1A85A

Mmp8 with malonic and asparagine based inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MMP-8
publication title Structure of malonic acid-based inhibitors bound to human neutrophil collagenase. A new binding mode explains apparently anomalous data.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 1998-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1a85A00
3B92A 3Q2HA 1PWUA 4A3WA 2OVZA 2OW9A 4QKZA 1I73A 1BKCE 1SLNA 4H76A 1K7GA 2I47A 3DPEA 3LQBA 1ZXVA 3KHIA 3MA2A 3U1RA 1QIAA 2AIGP 3N2VA 1UTZA 2WO9A 2JNPA 4G0DA 3I7IA 3EHXA 4Q1LA 2W15A 1CGFA 1USNA 2KRJA 2SRTA 1GE5A 4JA1A 3LUNA 5L7FA 1SLMA 4HX3A 1MMRA 4GF1A 1IADA 3HB2P 1JKYA 2K9CA 3WV2A 1OM6A 5I43A 4L6TA 1XFYA 3KRYA 5I2ZA 1IABA 4XM6A 4J4MA 1C3IA 2Y6CA 1L6JA 1GKCA 1JAPA 1C7KA 3G5CA 3F19A 4HMAA 4PKSA 4IUWA 1SMPA 4ON1A 1R1HA 2W14A 2X3BA 1FM1A 3LGPA 2HU6A 3ELMA 2OZRA 1GO8P 2K2GA 1FLSA 1XFUA 2ERPA 4H2EA 3B2ZA 3HDAP 1DTHA 1PWPA 1AYKA 1ZXCA 1Y8JA 1XUDA 1K7QA 1BZSA 4GUYA 2CLTA 2CKIA 1PWQA 1K7IA 1IACA 2MZHA 5B5OA 3EDZA 4AXQA 1KUIA 2RJQA 2V4BA 5CZMA 1H71P 4PKQA 1BUDA 3ZVSA 3P1VA 5BOTA 1SATA 1MNCA 4AYKA 3O2XA 4DD8A 1OM8A 1RMZA 5I4OA 1BUVM 4DV8A 1JIZA 1UTTA 5LABA 1JAQA 2W13A 2X7MA 1HY7A 2OW1A 2OXZA 1SU3A 3TT4A 2TCLA 3CKIA 3N2UA 4JIJA 3ZUKA 1XFXA 1CGLA 4JP4A 3VI1A 1ATLA 1AKLA 3RTSA 1BM6A 1JJ9A 1YQYA 2EROA 2JT6A 2J83A 1XFVA 1XURA 4GQLA 4WKIA 3F18A 2DW2A 4A7BA 1OS9A 3KEJA 3HBUP 1UEAA 1G49A 4JPAA 3TVCA 1I76A 1ZVXA 5CXAA 4FU4A 4AIGA 4ILWD 3E8RA 3LIKA 1OS2A 1R1JA 3DWBA 1IAGA 5D1SA 2DW1A 3LE9A 1CQRA 1G4KA 1KUHA 2OY2A 3B8ZA 3EDGA 3KMCA 2YB9A 1BIWA 3AYUA 2DDYA 1JAOA 1BKCI 4XCTA 1FBLA 2OVXA 4FXYP 4XM8A 3VTGA 1Y0VA 3EWJA 3WV1A 4FXQA 2DDFA 3HY9A 3KEKA 2D1OA 1GO7P 4H30A 2OW0A 2Z2DA 1C8TA 3LKAA 4GR3A 1ROSA 3LJZA 2QPJA 1D5JA 3SHIA 1GE7A 4WF6A 1KUFA 4PKTA 830CA 2JT5A 5H8XA 4L19A 1UMTA 3LJTA 3K7LA 2PJTA 5D7WA 1SRPA 2XS3A 2WO8A 4H84A 5BOYA 1R1IA 1Y93A 3HBVP 1IAAA 3DNGA 3F17A 1KAPP 4AUOA 1CAQA 3EDHA 3BA0A 2FV5A 3I7GA 1OM7A 4GWMA 3G42A 3LEAA 5D3CA 4H1QA 3LIRA 4DPEA 5JMYA 1YP1A 3AYKA 3F16A 1BQQM 1JIWP 1KUKA 1A86A 1D8MA 3DL1A 2USNA 3LK8A 1QIBA 3EHYA 1D7XA 1CGEA 1B8YA 1PWWA 1WNIA 3HY7A 1HV5A 3TSKA 3HDBA 1D8FA 3KECA 3USNA 1QICA 2XS4A 4DF9A 1GXDA 1YOUA 4PKUA 5BPAA 2RJPA 4L63A 4H82A 1R55A 1PWVA 4FVLA 3K7NA 1ZP5A 5I0LA 3O64A 3LILA 1HTDA 2MZEA 1DMTA 1HFCA 1J7NA 1ZS0A 2JIHA 2J0TA 2X3AA 3F1AA 1QJJA 3AIGA 3NX7A 4JQGA 5L79A 1Z3JA 1QUAA 3HYGA 3OHOA 3OHLA 3UVCA 1O0TA 4XM7A 2W12A 1EB6A 5I3MA 4WZVA 4WK7A 1JH1A 1S4BP 2OXWA 1IAEA 4R3VA 2MLSA 2FV9A 5CUHA 4CTHA 2X3CA 1O0QA 1Q3AA 3V96B 1BQOA 5D1UA 2MZIA 4EFSA 2OY4A 2E2DA 1MMBA 1GE6A 2E3XA 1EUBA 4IJOA 3LMCA 4WKEA 1MMPA 1B3DA 2MLRA 1HFSA 2DW0A 5B5PA 1KUGA 3DSLA 1AF0A 4GR8A 5D1TA 4GR0A 1A85A 966CA 1G05A 1XFZA 1ASTA 3P24A 3KMEA 