3WU2O

Crystal structure analysis of photosystem ii complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 52
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3wu2O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3wu2O02
5E79O 5GTHO 5KAIO 5H2FO 5G39A 4UB6O 3KZIO 5KAFO 4PJ0O 5G38A 5TISO 4UB8O 3A0HO 3JCUO 5B5EO 5GTIO 5B66O 2AXTO 5G3AA 4IL6O 3WU2O 1S5LO 3A0BO
chains in the Genus database with same CATH superfamily
3LK41 2KC0A 2X9KA 2YNKA 4AYID 3POUA 5ADXK 5G26A 2KZ7B 3TZGA 4D64A 5AFUK 4KR4A 4RL9A 2LHFA 1BXWA 1Q9FA 3UAQA 4UB6O 2X27X 2K0LA 1HXUA 2Y0HA 3AA7B 1GFNA 3HWBA 3QRCA 1GFOA 3QRAA 1ZHXA 2R4NA 4GCQA 4LSFA 4RLBA 5ADXL 3LK42 1ZHYA 5TISO 1ORMA 1T1LA 2Y2XA 2FGQX 4JFBA 2ODJA 1ZHZA 4FZMA 2KXPB 3A0HO 4UB8O 4XNKA 4Z3TA 3JCUO 5GV0A 4C4VB 3HOLA 1IZNB 5GTIO 2YPVA 3DA4A 5B66O 4GCPA 4O3ZA 3WU2O 2XMXA 3LK3B 1S5LO 2W80C 1HXXA 3AA1A 4FESA 4FUVA 4JCHA 4N75A 2M07A 2ZLDA 3A0BO 3PF1A 4O3XB 1GFQA 4FT6A 4AKRB 4RJWA 2N2LA 2XE5A 3A2SX 1ZHWA 3GP6A 4LSHA 4AYDC 2XE2A 3PQSA 3LK2B 3DA3A 4FRXA 1P4TA 4FZNA 4FMSA 4G76A 5DL6A 3JTYA 3RBHA 3AA6B 2Y7SA 3V8UA 4AFKA 4AYNA 1T16A 3PGRA 1QJPA 3AA0A 4O4UA 5H2FO 2LFUA 5G39A 4D5UA 4G75A 2PORA 4C00A 2ZFGA 3KZIO 4O49A 2KDYA 4O3WA 3VE1A 3AAEA 4AZLA 1GFPA 1YS5A 2F1CX 3BRYA 3VE2A 3SY7A 3SYSA 5G38A 4N74A 4O4XA 3UU2A 4O3YA 5IYUA 3DZMA 3UPGA 4GF4A 5AFUL 3DWOX 1GFMA 4KR8A 5JDPA 1BT9A 2JMMA 4AUIA 2Y0LA 3AAAA 2AXTO 3NJTA 4E1TA 3NSGA 3PQUA 3PORA 3POQA 2QTKA 1QJ9A 2F1VA 4AKMA 2R4OA 1OSMA 4D65A 1PRNA 3SZVA 2M06A 5E79O 2R8AA 4KRAA 7PRNA 4PUXA 4QQ1A 2MNHA 4LSEA 3BRZA 3BS0A 4F4BA 4E1SA 8PRNA 2KZ7A 6PRNA 3VY9X 2R88A 3VY8X 2IWWA 2XE3A 4RJXA 1MM4A 1BH3A 3VZUX 3T0SA 2J1NA 2R4PA 5KAFO 3SY9A 2WJQA 4GHBA 2XTQA 3AA7A 1OPFA 4FSOA 1MPFA 4U9CA 4PJ0O 4FZLA 2K4TA 3DWNA 2GE4A 3KVDD 2O4VA 5T5FA 4AYMC 4B61A 1QJ8A 4K3BA 2XG6A 1PHOA 2KXPA 3T20A 1G90A 2W81C 4C4VA 1IZNA 2XE1A 5DL8A 3HOEA 1THQA 4IL6O 3AA1B 2WVPA 3VZTX 4CTDA 1HXTA 3LK3A 2IWVA 4PR7A 5FVNA 5PRNA 1E54A 4AKRA 4AYEC 3PRNA 5GTHO 5KAIO 3WI5A 3T24A 4FRTA 4N58A 5DL7A 