3ZVSA

Crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution complexed with malonate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
MKIYIQPLSVNSHTVEVLANSLPKIFNAEVFVLPASDVSLKCYNASRRQYNSTCILRMLPPIKVTLGVTGKDIYAKGMNFVFGEAELGGARAVLSVFRLTTADSELYRERVVKEAVHEIGHVLGLKHCSNNCVMRFSNSVQDVDRKPVSFCRECASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARCHAEMETZINCIN
publication title Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 52
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07998 Peptidase_M54 Peptidase family M54
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3zvsA00
2Y6DA 4WZVA 3HBUP 3WV3A 3WV1A 1O0TA 2YB9A 1IAEA 1YCMA 2DDYA 4H30A 2POJA 3LIKA 3KMCA 1BM6A 2OY4A 5L7FA 1GXDA 3DPEA 4G9LA 1C3IA 2W15A 3MA2A 2JT6A 1XFUA 3RTTA 2V4BA 1GKDA 1MMQA 1USNA 2MZIA 3EDGA 1BZSA 3G5CA 4GWMA 2ERQA 2XS3A 1BKCI 4XM6A 1BKCE 2OXZA 5I0LA 4GQLA 4J4MA 4IUWA 2E3XA 1IAGA 3Q2HA 1AF0A 1BUVM 3LE9A 1QUAA 1B3DA 2OZRA 1FBLA 3LEAA 4XBHA 2YIGA 4G0DA 1D7XA 1XFYA 1A85A 1SRPA 1ROSA 3B92A 4DV8A 1OS2A 3UVCA 4A7BA 3AIGA 3EWJA 1KBCA 3ZXHA 2DW2A 1CGLA 4JA1A 2CLTA 1UTTA 2OW2A 3TS4A 3ZUKA 2AIGP 4DD8A 1Y8JA 4H82A 2X3AA 1UMSA 1OS9A 3AYKA 2CKIA 456CA 1XUDA 4WKIA 3OHLA 3N2VA 3HYGA 1H71P 1XFZA 3EHXA 1PWVA 1I1IP 1S4BP 1OM7A 3LQBA 2OW9A 3N2UA 1K7IA 3SHIA 3K7LA 3KHIA 1D8FA 4FXQA 1WNIA 2K2GA 4Q1LA 4I35A 4XM8A 3I7IA 1CXVA 1KUIA 5LABA 2E2DA 3KEKA 5D1UA 1JAOA 4IN9A 4EFSA 1G49A 4DPEA 3B8ZA 1ZXVA 2X3BA 1K7QA 2MLRA 3LIRA 3LJGA 2EROA 1OO9A 1IAAA 1CK7A 2AYKA 1DTHA 1Z3JA 3VTGA 3E8RA 1JKYA 3KEJA 1GE5A 1D5JA 1JK3A 1SLNA 2OVZA 3LKAA 1PWUA 3DPFA 3LJTA 1HFCA 1KUKA 4PKRA 3P1VA 2QPJA 2USNA 2J83A 2RJPA 1YP1A 1ATLA 1B8YA 5CZMA 1RMZA 4GR0A 1SMPA 4WK7A 3RTSA 5L79A 3G42A 1JJ9A 3F16A 2DW1A 1I73A 5I4OA 2W14A 1BSWA 1ZP5A 3DWBA 1IACA 1XFWA 1GO8P 966CA 830CA 2JSDA 1ND1A 1HY7A 1KUFA 1GO7P 1MMBA 3AYUA 2MZEA 2D1OA 3F15A 1UMTA 4GR3A 3F17A 1QICA 3EDIA 3KWVC 4R3VA 1Y0VA 1PWWA 1FM1A 3TSKA 4DF9A 3L0TA 1MMRA 1ASTA 4PKTA 3L0VA 3CKIA 3O2XA 2OVXA 3VI1A 5I43A 4GF1A 2O36A 2W13A 5D3CA 1OM6A 4IJOA 1ZXCA 5I12A 1CGEA 1UEAA 3V96B 2DDFA 4L19A 4A3WA 1JAQA 1UTZA 2OXUA 2WO8A 2KRJA 3KRYA 2TCLA 3LQ0A 4QKZA 4XM7A 2OW0A 2FV9A 1PWPA 1DMTA 3F1AA 3WV2A 2OW1A 4PKSA 4HMAA 1BKCA 2K9CA 1Q3AA 4ZR5A 2JIHA 3B2ZA 2J0TA 2W0DA 3ELMA 1OM8A 4GWNA 5BPAA 5JMYA 1I76A 3F19A 5D7WA 1XURA 5CUHA 1EUBA 3EDZA 4H2EA 3LJZA 1YQYA 1Y93A 3HY7A 4JP4A 3HBVP 2L0RA 2X7MA 1BQQM 1R1JA 1EAKA 1ZS0A 4JIJA 2O3EA 4ON1A 1PWQA 2RJQA 4FU4A 2Z2DA 4GUYA 2OXWA 3F18A 5BOTA 1XFXA 1A86A 2W12A 4JQGA 5BOYA 1JH1A 1AYKA 1RM8A 2D1NA 5D1TA 1GKCA 1G9KA 2SRTA 5H8XA 4CTHA 1R1HA 4FXYP 1SATA 1QIAA 4JPAA 3HDAP 4XCTA 1G05A 4H1QA 2N8RA 3KMEA 5B5PA 5D2BA 3LILA 2JT5A 3DSLA 3BA0A 4GR8A 1AKLA 2OY2A 1JAPA 1XUCA 3O64A 1HFSA 3EDHA 1JANA 3KECA 4H84A 1SLMA 1BUDA 3HB2P 1BIWA 