2 N;  1NU1 G;  5APW A;  3CCL P;  1FJG T;  3H1H E;  4MAL A;  4UXN B;  3II6 A;  4TZ4 C;  3GN5 A;  4KR8 A;  1YS5 A;  5HEG A;  2M3B A;  5B66 H;  1N8R Q;  2ZM2 A;  2E9X A;  3KPE A;  1I6Z A;  3ZMU B;  3FXD A;  1LWU C;  3WU2 H;  2LT3 A;  4IE6 A;  5JDF A;  2MKV A;  5AQQ B;  5EK4 A;  2KI7 B;  2Y7S A;  5AVR B;  2FFD C; 
#chains in the Genus database with same CATH homology
 1HF8 A;  4IDZ A;  1PHO A;  3KBU A;  3AA6 A;  4DO0 A;  4KBM B;  2E8I A;  4KP3 C;  4PJJ A;  3AA6 B;  4UF0 B;  5L3C B;  2FGQ X;  2CXF A;  3O1H A;  2W00 A;  2VKH A;  4I4T E;  3CVR A;  3HKC E;  3RBH A;  4GCP A;  2YU1 A;  4UIG A;  2PJQ A;  2XE5 A;  4GF4 A;  1T98 A;  2DWG A;  5H6R B;  3RKO A;  1OXZ A;  4D5U A;  4H9S E;  4I50 E;  4FOZ A;  2W62 A;  3O9X A;  5JRC A;  1S94 A;  4MHC A;  3I9W A;  2XQY A;  1HX8 A;  5JRC B;  3LG7 A;  4IE7 A;  4PW8 A;  4U72 A;  2YNK A;  3J7Y q;  4FZM A;  4FSO A;  4FMS A;  5JVD E;  1PRN A;  3FB2 A;  4QQ1 A;  4CXW A;  2V1D B;  5L3F B;  4FSP A;  2K48 A;  2V26 A;  5F8P A;  2D0T A;  4M1P A;  3P7I A;  4IST A;  5FVN A;  3OYX A;  5ADX K;  2N1G A;  2X9H A;  2Y8D A;  3Q5W A;  3RYI E;  2J4U P;  5DJQ C;  2W81 C;  2JMH A;  4ZI2 C;  3DA4 A;  3ETU A;  3R84 B;  3HOL A;  3SY7 A;  5EK3 A;  3N5L A;  4ZI7 E;  1YKE B;  5J1G A;  3ZPO A;  2XTQ A;  3N9N A;  4EYU A;  2PFV A;  3QUJ A;  2J1N A;  2LSY A;  1BXW A;  2Y0H A;  4D65 A;  2BDE A;  2D2S A;  3WAK A;  1IJ6 A;  5JDN A;  1H7C A;  3UAQ A;  3NBX X;  4CZZ B;  4LSE A;  3CQG B;  5LBQ B;  4FRT A;  4EXT A;  3ZC1 A;  4XNK A;  2WWU A;  3VZU X;  2CEA A;  1HG5 A;  4NUU A;  3T20 A;  2ODV A;  5AFU L;  2UXX B;  5JDM A;  4WW0 A;  2CXD A;  3JC6 D;  2JMM A;  3FBZ A;  4DMW A;  1OSM A;  2W61 A;  2J1D G;  2XAS B;  2XUE A;  5DQV A;  5LOV E;  4G2A A;  3KV5 A;  4G63 A;  2VK9 A;  2N2L A;  4AYN A;  2VWA A;  5IYZ E;  1QJP A;  2ES0 A;  3MA9 A;  3LBX A;  5LCY A;  5KMG P;  3HL6 A;  4OHF A;  4G76 A;  4E1T A;  3LBX B;  3HI2 A;  2F1T A;  2KND A;  3KVB A;  4H9Q C;  2XE3 A;  4HKA A;  5FP3 A;  1WR6 A;  5LHG B;  3KFW