4H3XA 1ND1A 456CA 1OO9A 2OXUA 3LQ0A 1G9KA 4PKRA 4I03A 3Q2GA 3LJGA 1JK3A 1YCMA 2ERQA 2D1NA 1XFWA 3L0VA 2W0DA 5I12A 2A8HA 2YIGA 3LUMA 1BKCA 3L0TA 1MMQA 4PKWA 2Y6DA 3RTTA 1QJIA 1R54A 5D2BA 1HOVA 1CK7A 4GWNA 2WOAA 2JSDA 1EAKA 3TS4A 1RM8A 1GKDA 3KWVC 2L0RA 1CIZA 4PKVA 1CXVA 4XBHA 3EDIA 1JANA 1UMSA 1OMJA 4IN9A 4ZR5A 4H49A 2O36A 1ZTQA 2AYKA 3F15A 2O3EA 3ZXHA 1BSWA 3DPFA 4I35A 2OI0A 1I1IP 1KBCA 2POJA 2OW2A 3WV3A 1G12A 4G9LA 1XUCA 2N8RA 3GBOA
chains in the Genus database with same CATH superfamily
3B92A 3Q2HA 1PWUA 4A3WA 2OVZA 2OW9A 4QKZA 1I73A 1BKCE 1SLNA 4H76A 1K7GA 2I47A 3DPEA 3LQBA 1ZXVA 3KHIA 3MA2A 3U1RA 1QIAA 3DTKA 2AIGP 3N2VA 1UTZA 2WO9A 2JNPA 4G0DA 3I7IA 3EHXA 4Q1LA 2W15A 1CGFA 1USNA 2KRJA 2SRTA 1GE5A 4JA1A 3LUNA 5L7FA 1SLMA 4HX3A 1MMRA 4GF1A 1IADA 3HB2P 1JKYA 2K9CA 3WV2A 1OM6A 5I43A 4L6TA 1XFYA 3KRYA 5I2ZA 1IABA 4XM6A 4J4MA 1C3IA 2Y6CA 1L6JA 1GKCA 1JAPA 2YUFA 1C7KA 3G5CA 3F19A 4HMAA 4PKSA 4IUWA 1SMPA 4ON1A 1R1HA 2W14A 2X3BA 1XAXA 1FM1A 3LGPA 2HU6A 3ELMA 2OZRA 1GO8P 2K2GA 1FLSA 1XFUA 2ERPA 4H2EA 3B2ZA 3HDAP 1DTHA 1PWPA 1AYKA 1ZXCA 1Y8JA 1XUDA 1K7QA 1BZSA 4GUYA 2CLTA 2CKIA 1PWQA 1K7IA 1IACA 2MZHA 5B5OA 3EDZA 4AXQA 1KUIA 2RJQA 2V4BA 5CZMA 1H71P 4PKQA 1BUDA 3ZVSA 3P1VA 5BOTA 1SATA 1MNCA 4AYKA 3O2XA 4DD8A 1OM8A 1RMZA 5I4OA 1BUVM 4DV8A 1JIZA 1UTTA 5LABA 1JAQA 2W13A 1OZ9A 2X7MA 1HY7A 2OW1A 2OXZA 1SU3A 3TT4A 2TCLA 3CKIA 3N2UA 4JIJA 3ZUKA 1XFXA 1CGLA 4JP4A 3VI1A 1ATLA 1AKLA 3RTSA 1BM6A 1JJ9A 1YQYA 2EROA 2JT6A 2J83A 1XFVA 1XURA 4GQLA 4WKIA 3F18A 2DW2A 4A7BA 1OS9A 3KEJA 3HBUP 1UEAA 1G49A 4JPAA 3TVCA 1I76A 1ZVXA 5CXAA 4FU4A 4AIGA 4ILWD 3E8RA 3LIKA 1OS2A 1R1JA 3DWBA 1IAGA 5D1SA 2DW1A 3LE9A 1CQRA 1G4KA 1KUHA 2OY2A 3B8ZA 3EDGA 3KMCA 2YB9A 1BIWA 3AYUA 2DDYA 1JAOA 1BKCI 4XCTA 1FBLA 2OVXA 4FXYP 4XM8A 3VTGA 1Y0VA 3EWJA 3WV1A 4FXQA 2DDFA 3HY9A 3KEKA 2D1OA 1GO7P 4H30A 2OW0A 2Z2DA 1C8TA 3LKAA 4GR3A 1ROSA 3LJZA 2QPJA 1D5JA 3SHIA 1GE7A 4WF6A 1KUFA 4PKTA 830CA 1TVIA 2JT5A 5H8XA 4L19A 1UMTA 3LJTA 3K7LA 2PJTA 5D7WA 1SRPA 2XS3A 2WO8A 4H84A 5BOYA 1R1IA 1Y93A 3HBVP 1IAAA 3DNGA 3F17A 1KAPP 4AUOA 1CAQA 3EDHA 3BA0A 2FV5A 3I7GA 1OM7A 4GWMA 3G42A 3LEAA 5D3CA 4H1QA 3LIRA 4DPEA 5JMYA 1YP1A 3AYKA 3F16A 1BQQM 1JIWP 1KUKA 1A86A 1D8MA 3DL1A 2USNA 3LK8A 1QIBA 4L7AA 3EHYA 1D7XA 1CGEA 1B8YA 1PWWA 1WNIA 3HY7A 1HV5A 3TSKA 3HDBA 1D8FA 3KECA 3USNA 1QICA 2XS4A 4DF9A 1GXDA 1YOUA 4PKUA 5BPAA 2RJPA 4L63A 4H82A 1R55A 1PWVA 4FVLA 3K7NA 1ZP5A 5I0LA 3O64A 3LILA 1HTDA 3DTEA 2MZEA 1DMTA 1HFCA 1J7NA 1ZS0A 2JIHA 2J0TA 2X3AA 3F1AA 1QJJA 3AIGA 3NX7A 4JQGA 5L79A 1Z3JA 1QUAA 3HYGA 3OHOA 3OHLA 3UVCA 1O0TA 4XM7A 2W12A 1EB6A 5I3MA 4WZVA 4WK7A 1JH1A 1S4BP 2OXWA 1IAEA 4R3VA 2MLSA 2FV9A 5CUHA 4CTHA 2X3CA 1O0QA 1Q3AA 3V96B 1BQOA 5D1UA 2MZIA 4EFSA 2OY4A 2E2DA 1MMBA 