1HTDA 3OHOA 1KUHA 4I03A 1K7GA 1IABA 1G12A 1HOVA 1L6JA 3U1RA 3K7NA 1FLSA 1G4KA 2PJTA 2XS4A 3DNGA 4L6TA 1QJIA 2MZHA 1R1IA 4AUOA 5I3MA 1GE6A 4HX3A 1QJJA 1YOUA 2Y6CA 3LGPA 1CIZA 2A8HA 5D1SA 1MNCA 4AYKA 2MLSA 1XFVA 3TVCA 2JNPA 1R55A 5B5OA 4L63A 4PKVA 2I47A 3HDBA 4AIGA 1C7KA 3HY9A 4ILWD 4H3XA 2WO9A 1SU3A 4H49A 3USNA 2WOAA 4WF6A 2HU6A 4PKQA 3LMCA 5CXAA 3ZVSA 4WKEA 2OI0A 1D8MA 3EHYA 3P24A 1ZTQA 1JIWP 1EB6A 2DW0A 5I2ZA 1CAQA 4PKWA 1HV5A 1O0QA 1CGFA 3GBOA 3I7GA 4PKUA 1C8TA 1OMJA 4H76A 1KAPP 1QIBA 1KUGA 1CQRA 3Q2GA 3LUMA 3DL1A 4FVLA 3TT4A 3LUNA 1R54A 1J7NA 1BQOA 1GE7A 1MMPA 1ZVXA 1JIZA 1IADA 2ERPA 2FV5A 3LK8A 3NX7A 2X3CA 4AXQA
chains in the Genus database with same CATH superfamily
2Y6DA 4WZVA 3HBUP 3WV3A 3WV1A 1O0TA 2YB9A 2YUFA 1IAEA 1YCMA 2DDYA 4H30A 2POJA 3LIKA 3KMCA 1BM6A 2OY4A 5L7FA 1GXDA 3DPEA 4G9LA 1C3IA 2W15A 3MA2A 2JT6A 1XFUA 3RTTA 2V4BA 1GKDA 1MMQA 1USNA 2MZIA 3EDGA 1BZSA 1XAXA 3G5CA 4GWMA 2ERQA 2XS3A 1BKCI 4XM6A 1BKCE 2OXZA 5I0LA 4GQLA 4J4MA 4IUWA 2E3XA 1IAGA 3Q2HA 1AF0A 1BUVM 3LE9A 1QUAA 1B3DA 2OZRA 1FBLA 3LEAA 4XBHA 2YIGA 4G0DA 1D7XA 1XFYA 1A85A 1SRPA 1ROSA 3B92A 4DV8A 1OS2A 3UVCA 4A7BA 3AIGA 3EWJA 1KBCA 3ZXHA 2DW2A 1CGLA 4JA1A 2CLTA 1UTTA 2OW2A 3TS4A 3ZUKA 2AIGP 4DD8A 1Y8JA 4H82A 2X3AA 1UMSA 1OS9A 3AYKA 2CKIA 456CA 1XUDA 4WKIA 3OHLA 3N2VA 3HYGA 1H71P 1TVIA 1XFZA 3EHXA 1PWVA 1I1IP 1S4BP 1OM7A 3LQBA 2OW9A 3N2UA 1K7IA 3SHIA 3K7LA 3KHIA 1D8FA 4FXQA 1WNIA 2K2GA 3DTKA 4Q1LA 4I35A 4XM8A 3I7IA 1CXVA 1KUIA 5LABA 2E2DA 3KEKA 5D1UA 1JAOA 4IN9A 4EFSA 1G49A 4DPEA 3B8ZA 1ZXVA 2X3BA 1K7QA 2MLRA 3LIRA 3LJGA 2EROA 1OO9A 1IAAA 1CK7A 2AYKA 1DTHA 1Z3JA 3VTGA 3E8RA 1JKYA 3KEJA 1GE5A 1D5JA 1JK3A 1SLNA 2OVZA 3LKAA 1PWUA 3DPFA 3LJTA 1HFCA 1KUKA 4PKRA 3P1VA 2QPJA 2USNA 2J83A 2RJPA 1YP1A 1ATLA 1B8YA 5CZMA 1RMZA 4GR0A 1SMPA 4WK7A 3RTSA 5L79A 3G42A 1JJ9A 3F16A 2DW1A 1I73A 5I4OA 2W14A 1BSWA 1ZP5A 3DWBA 1IACA 1XFWA 1GO8P 966CA 830CA 2JSDA 1ND1A 1HY7A 1KUFA 1GO7P 1MMBA 3AYUA 2MZEA 2D1OA 3F15A 1UMTA 4GR3A 3F17A 1QICA 3EDIA 3KWVC 4R3VA 1Y0VA 1PWWA 1FM1A 3TSKA 1OZ9A 4DF9A 3L0TA 1MMRA 1ASTA 4PKTA 3L0VA 3CKIA 3O2XA 2OVXA 3VI1A 5I43A 4GF1A 2O36A 2W13A 5D3CA 1OM6A 4IJOA 1ZXCA 5I12A 1CGEA 1UEAA 3V96B 2DDFA 4L19A 4A3WA 1JAQA 1UTZA 2OXUA 2WO8A 2KRJA 3KRYA 2TCLA 3LQ0A 4QKZA 4XM7A 2OW0A 2FV9A 1PWPA 1DMTA 3F1AA 3WV2A 2OW1A 4PKSA 4HMAA 1BKCA 2K9CA 1Q3AA 4ZR5A 2JIHA 3B2ZA 2J0TA 2W0DA 3ELMA 1OM8A 4GWNA 5BPAA 5JMYA 1I76A 3F19A 5D7WA 1XURA 5CUHA 1EUBA 3EDZA 4H2EA 3LJZA 1YQYA 1Y93A 3HY7A 4JP4A 3HBVP 2L0RA 2X7MA 1BQQM 1R1JA 1EAKA 1ZS0A 4JIJA 2O3EA 4ON1A 1PWQA 2RJQA 4FU4A 2Z2DA 4GUYA 2OXWA 3F18A 5BOTA 1XFXA 1A86A 2W12A 4JQGA 5BOYA 1JH1A 1AYKA 1RM8A 2D1NA 5D1TA 1GKCA 1G9KA 2SRTA 5H8XA 4CTHA 1R1HA 4FXYP 1SATA 1QIAA 4JPAA 3HDAP 4XCTA 1G05A 4H1QA 2N8RA 3KMEA 5B5PA 5D2BA 