X;  4ANJ A;  5LBM A;  1MNE A;  1YW0 A;  2GK9 A;  5L2L A;  1BH3 A;  1G73 A;  2P9B A;  4H9N C;  3PU3 A;  3ZMT B;  5LHI B;  4QHO A;  2X9W A;  1D0X A;  3JC6 C;  1UX4 A;  3J9X 1;  2YK0 A;  1ZEE A;  3TKL B;  1ZHC A;  3AAE A;  1SHZ C;  4O3W A;  3OYZ A;  2A72 A;  1EZ3 A;  2X9Y A;  3VU7 H;  2LE8 A;  2C5I T;  3PTR B;  3T24 A;  4O49 A;  4H9R C;  3BQK A;  3N2G E;  1IZN A;  4CI3 B;  1IZN B;  1NWM X;  3NRX A;  3V5U A;  2M67 A;  1WRD A;  3DP7 A;  2K9A A;  3K3Q C;  3WI5 A;  2ERV A;  2ZM0 A;  1NAF A;  4O4J E;  3F57 A;  2O4V A;  3K3N A;  4E7Z A;  2A3D A;  5E0O A;  2LHF A;  3FYX A;  1VOM A;  3SZD A;  4HE8 A;  4AQG A;  3CQX C;  3MAC A;  2FGR A;  3C50 A;  2Y6X A;  1X79 A;  1WYB A;  4QX8 B;  5CA0 E;  3POU A;  3O4X E;  2IAK A;  5HWY A;  4PUX A;  2EHO D;  4HN9 A;  5LXT E;  1YKH B;  1WLX A;  3M65 A;  1BR1 A;  2M07 A;  2YIN A;  1FEW A;  3ETV A;  3ZJ2 A;  2Y0K A;  4DBQ A;  2LOP A;  1GFN A;  4L5G A;  5J2T E;  2F1V A;  3G7G A;  3HWB A;  5L3G B;  1ZHT A;  1ORM A;  2KWH A;  3POX A;  3OBV E;  3CX8 B;  1HTJ F;  3I0O A;  2PG8 A;  1HG2 A;  1HXT A;  1S35 A;  2C5K T;  3U78 A;  2MTQ A;  2EHO C;  6PRN A;  4GCQ A;  2XAG B;  2Q9Q C;  4GYR A;  4ASK A;  5LYJ E;  3A2S X;  4XBF B;  2D0U A;  2C0S A;  2HPJ A;  3KDS E;  2V7I A;  3LK2 B;  2VL8 A;  3GA8 A;  2JQQ A;  3MZK B;  5ADX L;  4KRA A;  2CLY C;  4UF0 A;  5JH7 E;  1P4T A;  2PRN A;  4OYK A;  5L3B B;  2QTK A;  1CUN A;  5C8Y E;  4PFP A;  5L3E B;  3DA3 A;  4XZC A;  4AKL A;  4AYD C;  2BZB A;  3GMI A;  3ZMV B;  4L9I A;  5EZY E;  5M4Y A;  4E1S A;  3CQC B;  3PU8 A;  1GFP A;  1O3X A;  5LP6 E;  4C91 A;  3I1A A;  5FXW A;  3KVA A;  3ZCI A;  2Y48 B;  3IBP A;  1B7T A;  2KC0 A;  3E22 E;  4YJ2 E;  3VHL A;  4HFV A;  4DVD A;  2VAS A;  3WI4 A;  3I9Y A;  4K0U A;  2XAQ B;  3CML A;  1G90 A;  1QJ9 A;  4N58 A;  2ACX A;  2Y2X A;  4O4L E;  2I59 A;  5H6Q B;  4AQF C;  4X20 E;  3UUL A;  2XG6 A;  1THQ A;  4O4I E;  5JDH A;  3FHN A;  4LSF A;  4X1K E;  5LNK A;  2H7V C;  4CI2 B;  4EZH A;  4LSH A;  4ZS3 A;  2RA1 