5B5EO

Crystal structure analysis of photosystem ii complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 50
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b5eO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b5eO02
5GTHO 5G38A 5E79O 5GTIO 3JCUO 5B5EO 4UB8O 5KAIO 3KZIO 3A0BO 3WU2O 5H2FO 5G39A 4UB6O 5G3AA 3A0HO 1S5LO 2AXTO 4PJ0O 5KAFO 5TISO 5B66O 4IL6O
chains in the Genus database with same CATH superfamily
1OPFA 3AA7A 4RLCA 4E1TA 3LK3A 5T5FA 4AYEC 3GP6A 4O49A 4FSPA 5E79O 3QRAA 4GHBA 3JCUO 4RLBA 2LFUA 4XNKA 5KAIO 3AA7B 2ZFGA 1OSMA 2KZ7A 3AA0A 3KZIO 2XMXA 2XTRA 2WJQA 3LK3B 4GCSA 4FZNA 3A0BO 2Y0KA 4JFBA 4FZMA 5G39A 5ADXK 1Q9FA 3NJTA 4UB6O 4XNLA 5DL7A 1ZHWA 2R4PA 3PORA 4O3XB 1PHOA 4LSHA 4D65A 3TZGA 1QJPA 2K4TA 1BXWA 3AA0B 2KZ7B 3VZUX 2YPVA 4E1SA 4AZLA 4GF4A 3VY8X 5AFUK 1GFOA 3HWBA 4LSFA 3NSGA 3V8UA 2MHLA 2ZLDA 2O4VA 1GFMA 3POXA 3VZWX 4FZLA 3WI4A 4FESA 1QJ9A 4KRAA 4Z3TA 1PRNA 4PR7A 3HOLA 4FRTA 4FMSA 2JQYA 5G38A 2IWVA 2M06A 3PGUA 5D5DA 4AUIA 3LK41 1ORMA 2IWWA 4CTDA 3DWOX 3PGRA 4C4VA 6PRNA 1ZHYA 4G75A 3DA3A 4AKMA 4N59A 4O3WA 4PUXA 1T16A 3G7GA 2F1TA 3PRNA 3PQUA 4G76A 2W80C 5H2FO 4FUVA 4C4VB 3LK42 3SZVA 2R4NA 5DL8A 2QTKA 2Y2XA 3C5OA 3DZMA 4RJXA 3AAAA 2PRNA 1S5LO 4N75A 4BUMX 2XE3A 3PF1A 4GCQA 3SYBA 4RJWA 2ODJA 5TISO 1HXTA 3BS0A 4QQ1A 1GFQA 1H6S1 2R4OA 1Q9GA 1GFNA 3AAAB 4N74A 3SY9A 7PRNA 5GTHO 1YS5A 2WVPA 1THQA 8PRNA 2KXPA 2XE2A 1ZHXA 1E54A 2KDYA 3O0EA 3SZDA 3K19A 5FVNA 2M07A 1ZHZA 5GTIO 4O3ZA 2WJRA 4AFKA 3VE1A 3HOEA 4O4XA 2KXPB 2XE5A 1HXXA 2OMFA 3BRYA 3WU2O 1MM5A 1QJ8A 4N58A 4B61A 4D64A 4D5UA 5G26A 1BT9A 3LK2A 3PGSA 4U9CA 4AKRA 4AYID 3UPGA 3POUA 3DWNA 4F4BA 3VY9X 3RBHA 2R89A 3A0HO 4JCHA 4RL9A 2X9KA 3PQSA 3AA1A 5ADXL 2AXTO 5IYUA 5JDPA 4O3YA 2XE1A 4AYNA 3LK2B 4AKRB 5KAFO 2R88A 5B66O 4FT6A 4GCPA 2J1NA 2K0LA 3BRZA 3DA4A 2F1CX 2MNHA 4IL6O 5DL6A 5AFUL 3JTYA 1T1LA 3AA1B 3VZTX 1G90A 4C00A 2FGRA 3AA6A 1IZNA 4LSIA 4LSEA 4O4UA 3AAEA 2KC0A 2XTQA 3QRCA 3WI5A 4C69X 3VE2A 5B5EO 3HW9A 2ERVA 3EMNX 4K3CA 4UB8O 3UAQA 