1GE6A 2E3XA 1EUBA 4IJOA 1XM5A 3LMCA 4WKEA 1MMPA 1B3DA 2MLRA 1HFSA 2DW0A 5B5PA 1KUGA 3DSLA 1AF0A 4GR8A 5D1TA 4GR0A 1A85A 966CA 1G05A 1XFZA 1ASTA 3P24A 3KMEA 4H3XA 1ND1A 456CA 1OO9A 2OXUA 3LQ0A 1G9KA 4PKRA 4I03A 3DTIA 3Q2GA 3LJGA 1JK3A 1YCMA 2ERQA 2D1NA 1XFWA 3L0VA 2W0DA 5I12A 2A8HA 2YIGA 3LUMA 1BKCA 3L0TA 1MMQA 4PKWA 2Y6DA 3RTTA 1QJIA 1R54A 5D2BA 1HOVA 1CK7A 4GWNA 2WOAA 2JSDA 1EAKA 3TS4A 1RM8A 1GKDA 3KWVC 2L0RA 1CIZA 4PKVA 1CXVA 4XBHA 3EDIA 1JANA 1UMSA 1OMJA 4IN9A 4ZR5A 4H49A 2O36A 1ZTQA 2AYKA 3F15A 2O3EA 3ZXHA 1BSWA 3DPFA 4I35A 2OI0A 1I1IP 1KBCA 2POJA 2OW2A 3WV3A 1G12A 4G9LA 1XUCA 2N8RA 3GBOA
chains in the Genus database with same CATH topology
3B92A 3Q2HA 1PWUA 4A3WA 2OVZA 2OW9A 4QKZA 1I73A 1BKCE 1SLNA 4H76A 1K7GA 2I47A 3DPEA 3LQBA 1ZXVA 3KHIA 3MA2A 3U1RA 1QIAA 3DTKA 2AIGP 3N2VA 1UTZA 2WO9A 2JNPA 4G0DA 3I7IA 3EHXA 4Q1LA 2W15A 1CGFA 1USNA 2KRJA 2SRTA 1GE5A 4JA1A 3LUNA 5L7FA 1SLMA 4HX3A 1MMRA 4GF1A 1IADA 3HB2P 1JKYA 2K9CA 3WV2A 1OM6A 5I43A 4L6TA 1XFYA 3KRYA 5I2ZA 1IABA 4XM6A 4J4MA 1C3IA 2Y6CA 1L6JA 1GKCA 1JAPA 2YUFA 1C7KA 3G5CA 3F19A 4HMAA 4PKSA 4IUWA 1SMPA 4ON1A 1R1HA 2W14A 2X3BA 1FM1A 3LGPA 2HU6A 3ELMA 2OZRA 1GO8P 2K2GA 1FLSA 1XFUA 2ERPA 4H2EA 3B2ZA 3HDAP 1DTHA 1PWPA 1AYKA 1ZXCA 1Y8JA 1XUDA 1K7QA 1BZSA 4GUYA 2CLTA 2CKIA 1PWQA 1K7IA 1IACA 2MZHA 5B5OA 3EDZA 4AXQA 1KUIA 2RJQA 2V4BA 5CZMA 1H71P 4PKQA 1BUDA 3ZVSA 3P1VA 5BOTA 1SATA 1MNCA 4AYKA 3O2XA 4DD8A 1OM8A 1RMZA 5I4OA 1BUVM 4DV8A 1JIZA 1UTTA 5LABA 1JAQA 2W13A 2X7MA 1HY7A 2OW1A 2OXZA 1SU3A 3TT4A 2TCLA 3CKIA 3N2UA 4JIJA 3ZUKA 1XFXA 1CGLA 4JP4A 3VI1A 1ATLA 1AKLA 3RTSA 1BM6A 1JJ9A 1YQYA 2EROA 2JT6A 2J83A 1XFVA 1XURA 4GQLA 4WKIA 3F18A 2DW2A 4A7BA 1OS9A 3KEJA 3HBUP 1UEAA 1G49A 4JPAA 3TVCA 1I76A 1ZVXA 5CXAA 4FU4A 4AIGA 4ILWD 3E8RA 3LIKA 1OS2A 1R1JA 3DWBA 1IAGA 5D1SA 2DW1A 3LE9A 1CQRA 1G4KA 1KUHA 2OY2A 3B8ZA 3EDGA 3KMCA 2YB9A 1BIWA 3AYUA 2DDYA 1JAOA 1BKCI 4XCTA 1FBLA 2OVXA 4FXYP 4XM8A 3VTGA 1Y0VA 3EWJA 3WV1A 4FXQA 2DDFA 3HY9A 3KEKA 2D1OA 1GO7P 4H30A 2OW0A 2Z2DA 1C8TA 3LKAA 4GR3A 1ROSA 3LJZA 2QPJA 1D5JA 3SHIA 1GE7A 4WF6A 1KUFA 4PKTA 830CA 2JT5A 5H8XA 4L19A 1UMTA 3LJTA 3K7LA 2PJTA 5D7WA 1SRPA 2XS3A 2WO8A 4H84A 5BOYA 1R1IA 1Y93A 3HBVP 1IAAA 3DNGA 3F17A 1KAPP 4AUOA 1CAQA 3EDHA 3BA0A 2FV5A 3I7GA 1OM7A 4GWMA 3G42A 3LEAA 5D3CA 4H1QA 3LIRA 4DPEA 5JMYA 1YP1A 3AYKA 3F16A 1BQQM 1JIWP 1KUKA 1A86A 1D8MA 3DL1A 2USNA 3LK8A 1QIBA 4L7AA 3EHYA 1D7XA 1CGEA 1B8YA 1PWWA 1WNIA 3HY7A 1HV5A 3TSKA 3HDBA 1D8FA 3KECA 3USNA 1QICA 2XS4A 4DF9A 1GXDA 1YOUA 4PKUA 5BPAA 2RJPA 4L63A 4H82A 1R55A 1PWVA 4FVLA 3K7NA 1ZP5A 5I0LA 3O64A 3LILA 1HTDA 3DTEA 2MZEA 1DMTA 1HFCA 1J7NA 1ZS0A 2JIHA 2J0TA 2X3AA 3F1AA 1QJJA 3AIGA 3NX7A 4JQGA 5L79A 1Z3JA 1QUAA 3HYGA 3OHOA 3OHLA 3UVCA 1O0TA 4XM7A 2W12A 