3LILA 2JT5A 3DSLA 3BA0A 4GR8A 1AKLA 2OY2A 1JAPA 1XUCA 3O64A 1HFSA 3EDHA 1JANA 3KECA 4H84A 1SLMA 1BUDA 3HB2P 1BIWA 1HTDA 3OHOA 1KUHA 4I03A 1K7GA 1IABA 1G12A 1HOVA 1XM5A 1L6JA 3U1RA 3K7NA 1FLSA 4L7AA 1G4KA 2PJTA 2XS4A 3DNGA 4L6TA 1QJIA 2MZHA 1R1IA 4AUOA 5I3MA 1GE6A 4HX3A 1QJJA 1YOUA 2Y6CA 3LGPA 1CIZA 2A8HA 5D1SA 1MNCA 4AYKA 2MLSA 1XFVA 3TVCA 2JNPA 1R55A 5B5OA 4L63A 4PKVA 2I47A 3HDBA 4AIGA 1C7KA 3HY9A 4ILWD 4H3XA 2WO9A 1SU3A 4H49A 3USNA 2WOAA 4WF6A 2HU6A 4PKQA 3LMCA 5CXAA 3ZVSA 4WKEA 2OI0A 1D8MA 3EHYA 3P24A 1ZTQA 1JIWP 1EB6A 2DW0A 5I2ZA 1CAQA 4PKWA 1HV5A 1O0QA 1CGFA 3GBOA 3I7GA 4PKUA 1C8TA 1OMJA 4H76A 1KAPP 3DTEA 1QIBA 1KUGA 1CQRA 3Q2GA 3LUMA 3DL1A 4FVLA 3TT4A 3LUNA 1R54A 1J7NA 1BQOA 1GE7A 1MMPA 1ZVXA 1JIZA 1IADA 2ERPA 2FV5A 3LK8A 3NX7A 2X3CA 4AXQA 3DTIA
chains in the Genus database with same CATH topology
2Y6DA 4WZVA 3HBUP 3WV3A 3WV1A 1O0TA 2YB9A 2YUFA 1IAEA 1YCMA 2DDYA 4H30A 2POJA 3LIKA 3KMCA 1BM6A 2OY4A 5L7FA 1GXDA 3DPEA 4G9LA 1C3IA 2W15A 3MA2A 2JT6A 1XFUA 3RTTA 2V4BA 1GKDA 1MMQA 1USNA 2MZIA 3EDGA 1BZSA 3G5CA 4GWMA 2ERQA 2XS3A 1BKCI 4XM6A 1BKCE 2OXZA 5I0LA 4GQLA 4J4MA 4IUWA 2E3XA 1IAGA 3Q2HA 1AF0A 1BUVM 3LE9A 1QUAA 1B3DA 2OZRA 1FBLA 3LEAA 4XBHA 2YIGA 4G0DA 1D7XA 1XFYA 1A85A 1SRPA 1ROSA 3B92A 4DV8A 1OS2A 3UVCA 4A7BA 3AIGA 3EWJA 1KBCA 3ZXHA 2DW2A 1CGLA 4JA1A 2CLTA 1UTTA 2OW2A 3TS4A 3ZUKA 2AIGP 4DD8A 1Y8JA 4H82A 2X3AA 1UMSA 1OS9A 3AYKA 2CKIA 456CA 1XUDA 4WKIA 3OHLA 3N2VA 3HYGA 1H71P 1XFZA 3EHXA 1PWVA 1I1IP 1S4BP 1OM7A 3LQBA 2OW9A 3N2UA 1K7IA 3SHIA 3K7LA 3KHIA 1D8FA 4FXQA 1WNIA 2K2GA 3DTKA 4Q1LA 4I35A 4XM8A 3I7IA 1CXVA 1KUIA 5LABA 2E2DA 3KEKA 5D1UA 1JAOA 4IN9A 4EFSA 1G49A 4DPEA 3B8ZA 1ZXVA 2X3BA 1K7QA 2MLRA 3LIRA 3LJGA 2EROA 1OO9A 1IAAA 1CK7A 2AYKA 1DTHA 1Z3JA 3VTGA 3E8RA 1JKYA 3KEJA 1GE5A 1D5JA 1JK3A 1SLNA 2OVZA 3LKAA 1PWUA 3DPFA 3LJTA 1HFCA 1KUKA 4PKRA 3P1VA 2QPJA 2USNA 2J83A 2RJPA 1YP1A 1ATLA 1B8YA 5CZMA 1RMZA 4GR0A 1SMPA 4WK7A 3RTSA 5L79A 3G42A 1JJ9A 3F16A 2DW1A 1I73A 5I4OA 2W14A 1BSWA 1ZP5A 3DWBA 1IACA 1XFWA 1GO8P 966CA 830CA 2JSDA 1ND1A 1HY7A 1KUFA 1GO7P 1MMBA 3AYUA 2MZEA 2D1OA 3F15A 1UMTA 4GR3A 3F17A 1QICA 3EDIA 3KWVC 4R3VA 1Y0VA 1PWWA 1FM1A 3TSKA 4DF9A 3L0TA 1MMRA 1ASTA 4PKTA 3L0VA 3CKIA 3O2XA 2OVXA 3VI1A 5I43A 4GF1A 2O36A 2W13A 5D3CA 1OM6A 4IJOA 1ZXCA 5I12A 1CGEA 1UEAA 3V96B 2DDFA 4L19A 4A3WA 1JAQA 1UTZA 2OXUA 2WO8A 2KRJA 3KRYA 2TCLA 3LQ0A 4QKZA 4XM7A 2OW0A 2FV9A 1PWPA 1DMTA 3F1AA 3WV2A 2OW1A 4PKSA 4HMAA 1BKCA 2K9CA 1Q3AA 4ZR5A 2JIHA 3B2ZA 2J0TA 2W0DA 3ELMA 1OM8A 4GWNA 5BPAA 5JMYA 1I76A 3F19A 5D7WA 1XURA 5CUHA 1EUBA 3EDZA 4H2EA 3LJZA 1YQYA 1Y93A 3HY7A 4JP4A 3HBVP 2L0RA 2X7MA 1BQQM 1R1JA 1EAKA 1ZS0A 4JIJA 2O3EA 4ON1A 1PWQA 2RJQA 4FU4A 2Z2DA 4GUYA 2OXWA 3F18A 5BOTA 1XFXA 1A86A 2W12A 4JQGA 5BOYA 1JH1A 1AYKA 1RM8A 