3FYXA 3KVDD 3SYSA 2XG6A 3AA6B 2FGQX 1IZNB 2W81C 3SY7A 4K3BA 5EE2A 2Y7SA 3AAEB 2PORA 4KR8A 1MPFA 3T20A 2JMMA 2YNKA 4FRXA 5G3AA 5DL5A 4KR4A 2LHFA 3UU2A 1P4TA 4AYMC 1GFPA 1HXUA 2X27X 5GV0A 4AYDC 3T24A 1ZHTA 5PRNA 2Y0HA 2GE4A 4FSOA 4FQEA 4FOZA 2F1VA 1MM4A 2N2LA 2R4LA 2Y0LA 2R8AA 3A2SX 3POQA 4PJ0O 1BH3A 2J4UP 2N2MA 3T0SA
chains in the Genus database with same CATH topology
5GTHO 5G38A 5E79O 5GTIO 3JCUO 5B5EO 4UB8O 5KAIO 3KZIO 3A0BO 3WU2O 5H2FO 5G39A 4UB6O 5G3AA 3A0HO 1S5LO 2AXTO 4PJ0O 5KAFO 5TISO 5B66O 4IL6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH O;  5G38 A;  5E79 O;  5GTI O;  3JCU O;  5B5E O;  4UB8 O;  5KAI O;  3KZI O;  3A0B O;  3WU2 O;  5H2F O;  5G39 A;  4UB6 O;  5G3A A;  3A0H O;  1S5L O;  2AXT O;  4PJ0 O;  5KAF O;  5TIS O;  5B66 O;  4IL6 O; 
#chains in the Genus database with same CATH topology
 1OPF A;  3AA7 A;  4RLC A;  4E1T A;  3LK3 A;  5T5F A;  4AYE C;  3GP6 A;  4O49 A;  4FSP A;  5E79 O;  3QRA A;  4GHB A;  3JCU O;  4RLB A;  2LFU A;  4XNK A;  5KAI O;  3AA7 B;  2ZFG A;  1OSM A;  2KZ7 A;  3AA0 A;  3KZI O;  2XMX A;  2XTR A;  2WJQ A;  3LK3 B;  4GCS A;  4FZN A;  3A0B O;  2Y0K A;  4JFB A;  4FZM A;  5G39 A;  5ADX K;  1Q9F A;  3NJT A;  4UB6 O;  4XNL A;  5DL7 A;  1ZHW A;  2R4P A;  3POR A;  4O3X B;  1PHO A;  4LSH A;  4D65 A;  3TZG A;  1QJP A;  2K4T A;  1BXW A;  3AA0 B;  2KZ7 B;  3VZU X;  2YPV A;  4E1S A;  4AZL A;  4GF4 A;  3VY8 X;  5AFU K;  1GFO A;  3HWB A;  4LSF A;  3NSG A;  3V8U A;  2MHL A;  2ZLD A;  2O4V A;  1GFM A;  3POX A;  3VZW X;  4FZL A;  3WI4 A;  4FES A;  1QJ9 A;  4KRA A;  4Z3T A;  1PRN A;  4PR7 A;  3HOL A;  4FRT A;  4FMS A;  2JQY A;  5G38 A;  2IWV A;  2M06 A;  3PGU A;  5D5D A;  4AUI A;  3LK4 1;  1ORM A;  2IWW A;  4CTD A;  3DWO X;  3PGR A;  4C4V A;  6PRN A;  1ZHY A;  4G75 A;  3DA3 A;  4AKM A;  4N59 A;  4O3W A;  4PUX A;  1T16 A;  3G7G A;  2F1T A;  3PRN A;  3PQU A;  4G76 A;  2W80 C;  5H2F O;  4FUV A;  4C4V B;  3LK4 2;  3SZV A;  2R4N A;  5DL8 A;  2QTK A;  2Y2X A;  3C5O A;  3DZM A;  4RJX A;  3AAA