A;  3WI3 A;  4YLH A;  4AKM A;  3QRA A;  4UV8 B;  4F6R C;  5HAX A;  4HTE A;  2M06 A;  3DTO A;  4O8S A;  4QXH B;  3ZN0 B;  3CX6 B;  3SYS A;  3B57 A;  1FMW A;  4GK5 E;  4EAH A;  5HXH A;  3ZYK A;  2X27 X;  3C4X A;  4MLK A;  1WYC A;  3VKH A;  1YD8 G;  2SPC A;  4QX7 B;  4AKH A;  3UUM A;  4H9O C;  2NW8 A;  3KVD D;  2K0L A;  3LJC A;  5HXC A;  3S4U A;  5LJM A;  4UEM A;  4UVA B;  4TV8 E;  3W15 B;  4XNL A;  4O4X A;  4RLB A;  1BR4 A;  2LEH A;  2NW9 A;  4DBR A;  3ZMS B;  3UTK A;  4A56 A;  4AKG A;  1QUU A;  2MHL A;  2LFU A;  3O1J A;  2LSK A;  2WBL A;  5BMV E;  4TN7 B;  5LA6 E;  2YPV A;  3C98 B;  3RYH E;  3UFE A;  5JDL A;  4O4U A;  2NTX A;  1OWA A;  1ZHW A;  1HS7 A;  3BQL A;  3NSG A;  1BR0 A;  2MOZ A;  2LOS A;  3HKE E;  3A5X A;  3T0S A;  3N9M A;  4EOZ B;  4RLC A;  1ZKE A;  3LK4 2;  3N2K E;  2X66 A;  4AZL A;  1BR2 A;  3PUS A;  3AA7 A;  3PUQ A;  5LGU B;  3ZC0 A;  4L0R A;  4UVC B;  5FY7 A;  3AA7 B;  5D5D A;  2CWO A;  2IW5 B;  3GP6 A;  2ZMA A;  4TUY E;  4O3Z A;  1Z0P A;  2RP4 A;  4HGA A;  5LHH B;  5GV0 A;  3KIN B;  4C69 X;  2V7L A;  3HA4 A;  3VZW X;  4QKN A;  5CB4 E;  5JDQ A;  5FY1 A;  4D64 A;  5DAB A;  5FXZ A;  4O4H E;  4OFZ A;  5TAO A;  2HH7 A;  3SWH A;  1MMN A;  1QSD A;  4RJX A;  5JQG E;  4I55 E;  3RYF E;  1FIO A;  4FT6 A;  1MIV A;  2KT9 A;  3AA0 A;  2DNX A;  3WAJ A;  4GIW A;  3KV6 A;  5GON E;  3AA0 B;  3EMN X;  2A2F X;  2MBG A;  3NRY A;  2X51 A;  3GWH A;  2LHN A;  4ZOL E;  1ZV4 X;  3PUA A;  2XHE B;  3HKB E;  3L3P A;  4UV9 B;  4J2C A;  4Z8X A;  3RPU A;  4BA9 A;  3QRC A;  2WMN A;  5F3J A;  2L3L A;  3ANW B;  1MMG A;  1MM5 A;  1E1H B;  1D1C A;  2IC9 A;  2WMO A;  3C4W A;  2NW7 A;  2EHO A;  3AA1 A;  1LVF A;  3MJX A;  4JEH B;  2Q9Q A;  3AA1 B;  2VB6 A;  3OKQ A;  3VKG A;  2EHO B;  1QJ8 A;  4RL9 A;  5DL8 A;  2X67 A;  2Q9Q B;  3PDY A;  4FES A;  4OYJ A;  3OJA A;  2XMX A;  4O3X B;  5IHY A;  2X0L B;  3I0Q A;  4O3Y A;  4QWN B;  3PRN A;  4ISS A;  2NWB A;  3N9Q A;  3Q5X A;  2DHR A;  3BK9 A;  3EDU A;  3AVR A;  4C90 A;  