2D1NA 5D1TA 1GKCA 1G9KA 2SRTA 5H8XA 4CTHA 1R1HA 4FXYP 1SATA 1QIAA 4JPAA 3HDAP 4XCTA 1G05A 4H1QA 2N8RA 3KMEA 5B5PA 5D2BA 3LILA 2JT5A 3DSLA 3BA0A 4GR8A 1AKLA 2OY2A 1JAPA 1XUCA 3O64A 1HFSA 3EDHA 1JANA 3KECA 4H84A 1SLMA 1BUDA 3HB2P 1BIWA 1HTDA 3OHOA 1KUHA 4I03A 1K7GA 1IABA 1G12A 1HOVA 1L6JA 3U1RA 3K7NA 1FLSA 4L7AA 1G4KA 2PJTA 2XS4A 3DNGA 4L6TA 1QJIA 2MZHA 1R1IA 4AUOA 5I3MA 1GE6A 4HX3A 1QJJA 1YOUA 2Y6CA 3LGPA 1CIZA 2A8HA 5D1SA 1MNCA 4AYKA 2MLSA 1XFVA 3TVCA 2JNPA 1R55A 5B5OA 4L63A 4PKVA 2I47A 3HDBA 4AIGA 1C7KA 3HY9A 4ILWD 4H3XA 2WO9A 1SU3A 4H49A 3USNA 2WOAA 4WF6A 2HU6A 4PKQA 3LMCA 5CXAA 3ZVSA 4WKEA 2OI0A 1D8MA 3EHYA 3P24A 1ZTQA 1JIWP 1EB6A 2DW0A 5I2ZA 1CAQA 4PKWA 1HV5A 1O0QA 1CGFA 3GBOA 3I7GA 4PKUA 1C8TA 1OMJA 4H76A 1KAPP 3DTEA 1QIBA 1KUGA 1CQRA 3Q2GA 3LUMA 3DL1A 4FVLA 3TT4A 3LUNA 1R54A 1J7NA 1BQOA 1GE7A 1MMPA 1ZVXA 1JIZA 1IADA 2ERPA 2FV5A 3LK8A 3NX7A 2X3CA 4AXQA 3DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6D A;  4WZV A;  3HBU P;  3WV3 A;  3WV1 A;  1O0T A;  2YB9 A;  1IAE A;  1YCM A;  2DDY A;  4H30 A;  2POJ A;  3LIK A;  3KMC A;  1BM6 A;  2OY4 A;  5L7F A;  1GXD A;  3DPE A;  4G9L A;  1C3I A;  2W15 A;  3MA2 A;  2JT6 A;  1XFU A;  3RTT A;  2V4B A;  1GKD A;  1MMQ A;  1USN A;  2MZI A;  3EDG A;  1BZS A;  3G5C A;  4GWM A;  2ERQ A;  2XS3 A;  1BKC I;  4XM6 A;  1BKC E;  2OXZ A;  5I0L A;  4GQL A;  4J4M A;  4IUW A;  2E3X A;  1IAG A;  3Q2H A;  1AF0 A;  1BUV M;  3LE9 A;  1QUA A;  1B3D A;  2OZR A;  1FBL A;  3LEA A;  4XBH A;  2YIG A;  4G0D A;  1D7X A;  1XFY A;  1A85 A;  1SRP A;  1ROS A;  3B92 A;  4DV8 A;  1OS2 A;  3UVC A;  4A7B A;  3AIG A;  3EWJ A;  1KBC A;  3ZXH A;  2DW2 A;  1CGL A;  4JA1 A;  2CLT A;  1UTT A;  2OW2 A;  3TS4 A;  3ZUK A;  2AIG P;  4DD8 A;  1Y8J A;  4H82 A;  2X3A A;  1UMS A;  1OS9 A;  3AYK A;  2CKI A;  456C A;  1XUD A;  4WKI A;  3OHL A;  3N2V A;  3HYG A;  1H71 P;  1XFZ A;  3EHX A;  1PWV A;  1I1I P;  1S4B P;  1OM7 A;  3LQB A;  2OW9 A;  3N2U A;  1K7I A;  3SHI A;  3K7L A;  3KHI A;  1D8F A;  4FXQ A;  1WNI A;  2K2G A;  4Q1L A;  4I35 A;  4XM8 A;  3I7I A;  1CXV A;  1KUI A;  5LAB A;  2E2D A;  3KEK A;  5D1U A;  1JAO A;  4IN9 A;  4EFS A;  1G49 A;  4DPE A;  3B8Z A;  1ZXV A;  2X3B A;  1K7Q A;  2MLR A;  3LIR A;  3LJG A;  2ERO A;  1OO9 A;  1IAA A;  1CK7 A;  2AYK A;  1DTH A;  1Z3J A;  3VTG A;  3E8R A;  1JKY A;  3KEJ A;  1GE5 A;  1D5J A;  1JK3 A;  1SLN A;  2OVZ A;  3LKA A;  1PWU A;  3DPF A;  3LJT A;  1HFC A;  1KUK A;  4PKR A;  3P1V A;  2QPJ A;  2USN A;  2J83 A;  2RJP A;  1YP1 A;  1ATL A;  1B8Y A;  5CZM A;  1RMZ A;  4GR0 A;  1SMP A;  4WK7 A;  3RTS A;  5L79 A;  3G42 A;  1JJ9 A;  3F16 A;  2DW1 A;  1I73 A;  5I4O A;  2W14 A;  1BSW A;  1ZP5 A;  3DWB A;  1IAC A;  1XFW A;  1GO8 P;  966C A;  830C A;  2JSD A;  1ND1 A;  1HY7 A;  1KUF A;  1GO7 