1EB6A 5I3MA 4WZVA 4WK7A 1JH1A 1S4BP 2OXWA 1IAEA 4R3VA 2MLSA 2FV9A 5CUHA 4CTHA 2X3CA 1O0QA 1Q3AA 3V96B 1BQOA 5D1UA 2MZIA 4EFSA 2OY4A 2E2DA 1MMBA 1GE6A 2E3XA 1EUBA 4IJOA 3LMCA 4WKEA 1MMPA 1B3DA 2MLRA 1HFSA 2DW0A 5B5PA 1KUGA 3DSLA 1AF0A 4GR8A 5D1TA 4GR0A 1A85A 966CA 1G05A 1XFZA 1ASTA 3P24A 3KMEA 4H3XA 1ND1A 456CA 1OO9A 2OXUA 3LQ0A 1G9KA 4PKRA 4I03A 3DTIA 3Q2GA 3LJGA 1JK3A 1YCMA 2ERQA 2D1NA 1XFWA 3L0VA 2W0DA 5I12A 2A8HA 2YIGA 3LUMA 1BKCA 3L0TA 1MMQA 4PKWA 2Y6DA 3RTTA 1QJIA 1R54A 5D2BA 1HOVA 1CK7A 4GWNA 2WOAA 2JSDA 1EAKA 3TS4A 1RM8A 1GKDA 3KWVC 2L0RA 1CIZA 4PKVA 1CXVA 4XBHA 3EDIA 1JANA 1UMSA 1OMJA 4IN9A 4ZR5A 4H49A 2O36A 1ZTQA 2AYKA 3F15A 2O3EA 3ZXHA 1BSWA 3DPFA 4I35A 2OI0A 1I1IP 1KBCA 2POJA 2OW2A 3WV3A 1G12A 4G9LA 1XUCA 2N8RA 3GBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B92 A;  3Q2H A;  1PWU A;  4A3W A;  2OVZ A;  2OW9 A;  4QKZ A;  1I73 A;  1BKC E;  1SLN A;  4H76 A;  1K7G A;  2I47 A;  3DPE A;  3LQB A;  1ZXV A;  3KHI A;  3MA2 A;  3U1R A;  1QIA A;  2AIG P;  3N2V A;  1UTZ A;  2WO9 A;  2JNP A;  4G0D A;  3I7I A;  3EHX A;  4Q1L A;  2W15 A;  1CGF A;  1USN A;  2KRJ A;  2SRT A;  1GE5 A;  4JA1 A;  3LUN A;  5L7F A;  1SLM A;  4HX3 A;  1MMR A;  4GF1 A;  1IAD A;  3HB2 P;  1JKY A;  2K9C A;  3WV2 A;  1OM6 A;  5I43 A;  4L6T A;  1XFY A;  3KRY A;  5I2Z A;  1IAB A;  4XM6 A;  4J4M A;  1C3I A;  2Y6C A;  1L6J A;  1GKC A;  1JAP A;  1C7K A;  3G5C A;  3F19 A;  4HMA A;  4PKS A;  4IUW A;  1SMP A;  4ON1 A;  1R1H A;  2W14 A;  2X3B A;  1FM1 A;  3LGP A;  2HU6 A;  3ELM A;  2OZR A;  1GO8 P;  2K2G A;  1FLS A;  1XFU A;  2ERP A;  4H2E A;  3B2Z A;  3HDA P;  1DTH A;  1PWP A;  1AYK A;  1ZXC A;  1Y8J A;  1XUD A;  1K7Q A;  1BZS A;  4GUY A;  2CLT A;  2CKI A;  1PWQ A;  1K7I A;  1IAC A;  2MZH A;  5B5O A;  3EDZ A;  4AXQ A;  1KUI A;  2RJQ A;  2V4B A;  5CZM A;  1H71 P;  4PKQ A;  1BUD A;  3ZVS A;  3P1V A;  5BOT A;  1SAT A;  1MNC A;  4AYK A;  3O2X A;  4DD8 A;  1OM8 A;  1RMZ A;  5I4O A;  1BUV M;  4DV8 A;  1JIZ A;  1UTT A;  5LAB A;  1JAQ A;  2W13 A;  2X7M A;  1HY7 A;  2OW1 A;  2OXZ A;  1SU3 A;  3TT4 A;  2TCL A;  3CKI A;  3N2U A;  4JIJ A;  3ZUK A;  1XFX A;  1CGL A;  4JP4 A;  3VI1 A;  1ATL A;  1AKL A;  3RTS A;  1BM6 A;  1JJ9 A;  1YQY A;  2ERO A;  2JT6 A;  2J83 A;  1XFV A;  1XUR A;  4GQL A;  4WKI A;  3F18 A;  2DW2 A;  4A7B A;  1OS9 A;  3KEJ A;  3HBU P;  1UEA A;  1G49 A;  4JPA A;  3TVC A;  1I76 A;  1ZVX A;  5CXA A;  4FU4 A;  4AIG A;  4ILW D;  3E8R A;  3LIK A;  1OS2 A;  1R1J A;  3DWB A;  1IAG A;  5D1S A;  2DW1 A;  3LE9 A;  1CQR A;  1G4K A;  1KUH A;  2OY2 A;  3B8Z A;  3EDG A;  3KMC A;  2YB9 A;  1BIW A;  3AYU A;  2DDY A;  1JAO A;  1BKC I;  4XCT A;  1FBL A;  2OVX A;  4FXY P;  4XM8 A;  3VTG A;  1Y0V A;  3EWJ A;  3WV1 A;  4FXQ A;  2DDF A;  3HY9 