2H7O A;  3E08 A;  3PUG A;  2CLY B;  4FRX A;  4V1A v;  5J2U E;  3F2E A;  3EUH A;  3IF8 B;  4CXX A;  4ZS2 A;  4YJ3 E;  2Z6E A;  3K8P C;  3FXE B;  3P8C D;  1VRB A;  3LK2 A;  4F4B A;  1KNZ A;  4OK0 A;  4PAG A;  4ERR A;  2KWI B;  4GYS A;  2BVM A;  4FZL A;  2K5B B;  3AAI A;  3ONX A;  5A1L A;  3E0Z A;  3FBL A;  4JCH A;  2ODJ A;  2X9X A;  2VKO A;  2XTL A;  4QXB B;  3RRC A;  4BJN A;  3QK6 A;  3RC8 A;  1IAP A;  2Y0L A;  3CWZ B;  1LKX A;  5FNV E;  1Y64 B;  2W63 A;  3ZMZ B;  2V7K A;  4MBQ A;  4PK6 A;  4AXP A;  4AQF A;  5DL5 A;  5KX5 E;  5T5F A;  3ESL A;  2E9X D;  1OPF A;  2CWY A;  3VY8 X;  3AAA A;  4I43 B;  3UUN A;  4AKI A;  4B6X A;  1SA0 E;  3AAA B;  1HXU A;  3V5S A;  2W80 C;  2YEV C;  4DMV A;  2JMK A;  1H6S 1;  1HCI A;  1D0Z A;  4IIJ E;  3RH3 A;  2VKD A;  1ZHZ A;  2N9D A;  2GE4 A;  2JPF A;  2D5U A;  3C51 A;  4KR4 A;  5JR9 B;  3PQU A;  1LVK A;  1GFO A;  2L8K A;  3KV4 A;  3N9P A;  3RYC E;  1E54 A;  2OMF A;  3F31 A;  4ADZ A;  1HXX A;  4YHJ A;  3CX7 B;  4BJM A;  4ZI3 D;  3EDV A;  2B1E A;  3DJB A;  3VE2 A;  4P0A A;  2E9X C;  2L9Q A;  2XAJ B;  2KLQ A;  3AB3 B;  2ZFG A;  4PJN A;  2QA7 A;  3UU2 A;  5JRE A;  5JDP A;  3CKD A;  3NZP A;  5HXS A;  4NUV A;  5HXE A;  2JRK A;  4EIW A;  5JR9 C;  2WAU A;  2PBI A;  4X1I E;  2QGS A;  2KIN B;  1GFQ A;  4TX5 A;  4ZI2 D;  1D0Y A;  1BT9 A;  2NTY A;  2K24 A;  2MNH A;  5LGT B;  3HKD E;  4GCS A;  4O2A E;  3VE1 A;  1AJ3 A;  5FXX A;  4AYI D;  4MFR A;  3SS1 A;  5G26 A;  4ZI3 C;  4KMC A;  2C5J A;  4H63 H;  2LHR A;  2MYS A;  2WSS V;  3B13 A;  3AVS A;  4U9C A;  3V8U A;  3O0E A;  3TZG A;  3N9L A;  4UEL A;  3H3A A;  4O2B E;  3T8O A;  3KV9 A;  3POQ A;  4CQI A;  4YFS A;  4PNI A;  3HR0 A;  3U3I A;  1KK7 A;  4BAY B;  3N2O A;  4PK4 A;  1ZHY A;  4RJW A;  4ZHQ E;  4AUI A;  3SZV A;  4UVB B;  2CXL A;  4N59 A;  2LM9 A;  4IHJ E;  3RX6 A;  1UX5 A;  2KXP A;  2V7M A;  3CPZ A;  5DL6 A;  2XTR A;  1MPF A;  2KXP B;  3Q9D A;  2K4T A;  3ZN1 B;  3QC9 A;  2N2M A;  5FY0 A;  4IGU A;  3BQI A;  3H37 A;  4FJO