P;  1MMB A;  3AYU A;  2MZE A;  2D1O A;  3F15 A;  1UMT A;  4GR3 A;  3F17 A;  1QIC A;  3EDI A;  3KWV C;  4R3V A;  1Y0V A;  1PWW A;  1FM1 A;  3TSK A;  4DF9 A;  3L0T A;  1MMR A;  1AST A;  4PKT A;  3L0V A;  3CKI A;  3O2X A;  2OVX A;  3VI1 A;  5I43 A;  4GF1 A;  2O36 A;  2W13 A;  5D3C A;  1OM6 A;  4IJO A;  1ZXC A;  5I12 A;  1CGE A;  1UEA A;  3V96 B;  2DDF A;  4L19 A;  4A3W A;  1JAQ A;  1UTZ A;  2OXU A;  2WO8 A;  2KRJ A;  3KRY A;  2TCL A;  3LQ0 A;  4QKZ A;  4XM7 A;  2OW0 A;  2FV9 A;  1PWP A;  1DMT A;  3F1A A;  3WV2 A;  2OW1 A;  4PKS A;  4HMA A;  1BKC A;  2K9C A;  1Q3A A;  4ZR5 A;  2JIH A;  3B2Z A;  2J0T A;  2W0D A;  3ELM A;  1OM8 A;  4GWN A;  5BPA A;  5JMY A;  1I76 A;  3F19 A;  5D7W A;  1XUR A;  5CUH A;  1EUB A;  3EDZ A;  4H2E A;  3LJZ A;  1YQY A;  1Y93 A;  3HY7 A;  4JP4 A;  3HBV P;  2L0R A;  2X7M A;  1BQQ M;  1R1J A;  1EAK A;  1ZS0 A;  4JIJ A;  2O3E A;  4ON1 A;  1PWQ A;  2RJQ A;  4FU4 A;  2Z2D A;  4GUY A;  2OXW A;  3F18 A;  5BOT A;  1XFX A;  1A86 A;  2W12 A;  4JQG A;  5BOY A;  1JH1 A;  1AYK A;  1RM8 A;  2D1N A;  5D1T A;  1GKC A;  1G9K A;  2SRT A;  5H8X A;  4CTH A;  1R1H A;  4FXY P;  1SAT A;  1QIA A;  4JPA A;  3HDA P;  4XCT A;  1G05 A;  4H1Q A;  2N8R A;  3KME A;  5B5P A;  5D2B A;  3LIL A;  2JT5 A;  3DSL A;  3BA0 A;  4GR8 A;  1AKL A;  2OY2 A;  1JAP A;  1XUC A;  3O64 A;  1HFS A;  3EDH A;  1JAN A;  3KEC A;  4H84 A;  1SLM A;  1BUD A;  3HB2 P;  1BIW A;  1HTD A;  3OHO A;  1KUH A;  4I03 A;  1K7G A;  1IAB A;  1G12 A;  1HOV A;  1L6J A;  3U1R A;  3K7N A;  1FLS A;  1G4K A;  2PJT A;  2XS4 A;  3DNG A;  4L6T A;  1QJI A;  2MZH A;  1R1I A;  4AUO A;  5I3M A;  1GE6 A;  4HX3 A;  1QJJ A;  1YOU A;  2Y6C A;  3LGP A;  1CIZ A;  2A8H A;  5D1S A;  1MNC A;  4AYK A;  2MLS A;  1XFV A;  3TVC A;  2JNP A;  1R55 A;  5B5O A;  4L63 A;  4PKV A;  2I47 A;  3HDB A;  4AIG A;  1C7K A;  3HY9 A;  4ILW D;  4H3X A;  2WO9 A;  1SU3 A;  4H49 A;  3USN A;  2WOA A;  4WF6 A;  2HU6 A;  4PKQ A;  3LMC A;  5CXA A;  3ZVS A;  4WKE A;  2OI0 A;  1D8M A;  3EHY A;  3P24 A;  1ZTQ A;  1JIW P;  1EB6 A;  2DW0 A;  5I2Z A;  1CAQ A;  4PKW A;  1HV5 A;  1O0Q A;  1CGF A;  3GBO A;  3I7G A;  4PKU A;  1C8T A;  1OMJ A;  4H76 A;  1KAP P;  1QIB A;  1KUG A;  1CQR A;  3Q2G A;  3LUM A;  3DL1 A;  4FVL A;  3TT4 A;  3LUN A;  1R54 A;  1J7N A;  1BQO A;  1GE7 A;  1MMP A;  1ZVX A;  1JIZ A;  1IAD A;  2ERP A;  2FV5 A;  3LK8 A;  3NX7 A;  2X3C A;  4AXQ A; 
#chains in the Genus database with same CATH topology