A;  2PRN A;  1S5L O;  4N75 A;  4BUM X;  2XE3 A;  3PF1 A;  4GCQ A;  3SYB A;  4RJW A;  2ODJ A;  5TIS O;  1HXT A;  3BS0 A;  4QQ1 A;  1GFQ A;  1H6S 1;  2R4O A;  1Q9G A;  1GFN A;  3AAA B;  4N74 A;  3SY9 A;  7PRN A;  5GTH O;  1YS5 A;  2WVP A;  1THQ A;  8PRN A;  2KXP A;  2XE2 A;  1ZHX A;  1E54 A;  2KDY A;  3O0E A;  3SZD A;  3K19 A;  5FVN A;  2M07 A;  1ZHZ A;  5GTI O;  4O3Z A;  2WJR A;  4AFK A;  3VE1 A;  3HOE A;  4O4X A;  2KXP B;  2XE5 A;  1HXX A;  2OMF A;  3BRY A;  3WU2 O;  1MM5 A;  1QJ8 A;  4N58 A;  4B61 A;  4D64 A;  4D5U A;  5G26 A;  1BT9 A;  3LK2 A;  3PGS A;  4U9C A;  4AKR A;  4AYI D;  3UPG A;  3POU A;  3DWN A;  4F4B A;  3VY9 X;  3RBH A;  2R89 A;  3A0H O;  4JCH A;  4RL9 A;  2X9K A;  3PQS A;  3AA1 A;  5ADX L;  2AXT O;  5IYU A;  5JDP A;  4O3Y A;  2XE1 A;  4AYN A;  3LK2 B;  4AKR B;  5KAF O;  2R88 A;  5B66 O;  4FT6 A;  4GCP A;  2J1N A;  2K0L A;  3BRZ A;  3DA4 A;  2F1C X;  2MNH A;  4IL6 O;  5DL6 A;  5AFU L;  3JTY A;  1T1L A;  3AA1 B;  3VZT X;  1G90 A;  4C00 A;  2FGR A;  3AA6 A;  1IZN A;  4LSI A;  4LSE A;  4O4U A;  3AAE A;  2KC0 A;  2XTQ A;  3QRC A;  3WI5 A;  4C69 X;  3VE2 A;  5B5E O;  3HW9 A;  2ERV A;  3EMN X;  4K3C A;  4UB8 O;  3UAQ A;  3FYX A;  3KVD D;  3SYS A;  2XG6 A;  3AA6 B;  2FGQ X;  1IZN B;  2W81 C;  3SY7 A;  4K3B A;  5EE2 A;  2Y7S A;  3AAE B;  2POR A;  4KR8 A;  1MPF A;  3T20 A;  2JMM A;  2YNK A;  4FRX A;  5G3A A;  5DL5 A;  4KR4 A;  2LHF A;  3UU2 A;  1P4T A;  4AYM C;  1GFP A;  1HXU A;  2X27 X;  5GV0 A;  4AYD C;  3T24 A;  1ZHT A;  5PRN A;  2Y0H A;  2GE4 A;  4FSO A;  4FQE A;  4FOZ A;  2F1V A;  1MM4 A;  2N2L A;  2R4L A;  2Y0L A;  2R8A A;  3A2S X;  3POQ A;  4PJ0 O;  1BH3 A;  2J4U P;  2N2M A;  3T0S A; 
#chains in the Genus database with same CATH homology
 5GTH O;  5G38 A;  5E79 O;  5GTI O;  3JCU O;  5B5E O;  4UB8 O;  5KAI O;  3KZI O;  3A0B O;  3WU2 O;  5H2F O;  5G39 A;  4UB6 O;  5G3A A;  3A0H O;  1S5L O;  2AXT O;  4PJ0 O;  5KAF O;  5TIS O;  5B66 O;  4IL6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...