A;  3KEK A;  2D1O A;  1GO7 P;  4H30 A;  2OW0 A;  2Z2D A;  1C8T A;  3LKA A;  4GR3 A;  1ROS A;  3LJZ A;  2QPJ A;  1D5J A;  3SHI A;  1GE7 A;  4WF6 A;  1KUF A;  4PKT A;  830C A;  2JT5 A;  5H8X A;  4L19 A;  1UMT A;  3LJT A;  3K7L A;  2PJT A;  5D7W A;  1SRP A;  2XS3 A;  2WO8 A;  4H84 A;  5BOY A;  1R1I A;  1Y93 A;  3HBV P;  1IAA A;  3DNG A;  3F17 A;  1KAP P;  4AUO A;  1CAQ A;  3EDH A;  3BA0 A;  2FV5 A;  3I7G A;  1OM7 A;  4GWM A;  3G42 A;  3LEA A;  5D3C A;  4H1Q A;  3LIR A;  4DPE A;  5JMY A;  1YP1 A;  3AYK A;  3F16 A;  1BQQ M;  1JIW P;  1KUK A;  1A86 A;  1D8M A;  3DL1 A;  2USN A;  3LK8 A;  1QIB A;  3EHY A;  1D7X A;  1CGE A;  1B8Y A;  1PWW A;  1WNI A;  3HY7 A;  1HV5 A;  3TSK A;  3HDB A;  1D8F A;  3KEC A;  3USN A;  1QIC A;  2XS4 A;  4DF9 A;  1GXD A;  1YOU A;  4PKU A;  5BPA A;  2RJP A;  4L63 A;  4H82 A;  1R55 A;  1PWV A;  4FVL A;  3K7N A;  1ZP5 A;  5I0L A;  3O64 A;  3LIL A;  1HTD A;  2MZE A;  1DMT A;  1HFC A;  1J7N A;  1ZS0 A;  2JIH A;  2J0T A;  2X3A A;  3F1A A;  1QJJ A;  3AIG A;  3NX7 A;  4JQG A;  5L79 A;  1Z3J A;  1QUA A;  3HYG A;  3OHO A;  3OHL A;  3UVC A;  1O0T A;  4XM7 A;  2W12 A;  1EB6 A;  5I3M A;  4WZV A;  4WK7 A;  1JH1 A;  1S4B P;  2OXW A;  1IAE A;  4R3V A;  2MLS A;  2FV9 A;  5CUH A;  4CTH A;  2X3C A;  1O0Q A;  1Q3A A;  3V96 B;  1BQO A;  5D1U A;  2MZI A;  4EFS A;  2OY4 A;  2E2D A;  1MMB A;  1GE6 A;  2E3X A;  1EUB A;  4IJO A;  3LMC A;  4WKE A;  1MMP A;  1B3D A;  2MLR A;  1HFS A;  2DW0 A;  5B5P A;  1KUG A;  3DSL A;  1AF0 A;  4GR8 A;  5D1T A;  4GR0 A;  1A85 A;  966C A;  1G05 A;  1XFZ A;  1AST A;  3P24 A;  3KME A;  4H3X A;  1ND1 A;  456C A;  1OO9 A;  2OXU A;  3LQ0 A;  1G9K A;  4PKR A;  4I03 A;  3Q2G A;  3LJG A;  1JK3 A;  1YCM A;  2ERQ A;  2D1N A;  1XFW A;  3L0V A;  2W0D A;  5I12 A;  2A8H A;  2YIG A;  3LUM A;  1BKC A;  3L0T A;  1MMQ A;  4PKW A;  2Y6D A;  3RTT A;  1QJI A;  1R54 A;  5D2B A;  1HOV A;  1CK7 A;  4GWN A;  2WOA A;  2JSD A;  1EAK A;  3TS4 A;  1RM8 A;  1GKD A;  3KWV C;  2L0R A;  1CIZ A;  4PKV A;  1CXV A;  4XBH A;  3EDI A;  1JAN A;  1UMS A;  1OMJ A;  4IN9 A;  4ZR5 A;  4H49 A;  2O36 A;  1ZTQ A;  2AYK A;  3F15 A;  2O3E A;  3ZXH A;  1BSW A;  3DPF A;  4I35 A;  2OI0 A;  1I1I P;  1KBC A;  2POJ A;  2OW2 A;  3WV3 A;  1G12 A;  4G9L A;  1XUC A;  2N8R A;  3GBO A; 
#chains in the Genus database with same CATH topology
 3B92 A;  3Q2H A;  1PWU A;  4A3W A;  2OVZ A;  2OW9 A;  4QKZ A;  1I73 A;  1BKC E;  1SLN A;  4H76 A;  1K7G A;  2I47 A;  3DPE A;  3LQB A;  1ZXV A;  3KHI A;  3MA2 A;  3U1R A;  1QIA A;  3DTK A;  2AIG P;  3N2V A;  1UTZ A;  2WO9 A;  2JNP A;  4G0D A;  3I7I A;  3EHX A;  4Q1L A;  2W15 A;  1CGF A;  1USN A;  2KRJ A;  2SRT A;  1GE5 A;  4JA1 A;  3LUN A;  5L7F A;  1SLM A;  4HX3 A;  1MMR A;  4GF1 A;  1IAD A;  