 2Y6D A;  4WZV A;  3HBU P;  3WV3 A;  3WV1 A;  1O0T A;  2YB9 A;  2YUF A;  1IAE A;  1YCM A;  2DDY A;  4H30 A;  2POJ A;  3LIK A;  3KMC A;  1BM6 A;  2OY4 A;  5L7F A;  1GXD A;  3DPE A;  4G9L A;  1C3I A;  2W15 A;  3MA2 A;  2JT6 A;  1XFU A;  3RTT A;  2V4B A;  1GKD A;  1MMQ A;  1USN A;  2MZI A;  3EDG A;  1BZS A;  1XAX A;  3G5C A;  4GWM A;  2ERQ A;  2XS3 A;  1BKC I;  4XM6 A;  1BKC E;  2OXZ A;  5I0L A;  4GQL A;  4J4M A;  4IUW A;  2E3X A;  1IAG A;  3Q2H A;  1AF0 A;  1BUV M;  3LE9 A;  1QUA A;  1B3D A;  2OZR A;  1FBL A;  3LEA A;  4XBH A;  2YIG A;  4G0D A;  1D7X A;  1XFY A;  1A85 A;  1SRP A;  1ROS A;  3B92 A;  4DV8 A;  1OS2 A;  3UVC A;  4A7B A;  3AIG A;  3EWJ A;  1KBC A;  3ZXH A;  2DW2 A;  1CGL A;  4JA1 A;  2CLT A;  1UTT A;  2OW2 A;  3TS4 A;  3ZUK A;  2AIG P;  4DD8 A;  1Y8J A;  4H82 A;  2X3A A;  1UMS A;  1OS9 A;  3AYK A;  2CKI A;  456C A;  1XUD A;  4WKI A;  3OHL A;  3N2V A;  3HYG A;  1H71 P;  1TVI A;  1XFZ A;  3EHX A;  1PWV A;  1I1I P;  1S4B P;  1OM7 A;  3LQB A;  2OW9 A;  3N2U A;  1K7I A;  3SHI A;  3K7L A;  3KHI A;  1D8F A;  4FXQ A;  1WNI A;  2K2G A;  3DTK A;  4Q1L A;  4I35 A;  4XM8 A;  3I7I A;  1CXV A;  1KUI A;  5LAB A;  2E2D A;  3KEK A;  5D1U A;  1JAO A;  4IN9 A;  4EFS A;  1G49 A;  4DPE A;  3B8Z A;  1ZXV A;  2X3B A;  1K7Q A;  2MLR A;  3LIR A;  3LJG A;  2ERO A;  1OO9 A;  1IAA A;  1CK7 A;  2AYK A;  1DTH A;  1Z3J A;  3VTG A;  3E8R A;  1JKY A;  3KEJ A;  1GE5 A;  1D5J A;  1JK3 A;  1SLN A;  2OVZ A;  3LKA A;  1PWU A;  3DPF A;  3LJT A;  1HFC A;  1KUK A;  4PKR A;  3P1V A;  2QPJ A;  2USN A;  2J83 A;  2RJP A;  1YP1 A;  1ATL A;  1B8Y A;  5CZM A;  1RMZ A;  4GR0 A;  1SMP A;  4WK7 A;  3RTS A;  5L79 A;  3G42 A;  1JJ9 A;  3F16 A;  2DW1 A;  1I73 A;  5I4O A;  2W14 A;  1BSW A;  1ZP5 A;  3DWB A;  1IAC A;  1XFW A;  1GO8 P;  966C A;  830C A;  2JSD A;  1ND1 A;  1HY7 A;  1KUF A;  1GO7 P;  1MMB A;  3AYU A;  2MZE A;  2D1O A;  3F15 A;  1UMT A;  4GR3 A;  3F17 A;  1QIC A;  3EDI A;  3KWV C;  4R3V A;  1Y0V A;  1PWW A;  1FM1 A;  3TSK A;  1OZ9 A;  4DF9 A;  3L0T A;  1MMR A;  1AST A;  4PKT A;  3L0V A;  3CKI A;  3O2X A;  2OVX A;  3VI1 A;  5I43 A;  4GF1 A;  2O36 A;  2W13 A;  5D3C A;  1OM6 A;  4IJO A;  1ZXC A;  5I12 A;  1CGE A;  1UEA A;  3V96 B;  2DDF A;  4L19 A;  4A3W A;  1JAQ A;  1UTZ A;  2OXU A;  2WO8 A;  2KRJ A;  3KRY A;  2TCL A;  3LQ0 A;  4QKZ A;  4XM7 A;  2OW0 A;  2FV9 A;  1PWP A;  1DMT A;  3F1A A;  3WV2 A;  2OW1 A;  4PKS A;  4HMA A;  1BKC A;  2K9C A;  1Q3A A;  4ZR5 A;  2JIH A;  3B2Z A;  2J0T A;  2W0D A;  3ELM A;  1OM8 A;  4GWN A;  5BPA A;  5JMY A;  1I76 A;  3F19 A;  5D7W A;  1XUR A;  5CUH A;  1EUB A;  3EDZ A;  4H2E A;  3LJZ A;  1YQY A;  1Y93 A;  3HY7 A;  4JP4 A;  3HBV P;  2L0R A;  2X7M A;  1BQQ M;  1R1J A;  1EAK A;  1ZS0 A;  4JIJ A;  2O3E A;  4ON1 A;  1PWQ A;  2RJQ A;  4FU4 A;  2Z2D A;  4GUY A;  2OXW A;  3F18 A;  5BOT A;  1XFX A;  1A86 A;  2W12 A;  4JQG A;  5BOY A;  1JH1 A;  1AYK A;  1RM8 A;  2D1N A;  5D1T A;  1GKC A;  1G9K A;  2SRT A;  5H8X A;  4CTH A;  1R1H A;  4FXY P;  1SAT A;  1QIA A;  4JPA A;  3HDA P;  4XCT A;  1G05 A;  4H1Q A;  2N8R A;  3KME A;  5B5P A;  5D2B A;  