3LK2A 4FQEA 3AA6A 3AA0B 3VZWX 3WI4A 3EMNX 5EE2A 2PRNA 3PGUA 3PGSA 2N2MA 2R4LA 4GCSA 4K3CA 5DL5A 2MHLA 3AAEB 1MM5A 2ERVA 3G7GA 1H6S1 4N59A 2J4UP 4LSIA 3K19A 2F1TA 2JQYA 2WJRA 2OMFA 2R89A 2XTRA 3POXA 4FSPA 5B5EO 4RLCA 3AAAB 2FGRA 4XNLA 1ZHTA 4BUMX 2Y0KA 5D5DA 1Q9GA 5G3AA 3SZDA 3FYXA 4FOZA 3SYBA 3O0EA 3HW9A 3C5OA 4C69X
chains in the Genus database with same CATH topology
5E79O 5GTHO 5KAIO 5H2FO 5G39A 4UB6O 3KZIO 5KAFO 4PJ0O 5G38A 5TISO 4UB8O 3A0HO 3JCUO 5B5EO 5GTIO 5B66O 2AXTO 5G3AA 4IL6O 3WU2O 1S5LO 3A0BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 O;  5GTH O;  5KAI O;  5H2F O;  5G39 A;  4UB6 O;  3KZI O;  5KAF O;  4PJ0 O;  5G38 A;  5TIS O;  4UB8 O;  3A0H O;  3JCU O;  5B5E O;  5GTI O;  5B66 O;  2AXT O;  5G3A A;  4IL6 O;  3WU2 O;  1S5L O;  3A0B O; 
#chains in the Genus database with same CATH topology
 3LK4 1;  2KC0 A;  2X9K A;  2YNK A;  4AYI D;  3POU A;  5ADX K;  5G26 A;  2KZ7 B;  3TZG A;  4D64 A;  5AFU K;  4KR4 A;  4RL9 A;  2LHF A;  1BXW A;  1Q9F A;  3UAQ A;  4UB6 O;  2X27 X;  2K0L A;  1HXU A;  2Y0H A;  3AA7 B;  1GFN A;  3HWB A;  3QRC A;  1GFO A;  3QRA A;  1ZHX A;  2R4N A;  4GCQ A;  4LSF A;  4RLB A;  5ADX L;  3LK4 2;  1ZHY A;  5TIS O;  1ORM A;  1T1L A;  2Y2X A;  2FGQ X;  4JFB A;  2ODJ A;  1ZHZ A;  4FZM A;  2KXP B;  3A0H O;  4UB8 O;  4XNK A;  4Z3T A;  3JCU O;  5GV0 A;  4C4V B;  3HOL A;  1IZN B;  5GTI O;  2YPV A;  3DA4 A;  5B66 O;  4GCP A;  4O3Z A;  3WU2 O;  2XMX A;  3LK3 B;  1S5L O;  2W80 C;  1HXX A;  3AA1 A;  4FES A;  4FUV A;  4JCH A;  4N75 A;  2M07 A;  2ZLD A;  3A0B O;  3PF1 A;  4O3X B;  1GFQ A;  4FT6 A;  4AKR B;  4RJW A;  2N2L A;  2XE5 A;  3A2S X;  1ZHW A;  3GP6 A;  4LSH A;  4AYD C;  2XE2 A;  3PQS A;  3LK2 B;  3DA3 A;  4FRX A;  1P4T A;  4FZN A;  4FMS A;  4G76 A;  5DL6 A;  3JTY A;  3RBH A;  3AA6 B;  2Y7S A;  3V8U A;  4AFK A;  4AYN A;  1T16 A;  3PGR A;  1QJP A;  3AA0 A;  4O4U A;  5H2F O;  2LFU A;  5G39 A;  4D5U A;  4G75 A;  2POR A;  4C00 A;  2ZFG A;  3KZI O;  4O49 A;  2KDY A;  4O3W A;  3VE1 A;  3AAE