3HB2 P;  1JKY A;  2K9C A;  3WV2 A;  1OM6 A;  5I43 A;  4L6T A;  1XFY A;  3KRY A;  5I2Z A;  1IAB A;  4XM6 A;  4J4M A;  1C3I A;  2Y6C A;  1L6J A;  1GKC A;  1JAP A;  2YUF A;  1C7K A;  3G5C A;  3F19 A;  4HMA A;  4PKS A;  4IUW A;  1SMP A;  4ON1 A;  1R1H A;  2W14 A;  2X3B A;  1XAX A;  1FM1 A;  3LGP A;  2HU6 A;  3ELM A;  2OZR A;  1GO8 P;  2K2G A;  1FLS A;  1XFU A;  2ERP A;  4H2E A;  3B2Z A;  3HDA P;  1DTH A;  1PWP A;  1AYK A;  1ZXC A;  1Y8J A;  1XUD A;  1K7Q A;  1BZS A;  4GUY A;  2CLT A;  2CKI A;  1PWQ A;  1K7I A;  1IAC A;  2MZH A;  5B5O A;  3EDZ A;  4AXQ A;  1KUI A;  2RJQ A;  2V4B A;  5CZM A;  1H71 P;  4PKQ A;  1BUD A;  3ZVS A;  3P1V A;  5BOT A;  1SAT A;  1MNC A;  4AYK A;  3O2X A;  4DD8 A;  1OM8 A;  1RMZ A;  5I4O A;  1BUV M;  4DV8 A;  1JIZ A;  1UTT A;  5LAB A;  1JAQ A;  2W13 A;  1OZ9 A;  2X7M A;  1HY7 A;  2OW1 A;  2OXZ A;  1SU3 A;  3TT4 A;  2TCL A;  3CKI A;  3N2U A;  4JIJ A;  3ZUK A;  1XFX A;  1CGL A;  4JP4 A;  3VI1 A;  1ATL A;  1AKL A;  3RTS A;  1BM6 A;  1JJ9 A;  1YQY A;  2ERO A;  2JT6 A;  2J83 A;  1XFV A;  1XUR A;  4GQL A;  4WKI A;  3F18 A;  2DW2 A;  4A7B A;  1OS9 A;  3KEJ A;  3HBU P;  1UEA A;  1G49 A;  4JPA A;  3TVC A;  1I76 A;  1ZVX A;  5CXA A;  4FU4 A;  4AIG A;  4ILW D;  3E8R A;  3LIK A;  1OS2 A;  1R1J A;  3DWB A;  1IAG A;  5D1S A;  2DW1 A;  3LE9 A;  1CQR A;  1G4K A;  1KUH A;  2OY2 A;  3B8Z A;  3EDG A;  3KMC A;  2YB9 A;  1BIW A;  3AYU A;  2DDY A;  1JAO A;  1BKC I;  4XCT A;  1FBL A;  2OVX A;  4FXY P;  4XM8 A;  3VTG A;  1Y0V A;  3EWJ A;  3WV1 A;  4FXQ A;  2DDF A;  3HY9 A;  3KEK A;  2D1O A;  1GO7 P;  4H30 A;  2OW0 A;  2Z2D A;  1C8T A;  3LKA A;  4GR3 A;  1ROS A;  3LJZ A;  2QPJ A;  1D5J A;  3SHI A;  1GE7 A;  4WF6 A;  1KUF A;  4PKT A;  830C A;  1TVI A;  2JT5 A;  5H8X A;  4L19 A;  1UMT A;  3LJT A;  3K7L A;  2PJT A;  5D7W A;  1SRP A;  2XS3 A;  2WO8 A;  4H84 A;  5BOY A;  1R1I A;  1Y93 A;  3HBV P;  1IAA A;  3DNG A;  3F17 A;  1KAP P;  4AUO A;  1CAQ A;  3EDH A;  3BA0 A;  2FV5 A;  3I7G A;  1OM7 A;  4GWM A;  3G42 A;  3LEA A;  5D3C A;  4H1Q A;  3LIR A;  4DPE A;  5JMY A;  1YP1 A;  3AYK A;  3F16 A;  1BQQ M;  1JIW P;  1KUK A;  1A86 A;  1D8M A;  3DL1 A;  2USN A;  3LK8 A;  1QIB A;  4L7A A;  3EHY A;  1D7X A;  1CGE A;  1B8Y A;  1PWW A;  1WNI A;  3HY7 A;  1HV5 A;  3TSK A;  3HDB A;  1D8F A;  3KEC A;  3USN A;  1QIC A;  2XS4 A;  4DF9 A;  1GXD A;  1YOU A;  4PKU A;  5BPA A;  2RJP A;  4L63 A;  4H82 A;  1R55 A;  1PWV A;  4FVL A;  3K7N A;  1ZP5 A;  5I0L A;  3O64 A;  3LIL A;  1HTD A;  3DTE A;  2MZE A;  1DMT A;  1HFC A;  1J7N A;  1ZS0 A;  2JIH A;  2J0T A;  2X3A A;  3F1A A;  1QJJ A;  3AIG A;  3NX7 A;  4JQG A;  5L79 A;  1Z3J A;  1QUA A;  3HYG A;  3OHO A;  3OHL A;  3UVC A;  1O0T A;  4XM7 A;  2W12 A;  1EB6 A;  5I3M A;  4WZV A;  