3LIL A;  2JT5 A;  3DSL A;  3BA0 A;  4GR8 A;  1AKL A;  2OY2 A;  1JAP A;  1XUC A;  3O64 A;  1HFS A;  3EDH A;  1JAN A;  3KEC A;  4H84 A;  1SLM A;  1BUD A;  3HB2 P;  1BIW A;  1HTD A;  3OHO A;  1KUH A;  4I03 A;  1K7G A;  1IAB A;  1G12 A;  1HOV A;  1XM5 A;  1L6J A;  3U1R A;  3K7N A;  1FLS A;  4L7A A;  1G4K A;  2PJT A;  2XS4 A;  3DNG A;  4L6T A;  1QJI A;  2MZH A;  1R1I A;  4AUO A;  5I3M A;  1GE6 A;  4HX3 A;  1QJJ A;  1YOU A;  2Y6C A;  3LGP A;  1CIZ A;  2A8H A;  5D1S A;  1MNC A;  4AYK A;  2MLS A;  1XFV A;  3TVC A;  2JNP A;  1R55 A;  5B5O A;  4L63 A;  4PKV A;  2I47 A;  3HDB A;  4AIG A;  1C7K A;  3HY9 A;  4ILW D;  4H3X A;  2WO9 A;  1SU3 A;  4H49 A;  3USN A;  2WOA A;  4WF6 A;  2HU6 A;  4PKQ A;  3LMC A;  5CXA A;  3ZVS A;  4WKE A;  2OI0 A;  1D8M A;  3EHY A;  3P24 A;  1ZTQ A;  1JIW P;  1EB6 A;  2DW0 A;  5I2Z A;  1CAQ A;  4PKW A;  1HV5 A;  1O0Q A;  1CGF A;  3GBO A;  3I7G A;  4PKU A;  1C8T A;  1OMJ A;  4H76 A;  1KAP P;  3DTE A;  1QIB A;  1KUG A;  1CQR A;  3Q2G A;  3LUM A;  3DL1 A;  4FVL A;  3TT4 A;  3LUN A;  1R54 A;  1J7N A;  1BQO A;  1GE7 A;  1MMP A;  1ZVX A;  1JIZ A;  1IAD A;  2ERP A;  2FV5 A;  3LK8 A;  3NX7 A;  2X3C A;  4AXQ A;  3DTI A; 
#chains in the Genus database with same CATH homology
 2Y6D A;  4WZV A;  3HBU P;  3WV3 A;  3WV1 A;  1O0T A;  2YB9 A;  2YUF A;  1IAE A;  1YCM A;  2DDY A;  4H30 A;  2POJ A;  3LIK A;  3KMC A;  1BM6 A;  2OY4 A;  5L7F A;  1GXD A;  3DPE A;  4G9L A;  1C3I A;  2W15 A;  3MA2 A;  2JT6 A;  1XFU A;  3RTT A;  2V4B A;  1GKD A;  1MMQ A;  1USN A;  2MZI A;  3EDG A;  1BZS A;  3G5C A;  4GWM A;  2ERQ A;  2XS3 A;  1BKC I;  4XM6 A;  1BKC E;  2OXZ A;  5I0L A;  4GQL A;  4J4M A;  4IUW A;  2E3X A;  1IAG A;  3Q2H A;  1AF0 A;  1BUV M;  3LE9 A;  1QUA A;  1B3D A;  2OZR A;  1FBL A;  3LEA A;  4XBH A;  2YIG A;  4G0D A;  1D7X A;  1XFY A;  1A85 A;  1SRP A;  1ROS A;  3B92 A;  4DV8 A;  1OS2 A;  3UVC A;  4A7B A;  3AIG A;  3EWJ A;  1KBC A;  3ZXH A;  2DW2 A;  1CGL A;  4JA1 A;  2CLT A;  1UTT A;  2OW2 A;  3TS4 A;  3ZUK A;  2AIG P;  4DD8 A;  1Y8J A;  4H82 A;  2X3A A;  1UMS A;  1OS9 A;  3AYK A;  2CKI A;  456C A;  1XUD A;  4WKI A;  3OHL A;  3N2V A;  3HYG A;  1H71 P;  1XFZ A;  3EHX A;  1PWV A;  1I1I P;  1S4B P;  1OM7 A;  3LQB A;  2OW9 A;  3N2U A;  1K7I A;  3SHI A;  3K7L A;  3KHI A;  1D8F A;  4FXQ A;  1WNI A;  2K2G A;  3DTK A;  4Q1L A;  4I35 A;  4XM8 A;  3I7I A;  1CXV A;  1KUI A;  5LAB A;  2E2D A;  3KEK A;  5D1U A;  1JAO A;  4IN9 A;  4EFS A;  1G49 A;  4DPE A;  3B8Z A;  1ZXV A;  2X3B A;  1K7Q A;  2MLR A;  3LIR A;  3LJG A;  2ERO A;  1OO9 A;  1IAA A;  1CK7 A;  2AYK A;  1DTH A;  1Z3J A;  3VTG A;  3E8R A;  1JKY A;  3KEJ A;  1GE5 A;  1D5J A;  1JK3 A;  1SLN A;  2OVZ A;  3LKA A;  1PWU A;  3DPF A;  3LJT A;  1HFC A;  1KUK A;  4PKR A;  3P1V A;  2QPJ A;  