A;  4AZL A;  1GFP A;  1YS5 A;  2F1C X;  3BRY A;  3VE2 A;  3SY7 A;  3SYS A;  5G38 A;  4N74 A;  4O4X A;  3UU2 A;  4O3Y A;  5IYU A;  3DZM A;  3UPG A;  4GF4 A;  5AFU L;  3DWO X;  1GFM A;  4KR8 A;  5JDP A;  1BT9 A;  2JMM A;  4AUI A;  2Y0L A;  3AAA A;  2AXT O;  3NJT A;  4E1T A;  3NSG A;  3PQU A;  3POR A;  3POQ A;  2QTK A;  1QJ9 A;  2F1V A;  4AKM A;  2R4O A;  1OSM A;  4D65 A;  1PRN A;  3SZV A;  2M06 A;  5E79 O;  2R8A A;  4KRA A;  7PRN A;  4PUX A;  4QQ1 A;  2MNH A;  4LSE A;  3BRZ A;  3BS0 A;  4F4B A;  4E1S A;  8PRN A;  2KZ7 A;  6PRN A;  3VY9 X;  2R88 A;  3VY8 X;  2IWW A;  2XE3 A;  4RJX A;  1MM4 A;  1BH3 A;  3VZU X;  3T0S A;  2J1N A;  2R4P A;  5KAF O;  3SY9 A;  2WJQ A;  4GHB A;  2XTQ A;  3AA7 A;  1OPF A;  4FSO A;  1MPF A;  4U9C A;  4PJ0 O;  4FZL A;  2K4T A;  3DWN A;  2GE4 A;  3KVD D;  2O4V A;  5T5F A;  4AYM C;  4B61 A;  1QJ8 A;  4K3B A;  2XG6 A;  1PHO A;  2KXP A;  3T20 A;  1G90 A;  2W81 C;  4C4V A;  1IZN A;  2XE1 A;  5DL8 A;  3HOE A;  1THQ A;  4IL6 O;  3AA1 B;  2WVP A;  3VZT X;  4CTD A;  1HXT A;  3LK3 A;  2IWV A;  4PR7 A;  5FVN A;  5PRN A;  1E54 A;  4AKR A;  4AYE C;  3PRN A;  5GTH O;  5KAI O;  3WI5 A;  3T24 A;  4FRT A;  4N58 A;  5DL7 A;  3LK2 A;  4FQE A;  3AA6 A;  3AA0 B;  3VZW X;  3WI4 A;  3EMN X;  5EE2 A;  2PRN A;  3PGU A;  3PGS A;  2N2M A;  2R4L A;  4GCS A;  4K3C A;  5DL5 A;  2MHL A;  3AAE B;  1MM5 A;  2ERV A;  3G7G A;  1H6S 1;  4N59 A;  2J4U P;  4LSI A;  3K19 A;  2F1T A;  2JQY A;  2WJR A;  2OMF A;  2R89 A;  2XTR A;  3POX A;  4FSP A;  5B5E O;  4RLC A;  3AAA B;  2FGR A;  4XNL A;  1ZHT A;  4BUM X;  2Y0K A;  5D5D A;  1Q9G A;  5G3A A;  3SZD A;  3FYX A;  4FOZ A;  3SYB A;  3O0E A;  3HW9 A;  3C5O A;  4C69 X; 
#chains in the Genus database with same CATH homology
 5E79 O;  5GTH O;  5KAI O;  5H2F O;  5G39 A;  4UB6 O;  3KZI O;  5KAF O;  4PJ0 O;  5G38 A;  5TIS O;  4UB8 O;  3A0H O;  3JCU O;  5B5E O;  5GTI O;  5B66 O;  2AXT O;  5G3A A;  4IL6 O;  3WU2 O;  1S5L O;  3A0B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...