4WK7 A;  1JH1 A;  1S4B P;  2OXW A;  1IAE A;  4R3V A;  2MLS A;  2FV9 A;  5CUH A;  4CTH A;  2X3C A;  1O0Q A;  1Q3A A;  3V96 B;  1BQO A;  5D1U A;  2MZI A;  4EFS A;  2OY4 A;  2E2D A;  1MMB A;  1GE6 A;  2E3X A;  1EUB A;  4IJO A;  1XM5 A;  3LMC A;  4WKE A;  1MMP A;  1B3D A;  2MLR A;  1HFS A;  2DW0 A;  5B5P A;  1KUG A;  3DSL A;  1AF0 A;  4GR8 A;  5D1T A;  4GR0 A;  1A85 A;  966C A;  1G05 A;  1XFZ A;  1AST A;  3P24 A;  3KME A;  4H3X A;  1ND1 A;  456C A;  1OO9 A;  2OXU A;  3LQ0 A;  1G9K A;  4PKR A;  4I03 A;  3DTI A;  3Q2G A;  3LJG A;  1JK3 A;  1YCM A;  2ERQ A;  2D1N A;  1XFW A;  3L0V A;  2W0D A;  5I12 A;  2A8H A;  2YIG A;  3LUM A;  1BKC A;  3L0T A;  1MMQ A;  4PKW A;  2Y6D A;  3RTT A;  1QJI A;  1R54 A;  5D2B A;  1HOV A;  1CK7 A;  4GWN A;  2WOA A;  2JSD A;  1EAK A;  3TS4 A;  1RM8 A;  1GKD A;  3KWV C;  2L0R A;  1CIZ A;  4PKV A;  1CXV A;  4XBH A;  3EDI A;  1JAN A;  1UMS A;  1OMJ A;  4IN9 A;  4ZR5 A;  4H49 A;  2O36 A;  1ZTQ A;  2AYK A;  3F15 A;  2O3E A;  3ZXH A;  1BSW A;  3DPF A;  4I35 A;  2OI0 A;  1I1I P;  1KBC A;  2POJ A;  2OW2 A;  3WV3 A;  1G12 A;  4G9L A;  1XUC A;  2N8R A;  3GBO A; 
#chains in the Genus database with same CATH homology
 3B92 A;  3Q2H A;  1PWU A;  4A3W A;  2OVZ A;  2OW9 A;  4QKZ A;  1I73 A;  1BKC E;  1SLN A;  4H76 A;  1K7G A;  2I47 A;  3DPE A;  3LQB A;  1ZXV A;  3KHI A;  3MA2 A;  3U1R A;  1QIA A;  3DTK A;  2AIG P;  3N2V A;  1UTZ A;  2WO9 A;  2JNP A;  4G0D A;  3I7I A;  3EHX A;  4Q1L A;  2W15 A;  1CGF A;  1USN A;  2KRJ A;  2SRT A;  1GE5 A;  4JA1 A;  3LUN A;  5L7F A;  1SLM A;  4HX3 A;  1MMR A;  4GF1 A;  1IAD A;  3HB2 P;  1JKY A;  2K9C A;  3WV2 A;  1OM6 A;  5I43 A;  4L6T A;  1XFY A;  3KRY A;  5I2Z A;  1IAB A;  4XM6 A;  4J4M A;  1C3I A;  2Y6C A;  1L6J A;  1GKC A;  1JAP A;  2YUF A;  1C7K A;  3G5C A;  3F19 A;  4HMA A;  4PKS A;  4IUW A;  1SMP A;  4ON1 A;  1R1H A;  2W14 A;  2X3B A;  1FM1 A;  3LGP A;  2HU6 A;  3ELM A;  2OZR A;  1GO8 P;  2K2G A;  1FLS A;  1XFU A;  2ERP A;  4H2E A;  3B2Z A;  3HDA P;  1DTH A;  1PWP A;  1AYK A;  1ZXC A;  1Y8J A;  1XUD A;  1K7Q A;  1BZS A;  4GUY A;  2CLT A;  2CKI A;  1PWQ A;  1K7I A;  1IAC A;  2MZH A;  5B5O A;  3EDZ A;  4AXQ A;  1KUI A;  2RJQ A;  2V4B A;  5CZM A;  1H71 P;  4PKQ A;  1BUD A;  3ZVS A;  3P1V A;  5BOT A;  1SAT A;  1MNC A;  4AYK A;  3O2X A;  4DD8 A;  1OM8 A;  1RMZ A;  5I4O A;  1BUV M;  4DV8 A;  1JIZ A;  1UTT A;  5LAB A;  1JAQ A;  2W13 A;  2X7M A;  1HY7 A;  2OW1 A;  2OXZ A;  1SU3 A;  3TT4 A;  2TCL A;  3CKI A;  3N2U A;  4JIJ A;  3ZUK A;  1XFX A;  1CGL A;  4JP4 A;  3VI1 A;  1ATL A;  1AKL A;  3RTS A;  1BM6 A;  1JJ9 A;  1YQY A;  2ERO A;  2JT6 A;  2J83 A;  1XFV A;  1XUR A;  4GQL A;  4WKI A;  3F18 A;  2DW2 A;  4A7B A;  1OS9 A;  3KEJ A;  3HBU P;  1UEA A;  1G49 A;  4JPA