2USN A;  2J83 A;  2RJP A;  1YP1 A;  1ATL A;  1B8Y A;  5CZM A;  1RMZ A;  4GR0 A;  1SMP A;  4WK7 A;  3RTS A;  5L79 A;  3G42 A;  1JJ9 A;  3F16 A;  2DW1 A;  1I73 A;  5I4O A;  2W14 A;  1BSW A;  1ZP5 A;  3DWB A;  1IAC A;  1XFW A;  1GO8 P;  966C A;  830C A;  2JSD A;  1ND1 A;  1HY7 A;  1KUF A;  1GO7 P;  1MMB A;  3AYU A;  2MZE A;  2D1O A;  3F15 A;  1UMT A;  4GR3 A;  3F17 A;  1QIC A;  3EDI A;  3KWV C;  4R3V A;  1Y0V A;  1PWW A;  1FM1 A;  3TSK A;  4DF9 A;  3L0T A;  1MMR A;  1AST A;  4PKT A;  3L0V A;  3CKI A;  3O2X A;  2OVX A;  3VI1 A;  5I43 A;  4GF1 A;  2O36 A;  2W13 A;  5D3C A;  1OM6 A;  4IJO A;  1ZXC A;  5I12 A;  1CGE A;  1UEA A;  3V96 B;  2DDF A;  4L19 A;  4A3W A;  1JAQ A;  1UTZ A;  2OXU A;  2WO8 A;  2KRJ A;  3KRY A;  2TCL A;  3LQ0 A;  4QKZ A;  4XM7 A;  2OW0 A;  2FV9 A;  1PWP A;  1DMT A;  3F1A A;  3WV2 A;  2OW1 A;  4PKS A;  4HMA A;  1BKC A;  2K9C A;  1Q3A A;  4ZR5 A;  2JIH A;  3B2Z A;  2J0T A;  2W0D A;  3ELM A;  1OM8 A;  4GWN A;  5BPA A;  5JMY A;  1I76 A;  3F19 A;  5D7W A;  1XUR A;  5CUH A;  1EUB A;  3EDZ A;  4H2E A;  3LJZ A;  1YQY A;  1Y93 A;  3HY7 A;  4JP4 A;  3HBV P;  2L0R A;  2X7M A;  1BQQ M;  1R1J A;  1EAK A;  1ZS0 A;  4JIJ A;  2O3E A;  4ON1 A;  1PWQ A;  2RJQ A;  4FU4 A;  2Z2D A;  4GUY A;  2OXW A;  3F18 A;  5BOT A;  1XFX A;  1A86 A;  2W12 A;  4JQG A;  5BOY A;  1JH1 A;  1AYK A;  1RM8 A;  2D1N A;  5D1T A;  1GKC A;  1G9K A;  2SRT A;  5H8X A;  4CTH A;  1R1H A;  4FXY P;  1SAT A;  1QIA A;  4JPA A;  3HDA P;  4XCT A;  1G05 A;  4H1Q A;  2N8R A;  3KME A;  5B5P A;  5D2B A;  3LIL A;  2JT5 A;  3DSL A;  3BA0 A;  4GR8 A;  1AKL A;  2OY2 A;  1JAP A;  1XUC A;  3O64 A;  1HFS A;  3EDH A;  1JAN A;  3KEC A;  4H84 A;  1SLM A;  1BUD A;  3HB2 P;  1BIW A;  1HTD A;  3OHO A;  1KUH A;  4I03 A;  1K7G A;  1IAB A;  1G12 A;  1HOV A;  1L6J A;  3U1R A;  3K7N A;  1FLS A;  4L7A A;  1G4K A;  2PJT A;  2XS4 A;  3DNG A;  4L6T A;  1QJI A;  2MZH A;  1R1I A;  4AUO A;  5I3M A;  1GE6 A;  4HX3 A;  1QJJ A;  1YOU A;  2Y6C A;  3LGP A;  1CIZ A;  2A8H A;  5D1S A;  1MNC A;  4AYK A;  2MLS A;  1XFV A;  3TVC A;  2JNP A;  1R55 A;  5B5O A;  4L63 A;  4PKV A;  2I47 A;  3HDB A;  4AIG A;  1C7K A;  3HY9 A;  4ILW D;  4H3X A;  2WO9 A;  1SU3 A;  4H49 A;  3USN A;  2WOA A;  4WF6 A;  2HU6 A;  4PKQ A;  3LMC A;  5CXA A;  3ZVS A;  4WKE A;  2OI0 A;  1D8M A;  3EHY A;  3P24 A;  1ZTQ A;  1JIW P;  1EB6 A;  2DW0 A;  5I2Z A;  1CAQ A;  4PKW A;  1HV5 A;  1O0Q A;  1CGF A;  3GBO A;  3I7G A;  4PKU A;  1C8T A;  1OMJ A;  4H76 A;  1KAP P;  3DTE A;  1QIB A;  1KUG A;  1CQR A;  3Q2G A;  3LUM A;  3DL1 A;  4FVL A;  3TT4 A;  3LUN A;  1R54 A;  1J7N A;  1BQO A;  1GE7 A;  1MMP A;  1ZVX A;  1JIZ A;  1IAD A;  2ERP A;  2FV5 A;  3LK8 A;  3NX7 A;  2X3C A;  4AXQ A;  3DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...