A;  4WBN E;  4JFB A;  2G0U A;  4Z3T A;  4FUV A;  2XAF B;  1D1A A;  1FMV A;  1LRZ A;  2IC6 A;  3ZCJ A;  3PUR A;  1G8X A;  2XE1 A;  5L3D B;  5FYM A;  3PQS A;  2NP9 A;  1U5P A;  3ZYL A;  1US7 B;  3MKD A;  4FI5 A;  4PFO A;  5FMN A;  4GHB A;  4P0B A;  2DLR A;  4TV9 E;  1MM4 A;  4WNK A;  3UUX B;  1U4Q A;  3L09 A;  3SOL A;  3UT5 E;  3O1I A;  2DWK A;  4JEU B;  2XE2 A;  1HFA A;  3EVY A;  2LSJ A;  4PK5 A;  3K3O A;  3NZQ A;  3Q2M A;  4KUM B;  4E7S A;  5HXR A;  1Q9F A;  3JTY A;  2POR A;  2ODU A;  4QXC B;  2LJL A;  5EE2 A;  2Y7S A;  4JLE A;  2KDY A;  2CA5 A;  2CMR A;  4XAX B;  3ZJ1 A;  3ZEF B;  8PRN A;  4AKR A;  5HYA A;  5KDM C;  3C64 A;  2BVL A;  2YU2 A;  4AKR B;  5FXV A;  3D0T A;  1IJ5 A;  4ILU A;  3SY9 A;  2KMF A;  3ANW A;  3PE0 A;  3C5O A;  3AAE B;  3IHR A;  3LK4 1;  3POR A;  1MIY A;  4N78 D;  1V9D A;  3HW9 A;  1MMD A;  4GK0 E;  3IEE A;  3MK7 C;  3UPG A;  3VZT X;  4H9P C;  4FZN A;  3SYB A;  3C4Z A;  5AFU K;  2DCF A;  5ETW A;  2W0G A;  3RC3 A;  2VKJ A;  4BUM X;  4P09 A;  3HOE A;  4PJM A;  3R6N A;  4EYY R;  4CI1 B;  5HWX A;  2OA5 A;  2V7J A;  1GFM A;  3RRW A;  2WM9 A;  1UCU A;  2ZLY A;  4IE0 A;  3LFM A;  3LK3 A;  2DI4 A;  4HEA A;  4U74 A;  4AFK A;  4IE5 A;  1Q9G A;  4CXY A;  3LK3 B;  1ZHX A;  4AYE C;  2Q9Q D;  5IYU A;  4JUY A;  7PRN A;  3MXZ A;  5EK2 A;  4GOU A;  4LSI A;  5LG4 A;  2JJ9 A;  2KZ7 A;  2X68 A;  4X1Y E;  3ZYM A;  5CA1 E;  2KZ7 B;  2XAH B;  5PRN A;  4DND A;  2UXN B;  2LSI A;  4AYM C;  2CE7 A;  1MMA A;  3K19 A;  3KBT A;  4MAL A;  4UXN B;  4AI6 A;  4TZ4 C;  1MND A;  3GN5 A;  5JDG A;  5LGN B;  1YS5 A;  4KR8 A;  3GN5 B;  3VY9 X;  5LJN A;  4WBO A;  4IE4 A;  2ZM2 A;  2NOX A;  2ZLD A;  2E9X A;  5DL7 A;  4EB6 E;  4G75 A;  3ZMU B;  4H63 V;  2E9X B;  3SRZ A;  4EZ4 A;  2LT3 A;  1MIW A;  4IE6 A;  2ZM8 A;  5JDF A;  4B61 A;  3FXD B;  2CM0 A;  2H3R A;  2N2N A;  1D1B A;  5DQW A;  5EK4 A;  5JR9 A;  3N9O A;  2CCQ A;  3ZLI A;  2LSG A;  4PJL A;  2HPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...