5B66O

Crystal structure analysis of photosystem ii complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 53
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5b66O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5b66O02
3WU2O 5G38A 5B66O 5B5EO 5G3AA 4PJ0O 3JCUO 5GTIO 5KAFO 5GTHO 2AXTO 5H2FO 3A0HO 3A0BO 5E79O 4UB8O 4IL6O 5G39A 3KZIO 4UB6O 5TISO 1S5LO 5KAIO
chains in the Genus database with same CATH superfamily
4FZMA 1MPFA 3WU2O 3POXA 1ZHYA 5B66O 3HOLA 4LSFA 4GCPA 1OPFA 3DZMA 5FVNA 5AFUL 5DL5A 4C4VB 1QJPA 4RJWA 1E54A 4O49A 3JTYA 4G76A 3SZVA 2XE2A 3AA7A 2IWVA 3VE2A 2JMMA 2N2MA 3AA7B 3KVDD 4FSOA 1BT9A 2XTRA 3A0HO 3SYSA 4BUMX 5GV0A 3UPGA 1OSMA 2XE5A 2LFUA 1Q9GA 5E79O 1YS5A 2J1NA 2X9KA 2KZ7B 2R88A 1ZHXA 2R89A 4FZLA 5DL8A 3SZDA 1IZNB 3POQA 3BRZA 4UB6O 3WI5A 4N58A 4RLCA 1T1LA 1ZHTA 2LHFA 3EMNX 2WVPA 3DA3A 4FESA 3WI4A 1G90A 6PRNA 4AUIA 2J4UP 1T16A 2KC0A 4FOZA 5G38A 3NSGA 3AA1A 1QJ8A 4PJ0O 4LSIA 5G3AA 3PGUA 4AYNA 4D5UA 4O3XB 4RJXA 3HW9A 3DWOX 5JDPA 3BS0A 3VZTX 2K0LA 3C5OA 5KAFO 4AZLA 2ZFGA 3QRAA 1MM4A 1PHOA 3HOEA 4JFBA 2F1TA 4FUVA 4O3WA 2Y0KA 4O3YA 4B61A 5H2FO 3T20A 2R4NA 4GF4A 4GCSA 2YPVA 3DA4A 3LK42 4FRTA 1MM5A 4IL6O 2PRNA 8PRNA 4N75A 3AA0A 3KZIO 3QRCA 4F4BA 3A2SX 3AAEA 2N2LA 4FSPA 3V8UA 2W80C 3LK2A 3PRNA 5TISO 3O0EA 3DWNA 1ZHZA 4RLBA 2OMFA 2PORA 2ZLDA 5PRNA 3G7GA 4KR4A 4QQ1A 1HXXA 3PORA 5EE2A 3RBHA 4AYID 5KAIO 4AYDC 7PRNA 4KR8A 3LK41 1ORMA 3PQUA 2K4TA 1ZHWA 3JCUO 2R8AA 2R4LA 4K3BA 4N74A 2F1CX 2ODJA 3AA1B 4K3CA 4AKMA 2W81C 2XTQA 4JCHA 4U9CA 5T5FA 3BRYA 4FMSA 1QJ9A 2XMXA 4C00A 1Q9FA 2KXPA 1GFMA 2QTKA 2KXPB 4C69X 5G26A 1GFPA 1THQA 2FGQX 1BH3A 4LSHA 4FZNA 4AYEC 3AAAA 4UB8O 4GHBA 3NJTA 3LK3A 2R4OA 2Y0LA 5G39A 3LK3B 4AKRA 4D64A 4E1SA 2F1VA 4PR7A 4CTDA 3TZGA 3VZWX 5ADXK 3AA0B 3K19A 2WJRA 3AAEB 2GE4A 3SYBA 3LK2B 2XE1A 4Z3TA 3T0SA 4O3ZA 2MNHA 4O4UA 1BXWA 3UU2A 4O4XA 3UAQA 5IYUA 3PF1A 5B5EO 4C4VA 3PGRA 1P4TA 2ERVA 4KRAA 4XNLA 2M07A 4GCQA 2Y0HA 4RL9A 2X27X 4AYMC 2KDYA 2XE3A 4AFKA 3GP6A 5DL7A 5GTIO 5GTHO 2R4PA 