A;  3TVC A;  1I76 A;  1ZVX A;  5CXA A;  4FU4 A;  4AIG A;  4ILW D;  3E8R A;  3LIK A;  1OS2 A;  1R1J A;  3DWB A;  1IAG A;  5D1S A;  2DW1 A;  3LE9 A;  1CQR A;  1G4K A;  1KUH A;  2OY2 A;  3B8Z A;  3EDG A;  3KMC A;  2YB9 A;  1BIW A;  3AYU A;  2DDY A;  1JAO A;  1BKC I;  4XCT A;  1FBL A;  2OVX A;  4FXY P;  4XM8 A;  3VTG A;  1Y0V A;  3EWJ A;  3WV1 A;  4FXQ A;  2DDF A;  3HY9 A;  3KEK A;  2D1O A;  1GO7 P;  4H30 A;  2OW0 A;  2Z2D A;  1C8T A;  3LKA A;  4GR3 A;  1ROS A;  3LJZ A;  2QPJ A;  1D5J A;  3SHI A;  1GE7 A;  4WF6 A;  1KUF A;  4PKT A;  830C A;  2JT5 A;  5H8X A;  4L19 A;  1UMT A;  3LJT A;  3K7L A;  2PJT A;  5D7W A;  1SRP A;  2XS3 A;  2WO8 A;  4H84 A;  5BOY A;  1R1I A;  1Y93 A;  3HBV P;  1IAA A;  3DNG A;  3F17 A;  1KAP P;  4AUO A;  1CAQ A;  3EDH A;  3BA0 A;  2FV5 A;  3I7G A;  1OM7 A;  4GWM A;  3G42 A;  3LEA A;  5D3C A;  4H1Q A;  3LIR A;  4DPE A;  5JMY A;  1YP1 A;  3AYK A;  3F16 A;  1BQQ M;  1JIW P;  1KUK A;  1A86 A;  1D8M A;  3DL1 A;  2USN A;  3LK8 A;  1QIB A;  4L7A A;  3EHY A;  1D7X A;  1CGE A;  1B8Y A;  1PWW A;  1WNI A;  3HY7 A;  1HV5 A;  3TSK A;  3HDB A;  1D8F A;  3KEC A;  3USN A;  1QIC A;  2XS4 A;  4DF9 A;  1GXD A;  1YOU A;  4PKU A;  5BPA A;  2RJP A;  4L63 A;  4H82 A;  1R55 A;  1PWV A;  4FVL A;  3K7N A;  1ZP5 A;  5I0L A;  3O64 A;  3LIL A;  1HTD A;  3DTE A;  2MZE A;  1DMT A;  1HFC A;  1J7N A;  1ZS0 A;  2JIH A;  2J0T A;  2X3A A;  3F1A A;  1QJJ A;  3AIG A;  3NX7 A;  4JQG A;  5L79 A;  1Z3J A;  1QUA A;  3HYG A;  3OHO A;  3OHL A;  3UVC A;  1O0T A;  4XM7 A;  2W12 A;  1EB6 A;  5I3M A;  4WZV A;  4WK7 A;  1JH1 A;  1S4B P;  2OXW A;  1IAE A;  4R3V A;  2MLS A;  2FV9 A;  5CUH A;  4CTH A;  2X3C A;  1O0Q A;  1Q3A A;  3V96 B;  1BQO A;  5D1U A;  2MZI A;  4EFS A;  2OY4 A;  2E2D A;  1MMB A;  1GE6 A;  2E3X A;  1EUB A;  4IJO A;  3LMC A;  4WKE A;  1MMP A;  1B3D A;  2MLR A;  1HFS A;  2DW0 A;  5B5P A;  1KUG A;  3DSL A;  1AF0 A;  4GR8 A;  5D1T A;  4GR0 A;  1A85 A;  966C A;  1G05 A;  1XFZ A;  1AST A;  3P24 A;  3KME A;  4H3X A;  1ND1 A;  456C A;  1OO9 A;  2OXU A;  3LQ0 A;  1G9K A;  4PKR A;  4I03 A;  3DTI A;  3Q2G A;  3LJG A;  1JK3 A;  1YCM A;  2ERQ A;  2D1N A;  1XFW A;  3L0V A;  2W0D A;  5I12 A;  2A8H A;  2YIG A;  3LUM A;  1BKC A;  3L0T A;  1MMQ A;  4PKW A;  2Y6D A;  3RTT A;  1QJI A;  1R54 A;  5D2B A;  1HOV A;  1CK7 A;  4GWN A;  2WOA A;  2JSD A;  1EAK A;  3TS4 A;  1RM8 A;  1GKD A;  3KWV C;  2L0R A;  1CIZ A;  4PKV A;  1CXV A;  4XBH A;  3EDI A;  1JAN A;  1UMS A;  1OMJ A;  4IN9 A;  4ZR5 A;  4H49 A;  2O36 A;  1ZTQ A;  2AYK A;  3F15 A;  2O3E A;  3ZXH A;  1BSW A;  3DPF A;  4I35 A;  2OI0 A;  1I1I P;  1KBC A;  2POJ A;  2OW2 A;  3WV3 A;  1G12 A;  4G9L A;  1XUC A;  2N8R A;  3GBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...