1GFQA 2AXTO 3VY8X 2JQYA 3AA6A 1H6S1 4XNKA 1GFOA 1HXUA 2FGRA 2YNKA 3AA6B 5AFUK 4LSEA 5D5DA 3A0BO 2KZ7A 3FYXA 5ADXL 4G75A 2WJQA 1IZNA 3VE1A 3SY9A 4D65A 3HWBA 3VZUX 3AAAB 4N59A 2Y7SA 4FRXA 5DL6A 3POUA 1GFNA 2MHLA 4FQEA 4AKRB 2IWWA 3VY9X 2M06A 1S5LO 4PUXA 2O4VA 3PQSA 3T24A 3SY7A 2Y2XA 1HXTA 4E1TA 3PGSA 4FT6A 2XG6A 1PRNA
chains in the Genus database with same CATH topology
3WU2O 5G38A 5B66O 5B5EO 5G3AA 4PJ0O 3JCUO 5GTIO 5KAFO 5GTHO 2AXTO 5H2FO 3A0HO 3A0BO 5E79O 4UB8O 4IL6O 5G39A 3KZIO 4UB6O 5TISO 1S5LO 5KAIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 O;  5G38 A;  5B66 O;  5B5E O;  5G3A A;  4PJ0 O;  3JCU O;  5GTI O;  5KAF O;  5GTH O;  2AXT O;  5H2F O;  3A0H O;  3A0B O;  5E79 O;  4UB8 O;  4IL6 O;  5G39 A;  3KZI O;  4UB6 O;  5TIS O;  1S5L O;  5KAI O; 
#chains in the Genus database with same CATH topology
 4FZM A;  1MPF A;  3WU2 O;  3POX A;  1ZHY A;  5B66 O;  3HOL A;  4LSF A;  4GCP A;  1OPF A;  3DZM A;  5FVN A;  5AFU L;  5DL5 A;  4C4V B;  1QJP A;  4RJW A;  1E54 A;  4O49 A;  3JTY A;  4G76 A;  3SZV A;  2XE2 A;  3AA7 A;  2IWV A;  3VE2 A;  2JMM A;  2N2M A;  3AA7 B;  3KVD D;  4FSO A;  1BT9 A;  2XTR A;  3A0H O;  3SYS A;  4BUM X;  5GV0 A;  3UPG A;  1OSM A;  2XE5 A;  2LFU A;  1Q9G A;  5E79 O;  1YS5 A;  2J1N A;  2X9K A;  2KZ7 B;  2R88 A;  1ZHX A;  2R89 A;  4FZL A;  5DL8 A;  3SZD A;  1IZN B;  3POQ A;  3BRZ A;  4UB6 O;  3WI5 A;  4N58 A;  4RLC A;  1T1L A;  1ZHT A;  2LHF A;  3EMN X;  2WVP A;  3DA3 A;  4FES A;  3WI4 A;  1G90 A;  6PRN A;  4AUI A;  2J4U P;  1T16 A;  2KC0 A;  4FOZ A;  5G38 A;  3NSG A;  3AA1 A;  1QJ8 A;  4PJ0 O;  4LSI A;  5G3A A;  3PGU A;  4AYN A;  4D5U A;  4O3X B;  4RJX A;  3HW9 A;  3DWO X;  5JDP A;  3BS0 A;  3VZT X;  2K0L A;  3C5O A;  5KAF O;  4AZL A;  2ZFG A;  3QRA A;  1MM4 A;  1PHO A;  3HOE A;  4JFB A;  2F1T A;  4FUV A;  4O3W A;  2Y0K A;  4O3Y A;  4B61 A;  5H2F O;  3T20 A;  2R4N A;  4GF4 A;  4GCS A;  2YPV A;  3DA4 A;  3LK4 2;  4FRT A;  1MM5 A;  4IL6 O;  2PRN A;  8PRN A;  4N75 A;  3AA0 A;  3KZI O;  3QRC A;  4F4B A;  3A2S X;  3AAE A;  2N2L A;  4FSP A;  3V8U A;  2W80 C;  3LK2 A;  3PRN A;  5TIS O;  3O0E A;  3DWN A;  1ZHZ A;  4RLB A;  2OMF A;  2POR A;  2ZLD A;  5PRN A;  3G7G A;  4KR4 A;  4QQ1 A;  1HXX A;  3POR A;  5EE2 A;  3RBH A;  4AYI D;  5KAI O;  4AYD C;  7PRN A;  4KR8 A;  3LK4 1;  1ORM A;  3PQU A;  2K4T A;  1ZHW A;  3JCU O;  2R8A A;  2R4L A;  4K3B A;  4N74 A;  2F1C X;  2ODJ A;  3AA1 B;  4K3C A;  4AKM A;  2W81 C;  2XTQ A;  4JCH A;  4U9C A;  5T5F A;  3BRY A;  4FMS A;  1QJ9 A;  2XMX A;  4C00 A;  1Q9F A;  2KXP A;  1GFM A;  2QTK A;  2KXP B;  4C69 X;  5G26 A;  1GFP A;  1THQ A;  2FGQ X;  1BH3 A;  4LSH A;  4FZN A;  4AYE C;  3AAA A;  4UB8 O;  4GHB A;  3NJT A;  3LK3 A;  2R4O A;  2Y0L A;  5G39 A;  3LK3 B;  4AKR A;  4D64 A;  4E1S A;  2F1V A;  4PR7 A;  4CTD A;  3TZG A;  3VZW X;  5ADX K;  3AA0 B;  3K19 A;  2WJR A;  3AAE B;  2GE4 A;  3SYB A;  3LK2 B;  2XE1 A;  4Z3T A;  3T0S A;  4O3Z A;  2MNH A;  4O4U A;  1BXW A;  3UU2 A;  4O4X A;  3UAQ A;  5IYU A;  3PF1 A;  5B5E O;  4C4V A;  3PGR A;  1P4T A;  2ERV A;  4KRA A;  4XNL A;  2M07 A;  4GCQ A;  2Y0H A;  4RL9 A;  2X27 X;  4AYM C;  2KDY A;  2XE3 A;  4AFK A;  3GP6 A;  5DL7 A;  5GTI O;  5GTH O;  2R4P A;  1GFQ A;  2AXT O;  3VY8 X;  2JQY A;  3AA6 A;  1H6S 1;  4XNK A;  1GFO A;  1HXU A;  2FGR A;  2YNK A;  3AA6 B;  5AFU K;  4LSE A;  5D5D A;  3A0B O;  2KZ7 A;  3FYX A;  5ADX L;  4G75 A;  2WJQ A;  1IZN A;  3VE1 A;  3SY9 A;  4D65 A;  3HWB A;  3VZU X;  3AAA B;  4N59 A;  2Y7S A;  4FRX A;  5DL6 A;  3POU A;  1GFN A;  2MHL A;  4FQE A;  4AKR B;  2IWW A;  3VY9 X;  2M06 A;  1S5L O;  4PUX A;  2O4V A;  3PQS A;  3T24 A;  3SY7 A;  2Y2X A;  1HXT A;  4E1T A;  3PGS A;  4FT6 A;  2XG6 A;  1PRN A; 
#chains in the Genus database with same CATH homology
 3WU2 O;  5G38 A;  5B66 O;  5B5E O;  5G3A A;  4PJ0 O;  3JCU O;  5GTI O;  5KAF O;  5GTH O;  2AXT O;  5H2F O;  3A0H O;  3A0B O;  5E79 O;  4UB8 O;  4IL6 O;  5G39 A;  3KZI O;  4UB6 O;  5TIS O;  1S5L O;  5KAI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...